SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor Z    

ID / Description / Sequence
1 >lcl|NP_001011973.1|Plus111612606..11613928 NW_047713 actin-like 7a Actl7a __SEG__ Chr5 {Rattus norvegicus} MSLDAVWAPQTANIGDGPAKKASDQTSMQTQVLQTASLRDGPAKRAVWVRRDNAEKEEPVKSAVSKDRPRLEVTKAVVVDLGTGFCKCGFAGLPKPTHKISTTVGKPYME
TAKTGDNRKETFVGRELFNPDIHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFETFNTPAMHIAYQSRLSMYSYGRTSGL
VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTNYLMNLMNNCGKHFSEDHLSIVEDIKTKCCFVALDPIEEKKIPPSEHEIHYTLPDGKEIRLGQERFLCSEMFFKP
SLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLRGFPNRLQKELSSMCPNDTPQVNVLPERDTAVWTGGSILASLQGFQPLWVHRLEYEEHGPFFLYRRCF
*
2 >lcl|NP_001013167.1|Plus1complement(20507433..20508521) NW_047560 mesoderm development candidate 1 Mesdc1 __SEG__ Chr1 {Rattus norvegicus} MASGSAGKPTGEAASPAPGSAVGGASSQPRKRLVSICDHCKGKMQLVADLLLLSSEARPVLFEGPASPGAGAESFEQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAGD
SLVELGDLVVSLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQGCAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVKC
MSTSASALLACVREVKAAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSTEGKAVQTAILGGAMSVVSACVLLTQCLRDLAQHPDGSAKMSDHRERLRNSA
CAVSEGCTLLSQALRERSSPRTLPPVNSNSVN*
3 >lcl|NP_001013190.1|Plus120747424..20748116 NW_047773 four and a half LIM domains 4 Fhl4 __SEG__ Chr7 {Rattus norvegicus} MSEFKCHHCRESLQGKKYVQKDNFNYCVTCFDAHCANICVECNKPIGADSKEVCYKERFWHNTCFKCSKCLQPLATETFVVWDNKILCNNCVSQQAFPKCKGCLKDIKQG
EQSVEYKGTIWHKDCFVCSNCKEVIGTKTFFPKDEGFYCVACYDILFTKYCVKCNKPITSGGVSYQDQPWHSECFVCVNCSKELSEQRFTVMDDKIFCVDCYKNFIAKKC
AGCKNPITGFG
4 >lcl|NP_001013915.1|Plus1complement(7456384..7457619) NW_047555 actin-like protein 9 LOC292516 __SEG__ Chr1 {Rattus norvegicus} MDVNGPKRWEPHRSLDLNPRSTPVYKSPLQEPCGVFGNKGTTKMSGVVIDMGTGICKMGFAGQTRPTYIVRNIVGCQPKRRTTMEQPKMEMFIGEAAHARPELTLMHPVR
NGIVVDWEAAEFIWRHILENDLRLDTQDHPLLFTDPPFNPASNREKLVEVAFESLHSPAIYVASQSVLSVYANGRVNGLVVDTGHGVSYTVPVFQGYNLPSGIQRMDLAG
HYLTKFLAEKILRSSFAVKKEDMDTMENIKQQYCYVALDFQKEQGRPDEKFRRCLKLPDGQMITVGKELFQCPELLFHPPDTSGPSSLGLPSMVEHSLSTVPQELRADME
QNVLLCGGSSLFTGFEGRFKTELLRRLGPEAHVVVVAQANRNLSVWIGGSILASLCAFQTRWVLREQYEEHGPDIVLRKCS*
5 >lcl|NP_001013983.1|Plus13852263..3853393 NW_048048 actin-related protein T1 Actrt1 __SEG__ ChrX {Rattus norvegicus} MLNTARLDNPAVIFDNGSGLCKVGISGEIVPRHVINSVVGHPKFNIPSARSNRKRYFVGEEAQCMYDGLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMT
EPSLNPRETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGVTCTVPIYEGYSLPRAITKLYVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKL
