SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus Z    

ID / Description / Sequence
1 >lcl|NP_001001185.1|Plus113505562..13505831 NT_039589 cDNA sequence BC048507 BC048507 __SEG__ Chr13 {Mus musculus} MCDRKAVIKTVDMSEEMQQDSVRCAIQALEKYSTEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTYETKHFVYFYLGQVAILLFKSG*
2 >lcl|NP_001013835.2|Plus1129447..>129944 NT_166314 mastermind like 2 isoform 1 Maml2 __SEG__ Chr9 {Mus musculus} MGDTAPPQAPAGGLGGASGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYERGRAESSDRERESTMQLLSLVQHGQGARKASKHAKATVATATTTAPPPPPT
APPVASQAAATAPPPPPDYHHHHQQHRLTSNDNGGINREQPPASTPGDQRNSALLA
3 >lcl|NP_001074625.1|Plus1complement(2933435..2934106) NT_039267 TMF-regulated nuclear protein 1 Trnp1 __SEG__ Chr4 {Mus musculus} MPGCRISACGPGAQEGTAEPGSPPPPPREPLPSLQPPSPSPTSTPTPTKSPPLPEAAETPVEGQELQRWRQGASGGSGGAGPAGIAGAAAGAGGRALELAEARRRLLEVE
GRRRLVSELESRVLQLHRVFLAAELRLAHRAESLSRLSGGVAQAELYLAAHGSRLKKGARRGRRGRPPALLASALGLGSCVPWGAGRLRRGQGPEPDSPFRRSPPRGPAS
PQR*
4 >lcl|NP_001129742.1|Plus1complement(13858247..13858639) NT_039413 proline-rich protein 24 Prr24 __SEG__ Chr7 {Mus musculus} MRGSSCVGSGGESPGGTGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRPPAGPADPLPSAAAAPCARAAPPAPPPAAPASCLLGASGGPRPQPGLPRSR
RHSRRPAPGATRETARRAPG*
5 >lcl|NP_001165111.1|Plus195419168..95420208 NT_039207 putative uncharacterized actin family protein C20orf134 homolog 1700007I08Rik __SEG__ Chr2 {Mus musculus} MKPRIVLKSSSLMPSWDRPVLPGAPGCELAGGVARAHPIKHGVVVDWDALEGLWERLMVGGLQVHPEQWPVLVSDSPSAPPKGREKVAELLFEALTVPACHMANTALLAL
CSIGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSRYFRDLLVAACPDLQLQGLSRKTVTQLKKRCCYVSLDFQGDICDPARHQRACFCLGNGCYVRLGSE
RFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTLFPGFVERMNLELEAQCRRHGYPALQPCLVAHPGRDTAVWTGGSMMASLNSFQCRWMTR
AMYQEHGPLLVRDVFD*
6 >lcl|NP_001170862.1|Plus1complement(21949546..21949815) NT_039687 hypothetical protein LOC627788 Gm6788 __SEG__ Chr19 {Mus musculus} MCDRKAVIKNADMSEEMQQNSVECATQALEKYNIENDIVAHIKKGFDKKYNSTWHCIVGRNFGSYVTHETKLFIYFYLGQVAILLFKSG*
7 >lcl|NP_031619.3|Plus1complement(6618899..6619417) NT_039674 centrin-1 Cetn1 __SEG__ Chr18 {Mus musculus} MASTFRKSNVASTSYKRKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY*
8 >lcl|NP_031631.3|Plus1328766..329665 NT_039360 F-actin-capping protein subunit alpha-3 Capza3 __SEG__ Chr6 {Mus musculus} MSLSVLSRKEKEKVIHRLLVQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYCVPLCIDGNPVLLSHHNVMGDFRFFDYQSKLSFRFDLLQNQLRDIQSHGII