CTVSWGSKDSEKCYQRSLSEYKLPDGNTIQMSDHLCQVPEVLFTPEHLGIHDLGISKMVCNSIMKCDTDIQENLFAEIVLSGGTTLFPGLQDRLLKELEVLAFEGTPIKI
TASPDRCYSAWIGGSVMTSLTTFKQMWVTAEDFKEYGAFVVQRKCF*
6 >lcl|NP_001019959.1|Plus112434837..12438493 NW_047801 hypothetical protein LOC316000 RGD1310036 __SEG__ Chr8 {Rattus norvegicus} MEDTKKVGGPDPSGPQGHLLPSSQQLRGGFKGSQGPWMNSRPLYSKQGLSLSTGAIADMACSSISQAPASQPPLQLLHNSAQVSSQCDYAQASQDTPRFSSNPFPNPTVG
TQEHLLMDDGTQTLPMCTDDDADDQGQYKLNLSQIQLQIGKESKAPAKVLVGWGKGTCNLGQMASMGSRKSRWLPYFLSGENGVVEGQAPLLTVTQAAVQDQGQDKGPCL
AQPPTPNKATSSPSLPLPISIPASVAALSGLPAPAAVKPYAYCPNYLTNAAAATKDLPLDLKNNGGNQLSALSDSSKKDKLYFFLKETPPTPVPSPAEFSPKIQDQEVAR
MPVPVKPFEDPAKNCLVHASRPDPSTPASEPLNAFKTQENSHKLCSSQPDKQPPNACNNNNCSNVPLPALQQGAYNKQPLPQTCRGVIQSPISGAPTCQLHDAVEDHVLV
FDMATGNTRMGLLCHDPMGSRAVLVGLTPSHPSTHVSENTLSAWSLPRPILSPNSDHPSLWSTTAVLSSPVPSSLSAGSYREVALVSKEARHNLEPRSLGTESPMRTLAR
SGVPGTPVQYGEKIPAPAPDPSWPKSDAEKIDTDRTIWKLDSPVVQPRKLQWIKPDPVSTADTQIVSRPPLQDRAGINNQQMVHPSGPQAEGAGQVFLTGQSFLNGQNLL
ARQPPVAEQGSLSGQLPCTKQPPLTCPPHLNEQTPLPRQLSLTRHVPITVKLSPTKEPTFNSGESVQPSTQENEPLCNPTHVGILRVPLAPEEACIYVNRDKMGNNRAQR
ASIPQSPSWQPSDPHRAQQEQLSLITFTGCKDLPISMVGTESANGHQIKLTTEDMTRPSVVAHLGLLRGNCYELVSTVDAVPVQPAMLCNRSSFPYQKMAAIVIDTGTGF
TKCGLAQENHVLSVVPSQVQMLQHPPQGQPQYVVPEHQEGSYSVLNRGVVSDWDALEVLWQHLFYCKLRVQPEEMAVLVADSPISPRTNREKVAEILFERFHVPAMQTVH
QALLTLYAYGRTTGLVVGSGHGTSYVAPIITGDLAPLDTYRLDVAGADLTDYLAQLLMSGGHSPPKGGIVRQIKEACCYVAMDTTTEMARNQSQVQVDFVLPDKHVITLG
SERFCCPEALFQPNLLGLNQLGLPQLALLSISRLEVKQQEQLLANVVLEGGSTLINGFPERMRQELGPGATVLGSPHRAVAAWLGGSIMACRDSFQSLWLSRREYEEEGP
WAIYKYQL*
7 >lcl|NP_001020588.1|Plus1complement(11609252..11610505) NW_047713 actin-like 7b Actl7b __SEG__ Chr5 {Rattus norvegicus} MATKNNPSPKPMGTAQGDPGEAGTLPAPEAGIRDTGSTQLKAKPKKIRKIKALVIDLGSQYCKCGYAGEPRPTYFISSTVGKRSAEMAADAGDTFKETYVGHELLNMEAS
LKLVNPLKHGVVVDWDCIQNIWEYIFHTAMKILPEEHAVLVSDPPLSPTSNREKYAELMFETFGIPAMHVTSQALLSIYSYGKTSGLVVESGHGVSHVVPISEGDLLPGL
PSRVDYAGCDLTNYLMQLLNEAGHKFSDDHLHIIEHIKKKCCYAALLPEEEMSLGLDELHVDYELPDGKVITIGQERFRCSEMLFKPSLVGSTQPGLPELTATCLDRCQG
TGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPTVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGCAAIYSKC*
8 >lcl|NP_001034543.1|Plus12832329..2833627 NW_047784 hypothetical protein LOC315283 Fam113b __SEG__ Chr7 {Rattus norvegicus} MVRLLASEVQQLLHNKFVVVLGDSVHRAVYKDLVLLLQKDCLLTNKQLRTKGELSFEKDQLMMGGELDTLHNRTDYREVREFCSDHHLVRFYFLTRVYSEYMESVLKELQ
SGNHAPDVIIMNSCLWDVSRYGRNSLSSYRQNLENLFGRMDEVLPKSCLLVWNTAMPLGDKIKAAFLPQKCKGQYPRISVATLKKKVTQANFYSHAEATKHYFDVLDLNF