RNETEYLRSVVMCALKLYVNDHYPNGNCNVLRKTVKSKEFLIACIEDHSYDNGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHFFRCVNLHIEVSKDLKESLEVVNQAQ
LALSFARLVEEQENKFQAAVIEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII*
9 >lcl|NP_032004.2|Plus155403..56548 NT_039747 factor VIII intron 22 protein F8a __SEG__ ChrX {Mus musculus} MAAGSASSLGGGAWPGSEAGDFLARYRQVSNKLKKRFLRKPNVAEAGEQFAQLARELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQECDARQRLGC
PAAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRAVGQPAAAAGHFQRAAQLHLPLMPLAALQALGDAASCQLLARDYTGALALFTRMQRLAREHGGHPVQ
QLELLPQPPSGPQPPLSGPQPRPVLGSTLPLPQPPDHAPGSVAPSPGTLGAFADVLVRCEVSRVLLLLLLQPPPAKLLPEHAQTLEKYSWEAFDGHGQDTSGQLPEELFL
LLQSLVMAAQEKDTEGIKKLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV*
10 >lcl|NP_032004.2|Plus155403..56548 NT_039747 factor VIII intron 22 protein F8a __SEG__ ChrX {Mus musculus} MAAGSASSLGGGAWPGSEAGDFLARYRQVSNKLKKRFLRKPNVAEAGEQFAQLARELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQECDARQRLGC
PAAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRAVGQPAAAAGHFQRAAQLHLPLMPLAALQALGDAASCQLLARDYTGALALFTRMQRLAREHGGHPVQ
QLELLPQPPSGPQPPLSGPQPRPVLGSTLPLPQPPDHAPGSVAPSPGTLGAFADVLVRCEVSRVLLLLLLQPPPAKLLPEHAQTLEKYSWEAFDGHGQDTSGQLPEELFL
LLQSLVMAAQEKDTEGIKKLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV*
11 >lcl|NP_033177.3|Plus1complement(283005..284258) NT_078458 P-selectin glycoprotein ligand 1 Selplg __SEG__ Chr5 {Mus musculus} MSPSFLVLLTILGPGNSLQLQDPWGHETKEAPGPVHLRERRQVVGDDDFEDPDYTYNTDPPELLKNVTNTVAAHPELPTTVVMLERDSTSAGTSERATEKIATTDPTAPG
TGGTAVGMLSTDSATQWSLTSVETVQPASTEVETSQPAPMEAETSQPAPMEAETSQPAPMEAETSQPAPMEADTSQPAPMEADTSKPAPTEAETSKPAPTEAETSQPAPN
EAETSKPAPTEAETSKPAPTEAETTQLPRIQAVKTLFTTSAATEVPSTEPTTMETASTESNESTIFLGPSVTHLPDSGLKKGLIVTPGNSPAPTLPGSSDLIPVKQCLLI
ILILASLATIFLVCTVVLAVRLSRKTHMYPVRNYSPTEMICISSLLPEGGDGAPVTANGGLPKVQDLKTEPSGDRDGDDLTLHSFLP*
12 >lcl|NP_033741.1|Plus114595422..14596744 NT_109315 actin-like protein 7A Actl7a __SEG__ Chr4 {Mus musculus} MSLDGVWAPQTANIGDGPAKKASDQASMQTQVLQTASLKDGPAKRAVWVRRDNAETEDPVKSTMSKDRPRLEVTKAVVVDLGTGFCKCGFAGLPKPTHKISTTVGKPYME
TAKTGDNRKETFVGHELFNPDIHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFETFNTPAMHIAYQSRLSMYSYGRTSGL
VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDIKTRCCFVALDPIEEKKIPAPEHEIHYTLPDGKEIRLGQERFLCSEMFFKP
SLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLRGFPNRLQKELSSMCPNDTPQVNVLPERDTAVWTGGSILASLQGFQPLWVHRLEYEEHGPFFLYRRCF
*
13 >lcl|NP_034344.2|Plus1complement(26892208..26893047) NT_039500 four and a half LIM domains 4 Fhl4 __SEG__ Chr10 {Mus musculus} MSEFKCHHCEESLQGKKYVQKDGANYCVTCFDSHCANICQECHKPIGADSKEVCYKEQFWHNTCFKCSKCSQLLATETFVAWDKNILCNKCATRVTFPKCKGCLKDIEEG
DHNVEYKGSIWHKNCFVCTNCKDIIGTKNFFPKDEGFYCVTCYDALFTKHCMKCKKPITSGGVSYQDQPWHSECFVCVSCSKELSGQRFTAMDDQYFCVDCYKNYIAKKC
AGCKNPITGFGKGANVVAHEQNSWHDYCFNCKTCSVNLANKHFVFHDEQVYCPDCARNL*
14 >lcl|NP_035599.2|Plus141503724..41504020 NT_039240 small proline-rich protein 2B Sprr2b __SEG__ Chr3 {Mus musculus} MSYHQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK*
15 >lcl|NP_035600.1|Plus141526529..41526786 NT_039240 small proline-rich protein 2D Sprr2d __SEG__ Chr3 {Mus musculus} MSYQQQQCKQPCQPPPVCPPKKCPEPCPPLKCPEPCPPPKCPEPCPPPKCPEPCPEPCPPPSCQQKCPPAQPPPPCQQKCPPKSK*
16 >lcl|NP_035601.1|Plus141539139..41539369 NT_039240 small proline-rich protein 2E Sprr2e __SEG__ Chr3 {Mus musculus} MSYQQQQCKQPCQPPPVCPPKKCPEPCPHPQCPEPCPPPKCPEPCPEPCPPPSYQQKCPPVQPPPPCQQKCPPKSK*
17 >lcl|NP_035602.1|Plus141552171..41552401 NT_039240 small proline-rich protein 2F Sprr2f __SEG__ Chr3 {Mus musculus} MSYQEQQCKQPCQPPPVCPPPKCPEPCSPSVCPEPCPPPKCPEPCPEPCPPPSFQQKCPPVQPPPPCQQKCPPKSK*
18 >lcl|NP_035604.1|Plus141572907..41573233 NT_039240 small proline-rich protein 2H Sprr2h __SEG__ Chr3 {Mus musculus} MSYQQQQCKQPCQPPPVCPPPQCPEPCPPPKCPEPCPPPKCTEPCPPPKCPEPCPPPKCPEPCPPPKCPEPCPPPKCTEPCPPPSYQQKCPSVQPSPPCQQKCPPKNK*
19 >lcl|NP_035605.1|Plus141594991..41595221 NT_039240 small proline-rich protein 2I Sprr2i __SEG__ Chr3 {Mus musculus} MSYQQQQCKQPCQPPPVCPPKKCPEPCPPPQCPEPCPPPKCPEPCPESCPPPSYQQKCPPVQPPPPCQQKCPPKSK*
20 >lcl|NP_062509.1|Plus120790607..20791155 NT_039264 cbp/p300-interacting transactivator 4 Cited4 __SEG__ Chr4 {Mus musculus} MADHLMLAEGYCLLQVPPHTHGPHAPRTLQPYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPAAAGGPSPLQP
APGAAASLPPPPPPPALGCMDTELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPAAGSVSC*
21 >lcl|NP_067429.1|Plus1complement(1102937..1103389) NT_039413 cdc42 effector protein 5 Cdc42ep5 __SEG__ Chr7 {Mus musculus} MPVMKQLGPAQPKKRLDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPGAPPVVAPHSVAPPAAPQPPVAVPSPADPLLSFHLDLGPSMLDAVLGVMD
AERSETTATKPDGDAHPRVQHPKTRCCSNADLQLDDVIGL*