HFRQARKHLQGDGVHWNEHAHRKLSYLLLAHMADAWGVELPHRDPWEPGFEAWESSGQVEERQPQDNIGPQFAQSPPYPFPRPPPLLPSPGLPIRPPPLLGCPLPPPQPM
PPLPLYPQVSYFSSDPVFQSDEFYIHSDSPSSNHTGYAFEGDFSFYPQPPMPNFRPPCHQRQAPVVHRGFPRHFPRGPYMPWRERPRRPQKHAPACLESRPQ*
9 >lcl|NP_001094442.1|Plus1complement(16445418..16445990) NW_047492 enhancer of polycomb homolog 1 Epc1 __SEG__ Chr17 {Rattus norvegicus} MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESVRVNSPVRPAARPAPSAARGGGGAADPHKMAAIFSPPPTLGRRPGRSPASPGARSRAAE
ARRSTLEGLPPSSATGTRVPRSSGARKAQRGHVTKPPAAILWSQFLGWALCISGEGSGLGGGGGAASREWAAPAGPSQGR*
10 >lcl|NP_001101547.1|Plus115944167..15945414 NW_047773 actin-like 9 Actl9 __SEG__ Chr7 {Rattus norvegicus} MDVNGYPKPQPSPETHGPPSLTSNTVLVSKNLEQDSFSVVGDRFPLKTGAVVIDMGTGTCKVGFAGQSQPTYSVATILGCQPKKQATKGQSELETFIGEAARSRPELRLV
KPIRNGIVVDWEAAELIWRHILEHDLRVATQEHPLLFSDPPFSPATNREKLVEVAFESLHSPALYVASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRL
DLAGNHLTAFLAEMILGSGFSLQQEDLDLVENIKHHYCYLASDFQKEQARPDQECKQTLRLPDGRTVTLGKELFQCPELLFHPPEIPGLSPMGLPAMAEQSLLRVPQDLR
PHVAQNVILCGGSSLFTGLESRFRAELLRSLSPEDHVVVMAQPNRNLSVWIGGSILASLHAFQSCWVLREQYEEMGPQVVYRKCY*
11 >lcl|NP_001101566.1|Plus132836804..32837625 NW_047774 leucine-rich repeat-containing 10 Lrrc10 __SEG__ Chr7 {Rattus norvegicus} MGNIIRALVAFIPTDRCQSYVVGDLREMPLDRMVDLSGSQLRRFPLHVCSFTELVKLYLSDNHLHSLPPDLAQLQNLQILALDFNNFKALPQAVCTLKQLCILYLGNNKL
CDLPDELSLLQNLRTLWLESNCLTRLPDVVCELSLLKTLHAGSNALRLLPGQLRRLRELRTIWLSGNQLADFPSVLLHMPFLEVIDVDRNSIRYFPSLAHLTNLKLVIYD
HNPCRNAPKVGKGVRRVGRWAEETPEPDRRKTRRSALAKEENQEPPPLLPPSS*
12 >lcl|NP_001102786.1|Plus1complement(5848511..5850100) NW_048040 retinoic acid induced 2 Rai2 __SEG__ ChrX {Rattus norvegicus} MDDLQSQNLSMDMTDSPPTLANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNA
TYVMTTQGPVQLPVVLEQHVFQHLNSPLVLPQEAPCSSNAIHNNLFQGAEDSEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPTQGSLGPPPCQPPPGYAPVPPQPFSSP
LSPLVPPATLLVPYPVIVPLPVPVPIPIPVPVPQSSESKFSPSFPKPPSSFGLHSFKGTQTTLEKDELKPLDILQPKEYFQLSRHTVIKMGGENEALDLSMKSVPWLKAG
EASPPVFQEDAALDLSLAAHRKAEVPPETLYNTSGSADIQGHTLLEKRPSGMEMPFAPAKSREASAMMDSHSSSSNGTEMVSQPIHPGSELKPENNIEIVSESQAAKVIV
SVEDAVPAIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQEDESLGNTEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
13 >lcl|NP_001102957.1|Plus19773081..9773494 NW_047487 profilin 3 Pfn3 __SEG__ Chr17 {Rattus norvegicus} MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVL
MGRRGVHGGILNKTVHDLIGGLREQCS*
14 >lcl|NP_001103525.1|Plus1complement(19768309..19769037) NW_047657 hypothetical protein LOC499839 RGD1564664 __SEG__ Chr3 {Rattus norvegicus} MAFAVIRACSRVGRGGLYKRLGGLPRGTRRQRQRRQGASLSTTEQRSLAPRPPTGPPARYPSPAVPARASEARRHPAADLDPPPGEPQAVASRGTPEPRPPPESPGAQPP