22 >lcl|NP_079547.2|Plus1complement(14592047..14593303) NT_109315 actin-like protein 7B Actl7b __SEG__ Chr4 {Mus musculus} MATKNSPSPKPMGTAQGDPGEAGTLPAPEAAGIRDTGSTQLKTKPKKIRKIKALVIDLGSQYCKCGYAGEPRPTYFISSTVGKRSAEMAADAGDNFKETYVGHELLNMEA
SLKLVNPLKHGVVVDWDCIQNIWEYIFHTAMKIMPEEHAVLVSDPPLSPTSNREKYAELLFETFGIPAMHVTSQALLSIYSYGKTSGLVVESGHGVSHVVPISEGDLLPG
LPSRVDYAGCDLTNYLMQLLNEAGHKFSDDHLHIIEHIKKKCCYAALLPEEEMSLGLDELHVDYELPDGKIITIGQERFRCSEMLFKPSLVGCTQPGLPELTATCLARCQ
GTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPTVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGCAAIYSKC*
23 >lcl|NP_080614.1|Plus16836534..6840157 NT_039477 hypothetical protein LOC67722 4921517D21Rik __SEG__ Chr9 {Mus musculus} MEDTKKVGGPDPSGPQGHPLPSSQQLTGGFKVSQGPWMNPKSLYSKQGLSLSTGAINSTSQAPASQPMLQLLHNSAQVNSQCDYARASQDTSRFSSNPYPNPVVGTQEHL
LMDDGTQTLPMPPDNNGTDDKAQYRFNLSQNQLQIGRESKAPAKVLVGWGKGTCNIGQMASEGSRKSRWLPYFLSGESGVVEGQAPLLTQAPVQDQRQDKCPCLAQSPTL
NKATSSPSLPLPTSVPASVAAVNGLPAPAAVKPYTYSPNYLTNTTAAAKDLPLDLRNGGNQLSVLSDPSKKDKVYFFLKETPPTPTSSPAEFSPKIQDQEVAKVQVPIQQ
SEYPAKKCLVSRLDTLTSTSEPLDSFKIQENSHKVCSSHPDKQPPNACNNNNCSNVPLPVLQGAYSKHSLPQSPRGVIQSPISGAPTCQLQDAVEDHVLVFDMATGNTRM
GLLCHDPMGSRAVLVGLTPSHPSNHVSDNTLSAWSLSRPILSPNSDHPSLWSTTAVLSSPVPSSLSAGSYREVALVSKEAKHNLEPRTSPGTESPIRMLARPVVPGTPIQ
YGEKISAQVPDPSWPKSDAEKMGTDHTIWKLDSPTVQPRKLQWIKPDPVSTVDIQVVSRSPLQEKAGSTNQQAAHPSVPQAEGTGQVFLTGQSFLNGQNLLARQPPVAEQ
GSLSGQLPSTKQLPLTCAPHLNEQTPLPRQLSLTRHVPVPVKPPTTKEPPFTSGEPIQPQENEPLCNATHVGILRVPLTPEGTCLYVNRDKVENNRVQRSSINQPQSWQP
SNPHRAQQEQLSLITFTGCKDLPISMVATESTNGHQFKMTSEDITHASVVAHLGLLRGNCYELVSTVDTVPVQSAVLCNRSSSPYQKMAAIVIDTGTGFTKCGLAQENHV
LSVVPSQVQMLQHPPQGQPQYVVPEHQEGSYSVLNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFERFHVPAMQTVHQALLTLYAYGR
TTGLVVGSGHGTSYVAPIITGDLAPIDTYRLDVAGADLTDYLTQLLLSGGHSLPKGGIIRQIKEACCYVAMDTATEMARNQSQVQVDFVLPDKHVITLGSERFCCPEALF
QPNLLGLNQLGLPQLALLSINRLEVKQQEQLLANVVLEGGSTLINGFPERMRQELGPGATVLGSPHRAVAAWLGGSIMACRDSFQSLWLTRREYEEEGPWAVYKYQL*
24 >lcl|NP_082789.1|Plus1complement(8500775..8501908) NT_039268 actin-related protein T2 Actrt2 __SEG__ Chr4 {Mus musculus} MFNPLVLDSPSVIFDNGSGLCKAGLSGEIGPRHVTSSVVGYPKFKAPPTGASQKKYFVGEEALYKQEALSLHYPIDRGLVTSWDDVEKLWRHLFEWELGVKPCERPVLVT
EPSLNPRENREKTAEMMFETFEVPAFYLSDQAVLALYSSACVTGLVVDSGDGVTCTVPIYEGYSLPHAVSKLYVAGKDITELLTRLLLASGRAFPCPLEKALADDIKEKL
CYVALEPEEELSRRAEDVLREYKLPDGNVIYIGDQLYQAPEVLFSPDQLGTHGPGLAQMASNSITKCDADIQKTLFGEIVLSGGSTLFQGLDDRLLKELEQLASKGVPIK