PGPAAADGAMAAAKPGELMGISSSYQAVMPHFVCLADEFPQPVRPAKLPKGKGRLRRPRQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQ
REPLGSCKLRNSLDSSDSDSAL*
15 >lcl|NP_001107222.1|Plus11943802..1945022 NW_048033 testis derived transcript-like Tesl __SEG__ ChrX {Rattus norvegicus} MDLGHKPGLGAPCLKCKEKCAGFELHFWRKICRNCKCGQEDHDILLSNDEDQKVGRLFEHTEYTNIITKLKSEGMPMFKHNVMAMTNPCTAEKKFFNTGSYEWAPPVQRQ
ELARNYMAKEKLSLSGSWATQYLKKQLSKQLPAHDQDPSKCHELSPNEVREMEQFIKKYKNEALGVGAMKHLSEVNDQGDKVQNPARVRNTTSALSSKEKSTEPKKTQYS
CYCCKQPIKEGDTAIYAERAGYNKLWHPSCFICSTCGELLVHMIYFWKNGKLYCGRHYCDSEKPRCAGCDELIFSKEYTQAENQNWHLKHFSCFDCDKILAGKIYVMVND
KPVCKPCYMKNHAVKCQECQSVIDPELQRVTYNNFSWHASSECFLCSCCRKCLFGQKFMPVNGLVFCSMECKKMMS*
16 >lcl|NP_001119743.1|Plus1complement(7708146..7710050) NW_048043 hypothetical protein LOC302367 RGD1561552 __SEG__ ChrX {Rattus norvegicus} MAFNEDILRNILKEHGTINEIKNEFIYIILTSLSKIVRQVNDLDKFTEDVLGKLDKEIHDLSFKLKILQENIIQLTNAIHKIPNDILSMQLWKSRKTFSKITIETQQVYS
CTSLPIKIFERNNANIRIPLLTVPEYYQNDMEDSPSSNGLFHPCLYCSKLLKDNVSVNKQLASEKKHTQNQNLTHAGDFKNVLQCHLLKKHIPVDHIPASGSEVSHSYLD
QYGGGSSFYIFPPNRNKHQGTSAANILPSEQEQLHYHIGCMSNSRPRVLYGTGKGDVVVKQRRVLTHYKSNVFVNPLAPKAPPLPSDWLIHLISSKKPSASGVISSRGTS
SFFVLGKTKTLPSACLKSNPNIDLTVPPEVEVTATSESLERYELKPGGLSPQDMDQKIPLLLYPSVIPLRNQSWDSVVTLIDSLVEKPQPIKSSFPKSPRSLSKSKYAHG
SLPQHPVANTSRTFSAQLPKSYRVPRHSFSVSASPSPKPQTSSNVVPKRSVSHLTKLIEAQSRSPVTYPKRHLHPPQAKPSKQLNKSNLTKVSTLQSSLSSMKSSASNHR
ALAKRHYRIESAYASILQNTSILPIMTKARKALMEAIRKGIKLRKTRPRAESDDPENEAKMIRFRRKAMGYHSGKSDSETEWVE*
17 >lcl|NP_058860.2|Plus130266901..30267800 NW_047696 F-actin-capping protein subunit alpha-3 Capza3 __SEG__ Chr4 {Rattus norvegicus} MSLSVLSRQDKEKVIHRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYCVPLCIDGNPVLLSHHNVMGDFRFFDYQSKLSFRFDLLQNQLRDIQSHGII
RNETEYLRSVVMCALKLYVNDHYPNGNCNVLRKTVKNKEFLIACIEDHSYDNGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHYFRCVNLHVEVSKDLKESLEVVNQAQ
LALSFARLVEEQENKFQAAVIEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII*
18 >lcl|NP_445913.1|Plus1complement(914029..914547) NW_047506 centrin 1 Cetn1 __SEG__ Chr18 {Rattus norvegicus} MASTFRKSNVASTSYKKKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY*
19 >lcl|NP_446151.1|Plus12416464..2417003 NW_047719 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 Cited4 __SEG__ Chr5 {Rattus norvegicus} MADHLMLAEGYCLLQVPHAPRTLQPYPGPGLDSGLRPRGAPLGPPPPSGTLAYGSFGSPVSFQPFPVSQPPGAGNAHLQSAATPSPGRMPAPPSAAGGPSPLQPAPGAAS
PLPLPPPPPLPPALGCMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSVPAAGSVSC*
20 >lcl|NP_599226.1|Plus1complement(1625102..1625479) NW_047470 Mk1 protein Mk1 __SEG__ Chr16 {Rattus norvegicus} MARWQMAPVRTRPLAIVGYKDLPSIWAAIPGKNFVSITLAEFGLMVGKDWSSFFMNSLTLGGQKMFCDPGLTAASRGIYNGSSYQEHWRNPHLQCHCTMTAKMLLLMGKE
GTHGGWINNHGGWML*
21 >lcl|XP_001053633.2|Plus1complement(386202..386555) NW_047537 GABA(A) receptor-associated protein-like 2-like LOC679596 __SEG__ Chr19 {Rattus norvegicus} MKWMFKEDHSLEHRFVESAKIRVKPPDRVPVIVEKVSGSQIVDTDRRKHLIPSHSTVAQFMWILKKRIQFPSEKATFLCVDKTVPQSRLTVGQLYKKEKDEDGFLYVAHR
GENTFGF*
22 >lcl|XP_001053659.1|Plus1complement(1842891..1843160) NW_047331 dynein light chain 1-like LOC679822 __SEG__ Chr10 {Rattus norvegicus} MCDWKVVITNADMSEGMQQDSVERAAQALEKCSMEKGIAAPSKEESDKKSNPTRHCIVGRTSGSYGTHETKPFIHFSLGQVAVLLFKSG*
23 >lcl|XP_001056138.1|Plus1complement(885882..888425) NW_048036 AU022751 protein-like LOC680214 __SEG__ ChrX {Rattus norvegicus} MASYSTPKKERTARRGSVRSQGKAPVTVCSDTSAAGSAFQGLEVDLGEPDIFSSQGKAPVTVCSGTSAASSAFQGLEVDLGAPDIFSFQGEAPVASVLAVCSDTSVAGSA
FQGVEVDLGPPDTFSSQGKAPVASSVLAVCSDTSAAGSAFQGLEVDLGAPDIFSFQGEAPVASVLAVCSDTSAASSAFQGLEVDLGAPDIFSFQGEAPVASVLAVCSDTS
AAGSAFQGVEVDLGPPDTFSTQGKAPVASSVLAVCSDTSAAGSAFQGLEVDLGPPDTFSTQGKAPVASSVLTVCSGTSAAGSTFQGVEVDLGEPETFSMAIENLGTFSVP
DNQPFDPEGSFGPNIQLGRVRPMTRSQRELGQALRGEKDSNEPPAQTKSCRKRKQPSQNLTTKSLGALQLPEALELPHRLQLPSSLSSQPSSSHHSEYAVGNLDSPGPTT
LRSTTRSGPVSTPAPMALSQAFLTVSGPPSSASGSSSDENVQELSQQTILQAPDDGVFCREPDSRGSVIPGGWVLRSRVVTFGHHSPALVSPEVQPEVHTIGWNLRPRAT
PRIPVLHSGPPVSSPDTGSRATQSRSRSRSASRPGSDHRRRSRETKMEPEPEPEPKSESESDHELESESEAEAEPESEAEAEPESEAETEAESEAEAEPESEAEPEPESE
AEPESEPEVEPESEPEVEAEVEPESEPEAEAEVEPESEPEVEAEAEAEPESEPESESEPELVEMEPGPRSQSQARPFTSTPTLPRRSSHATASSPPRRPVRMRASSPSPP
GRLYPLPGQYGEGASSSSSSTSELCVSSPHSLKGSSPPLSDLSSVSGPSPNTLWRALIPDLDNLHSSSERESEEETG*
24 >lcl|XP_001058002.1|Plus14722166..4722414 NW_047425 rCG57039-like LOC680613 __SEG__ Chr14 {Rattus norvegicus} MEHFLTMLQTVAKDKDQGIYEDYSEDLCVLTRKGTVMGAEICHVLVSLGEKMTEEEVGMLVAGCEDSNGGIIYKELVMVLNA*
25 >lcl|XP_001067293.1|Plus1complement(12302661..12303158) NW_047801 cofilin-1-like isoform 1 LOC688430 __SEG__ Chr8 {Rattus norvegicus} MASGVAVSDGVIKVFNDMKVCKSSMPEVKKHKKTVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWTPESAPL
KSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDCCTLAEKLGGRAVISLEGKPL*
26 >lcl|XP_001070964.1|Plus1complement(2764348..2765124) NW_047375 FSHD region gene 1 Frg1 __SEG__ Chr12 {Rattus norvegicus} MAEYSYVKSTKLVLKGTKAKSKKKKSKDKKRKREEDEEAQLDIVGIWWTVSNFGEISGTIAIEMDKGAYIHALDNGLFTLGAPHREVDEGSSPPEQFTAVKLSDSRIALK
SGYGKYLGINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEAKNKTAGEEEMIKIRSCAEREAKKKDDIAEEDKGSVQQCEINYVKKFQSFQDHK
LKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK*
27 >lcl|XP_002727771.1|Plus143618900..43619337 NW_047334 rCG35172-like RGD1560902 __SEG__ Chr10 {Rattus norvegicus} MKMCKSSRPEEVKKRKKVVLFCPSEVETIIPEEGKEMLVADVGPTVNDPLLHFCQDAARQGLTGATLSRMQPRRARRTNLLFNFWAPESAPLQSKMICASSKDAIKKNLT
GIKHELQANCFEEEVKACCTLAEKLGGIFLEHKPL*
28 >lcl|XP_002728174.1|Plus120282716..20284143 NW_047430 vasculin-like protein 1-like LOC100361636 __SEG__ Chr14 {Rattus norvegicus} MAQHDFVPAWLNFSTPQSAKSSTATFDKHGEHLSRGEGRFGISRRRHNSSDGFFNNGPLRTTGDSWHQPSLFRHDSVDSGVSKGAYAGTTGNLSGWHGSSRGHDGMSQRG
GGSTGNHRHWNGSFHSRKGCAFQEKTPTEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQNQPCRPIGTPSGVWENPPSAKQPSKMLVIKKISKEDPAAAFSAAFTSGSHH
ANGNKVSTMVPSVYKNLVPKPAPPPSKPNAWKANRMEHKPGSLSSSREAALTNPVSVTKPVVLAAGVVLNAPKESPSSTTPPIEISSSRLTKLTRRTTDRKSEFLKTLKD
ERNEDCSQSRDCDKLEGLRLEGSHTPEPKENGEQGCLQNGLSLPMVEEREVLSHSLEAEHRLLKAMGWQEYPENDESCLPLTEDELKEFHTRTEQLRRNGFVKNGFLQGR
SSSLFSPWRSTCIAECEDSDTGTSSSETSDDDAWK*
29 >lcl|XP_002728578.1|Plus1complement(1299185..1300312) NW_047510 actin, gamma, cytoplasmic 1 LOC684969 __SEG__ Chr18 {Rattus norvegicus} MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPNEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL
NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA
LDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII
APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*
30 >lcl|XP_002729012.1|Plus1complement(6641454..6642881) NW_047602 vasculin-like protein 1-like LOC100361476 __SEG__ Chr20 {Rattus norvegicus} MAQHDFVPAWLNFSTPQSAKSSTATFDKHGEHLSRGEGRFGISRRRHNSSDGFFNNGPLRTTGDSWHQPSLFRHDSVDSGVSKGAYAGTTGNLSGWHGSSRGHDGMSQRG
GGSTGNHRHWNGSFHSRKGYAFQEKTPTEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQNQPCRPIGTPSGVWENPPSAKQPSKMLVIKKISKEDPAAAFSAAFTSGSHH
ANGNKVSTMVPSVYKNLVPKPAPPPSKPNAWKANRMEHKPGSLSSSREAALTNPVSVTKPVVLAAGVVLNAPKESPSSTTPPIEISSSRLTKLTRRTTDRKSEFLKTLKD
ERNEDCSQSRDCDKLEGLRLEGSHTPEPKENGEQGCLQNGLSLPMVEEREVLSHSLEAEHRLLKAMGWQEYPENDESCLPLTEDELKEFHTRTEQLRRNGFVKNGFLQGR
SSSLFSPWRSTCIAECEDSDTETSSSETSDDDAWK*
31 >lcl|XP_002729111.1|Plus1complement(11576684..11576929) NW_047626 hypothetical protein isoform 1 LOC100361349 __SEG__ Chr2 {Rattus norvegicus} MSYQQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPKCPEPCPPPKCPEPCPPPSYQQKCPPVQAPPTCQLKCPPKSK*
32 >lcl|XP_002729114.1|Plus111639320..11639592 NW_047626 hypothetical protein LOC100361455 __SEG__ Chr2 {Rattus norvegicus} MSYQQQQCKQPCQPPPVCSPPKCPEPCPPPKCPEPCPPPKCPEPCPPPKCPEPCPPPKCPEPCPPPSYQQKCPPVQPPPTCQQKCPPKSK*
33 >lcl|XP_002729242.1|Plus112662978..12664105 NW_047657 actin, gamma, cytoplasmic 1 LOC100361457 __SEG__ Chr3 {Rattus norvegicus} MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL
NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA
LDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII
APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*
34 >lcl|XP_002729448.1|Plus1complement(3475643..3475912) NW_047695 dynein light chain 1-like LOC100361920 __SEG__ Chr4 {Rattus norvegicus} MCDRKAVIKNADMLEEMQQDLVECATQVLEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFNSYVTHETKHFIYFYLGQVAILLFKSG*
35 >lcl|XP_002729516.1|Plus128820756..28821214 NW_047711 cofilin 1, non-muscle LOC100360134 __SEG__ Chr5 {Rattus norvegicus} MASGVDFSDRVIMVFGNMKVFTYSMPEVKKHKKAVHFCLSEEKKNITLEEGKEILVGNIGQTVGVLHTSRETRWQSSFPWRASLFVLLPAPCLEHLTAPDLLLGVAGCSF
PARPKGLGESQQWEGYSFIPVATSWTVLFPPSLMVLTFSNCF*
36 >lcl|XP_002729988.1|Plus1complement(691174..691437) NW_047800 dynein light chain 1-like LOC100363141 __SEG__ Chr8 {Rattus norvegicus} MYSWKAAIKHADMLEETQQDSVECATQTQDSVEEDFVAHSKKEFDNKYNCTWHCIVGWNVSGCVTYETKHFIYFYLGQVAIFLFISG*
37 >lcl|XP_002729993.1|Plus19843691..9844044 NW_047800 GABA(A) receptor-associated protein-like 2-like LOC100359937 __SEG__ Chr8 {Rattus norvegicus} MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYS
GENTFGF*
38 >lcl|XP_215862.3|Plus1661424..661921 NW_047596 destrin LOC296197 __SEG__ Chr20 {Rattus norvegicus} MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRNKAVIFCLSADKKCIVVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPEQAP
LKSKMIYASSKDAIKKKFPGIKHEYQANGPEDLNRTSIAEKLGGSLIVAFEGSPV*
39 >lcl|XP_220587.3|Plus1complement(42215987..42217303) NW_047334 microfibrillar-associated protein 1A RGD1564148 __SEG__ Chr10 {Rattus norvegicus} MSVPSTLMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEFQFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEP
EVVGESDSEVGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESESESEYEEYTDSEDEMEPSTKPVFIRKKDRVTVQEREAEALK
QKELEQEAKRMAEERRKYTLKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGKVITNKAV
KGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKTT*
40 >lcl|XP_223007.4|Plus1complement(2387788..2388759) NW_047400 coiled-coil domain containing 121 Ccdc121 __SEG__ Chr13 {Rattus norvegicus} MLAQSPKGAPPPTPYLTILNTYLKPKLLTRLEKRVKRKTVVELKELSQQIQETKCRRERLLTDSRQLLEEKYRVQAENQLFTEYLRKNKEQCEKKQEELWKQYIQECGEI
ERERQELASRYNQRNAALQAQLLQGRKTQKDLKQQLQALKPIYKVKEGQDMKIQSLEQEQEKVRGETAAKDQKAHFRFLQEKALMEKELEDLHLMELGQINTTGLTRKYK
ALALAAKQAHSEFCGSLHRENQQLRKELQQLSQEYRRVEAVRNQLEKHRRLMKEQRWYLEALTRGRQRLQAERERHHRRHNPCLKEQRTSKTMLSTKSKTSLK*
41 >lcl|XP_228124.1|Plus13452573..3452890 NW_047601 similar to Dynein, axonemal, light chain 4 RGD1559781 __SEG__ Chr20 {Rattus norvegicus} MGETEGKKEEADYKRLQTFPLVKHSDMPEEMRMETMELCVTACEKFSNNNESAAKMIKETMDKKFGSCWHVVIGEGFGFEITHEVKNLLYLFFGGTLAVCVWKCS*
42 >lcl|XP_233287.5|Plus1complement(1605420..1606652) NW_048033 similar to hypothetical protein RGD1566387 __SEG__ ChrX {Rattus norvegicus} MDLNHEQGLGAPCRKCKEKCTGFELHFWKKICRNCKCKQEEHDILLSTEEEPKVGRLFENTKYNTLIAKLKSEGIPFENQYAMTLSKPCAAEKKVSINTLTHESVPPFQK
QALPRKYMEVLLDEKEPVSDSEEAQYWKKQLAKQLPSHDQDPSKCHELSPEEVEEMEQFVKKYENEALGVGDMKLLSDVNAQHYKVHHPTGDRNTTATVGSKDMSAESKK
TEYPCYCCKQTVKEGDLVIFAERAGYDKCWHPDCFICSTCGEFLVHMVYFWKNGKLYCGRHYCESEKPRCAGCDELIFSKEYTQAENQNWHLKHFCCCDCNYILAGKLYV
MVSDKPVCKACYMKNHAVVCQGCHSVIDPEVQRVTYNNLSWHASTQCFLCSCCRKCLFGETFLTVKGMTFCSIECKNMMC*
43 >lcl|XP_345264.3|Plus1complement(2446907..2447134) NW_047627 alpha tubulin subunit-like RGD1560000 __SEG__ Chr2 {Rattus norvegicus} MLSNTTATAEAWARLDPKFDLMYAKRAFMHWYVGEVMEEGEFSEAREDMAALEKYYEEVGVDSVEGEGEEEGEEY*
44 >lcl|XP_576332.1|Plus1complement(2883556..2884074) NW_047784 tumor protein, translationally-controlled 1 RGD1565798 __SEG__ Chr7 {Rattus norvegicus} MIIYRDLISHDELFSNIYKIREIADRPCLEVEGKMVSRTEGAIDDSLIGGNAPAEGPEGGRTESTVVTGVDIVLNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPER
VKPFMTGAAEKIKRILANFNNYQFFIGENMNPDGMVALLEYPEDGVTPFMIFFKDGLEMEKC*
45 >lcl|XP_576552.2|Plus1complement(8306753..8307214) NW_047814 similar to actin related protein 2/3 complex, subunit 5-like RGD1560362 __SEG__ Chr9 {Rattus norvegicus} MARNTLSSRFRRVDIDEFDENKFVDEHEEAAAASGEPGPDPCEVDGLLRQGDMLRAFHAALRNSPINTKNQAVKERAQGIVLKVLTNFKSSEIEQAVQSLDRNGIDLLMK
YIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV*
46 >lcl|XP_576917.1|Plus15516215..5517363 NW_048034 mCG18732-like isoform 2 RGD1562289 __SEG__ ChrX {Rattus norvegicus} MSGYARRQGAPPLSRTRSLVVPDDFGYGKGKCTKQGPSGAHETRFGGDKLEDLEEANPFSFKEFLKTKNLSLSKEDTATSRIYPKEASRHPLGLDHNSPVSQPMGYGLEY
QQPFFEDPTRASNLEEDEEDGWSRAYLPSAVEQTHSMRATQNSSPCGTYLSFFSNASELAGPESLPPWTLSDTDSRLSPASPAGNPNVDFAAHEESLGDRHLRTLQLSYE
ALKDENSKLRRKLSEVQSFSETQTKMVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVMKLKQEVNLLQAQLSNFKRENEALRSGQGASLTVVKQ
NTDVALQNLHVVMNSAHASIKQLVSGAETLNLVAEILKSIDRITEVKDEADS*