ITAPPDRWFSTWIGASIVTSLSSFKQMWITAADFKEFGVSVVQRRCF*
25 >lcl|NP_082790.1|Plus18514446..8515576 NT_039702 actin-related protein T1 Actrt1 __SEG__ ChrX {Mus musculus} MLDPARLDNPAVIFDNGSGLCKVGISGEIEPRHVINSVVGHPKFNIPSARSNRKRYFVGEEAQCMYDGLYLHYPIERGLVTRWDDMEKLWKDLFEWELGVKPNEQPVFMT
EPSLNPQETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGVTCTVPVYEGYSLPHAITKLYVAGRDITEHLTRLLLAKGYTFPCILNKAVVDDIKEKL
CTVSLGYKDTEKNCQQFLRKYTLPDGNTIQMSDHLCQVPEVLFTPDHLGIHDLGISKMVCNSIMNCDTDIQENLFAEIVLSGGTTMFPGLQDRLLKELEDLAFEGTPIKI
TASSDRCYSAWIGGSVMTSMTTFKQMWVTAEDFKEYGAFVVQRKCF*
26 >lcl|NP_082823.1|Plus1complement(2977838..2979844) NT_165773 kinesin-like protein KIF2B Kif2b __SEG__ Chr11 {Mus musculus} MASQFCLPLAPRLSPLKPLKSHFTDFQVGICVAIQRSDKRIHLAVVTEINRENSWVTVEWVEKGVKKGKKIELETVLLLNPALASLEHQRSRRPLRPVSVVPSTAIGDQR
TATKWIAMIPHRNETPSGDSQTLMIPSNPCLMKRKKSPCLREIEKLQKQREKRRRLQLEIRARRALDINTGNPNFETMRMIEEYRRRLDSSKMSSLEPPEDHRICVCVRK
RPLNQRETTMKDLDIITIPSHNVVMVHESKQKVDLTRYLENQTFCFDHAFDDKASNELVYQFTARPLVESIFRKGMATCFAYGQTGSGKTHTMGGAFLGKAQDCSKGIYA
LVAQDVFLLLKTPAYEKLELKVYGTFFEIYGGKVYDLLNWKKKLQVLEDGNQQVQVVGLQEQEVSCVEEVLNLVELGNSCRTSGQTSVNAHSSRSHAVFQLILKAGGKLH
GKFSLVDLAGNERGADTAKATRKRQLEGAEINKSLLALKECIRALGKNKSHTPFRASKLTQVLRDSFIGQNSYTCMIATISPGMTSCENTLNTLRYANRVKELALEARPY
HHCVSPPGHEVPLMIENDNTNSGKSLQRDEVIQIPTVEKEEEKESDELTSKKEPAASWSRSNQWWEAIQETAEGVNGDVDFCIAQSLSVLEQKIGVLTDIQKKLQSLRED
LQKKSQVE*
27 >lcl|NP_082905.1|Plus1complement(42010043..42012016) NT_039240 keratinocyte proline-rich protein Kprp __SEG__ Chr3 {Mus musculus} MCDQQPIQCCVPIPQCCVKGSSFGPSQFSYANNQVLVEAPCEMKVLECAAPCPVQVSQTACQSSTTEVKGQAPCKTTKGKCQAPCQSKTTQVKYQPKTTEIKCQAPCQTQ
VSCVQCQAPCQSQVSYVQIPQPPQTYYVECPPVYYTETRYVEYPVSTYMPAPALQPGYTYVECPAVGQGQGQGQGGFSTQYQYQGSYGSCTPQSQSRRSYSSCGPQNQSQ
ASYSYCEPQFQSGPSYTNCGPQRQSQASYGNCTSQLQSRASYSNCSSQRRSGATFSTCAPRCQSQGTYGSYTSQRRSQSTSRCLPPRRLQPSYRSCSPPRHSEPCYSSCL
PSRCSSGSYNYCTPPRRSEPIYGSHCPPRGRPSGCSQRCGPKCRVEISSPCCPRQVPPQRCPVQIPPFRGRSQSCPRQPSWGVSCPDLRPRADPHPFPRSCRPQHLDRSP
ESSRQRCPVPAPRPYPRPQPCPSPEPRPYPRPQPCPSPEPRPRPCPQPCPSPEPRPCPPLRRFSEPCLYPEPCSAPQPVPHPAPRPVPRPRPVHCENPGPRPQPCPLPHP
EPMPRPAPCSSPEPCGQPVRCPSPCSGPNPVPYRQELGCHESNPCRLDTEGPRCGSYNFTQRQESNGSCESGDVFSGSHGLSGCGDQGNTCGGMNCGAYGGAKGAYF*
28 >lcl|NP_083579.1|Plus1complement(1057233..1057646) NT_039589 profilin-3 Pfn3 __SEG__ Chr13 {Mus musculus} MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVL
MGRRGVHGGILNKTVHDLIGGLREQCS*
29 >lcl|NP_109630.1|Plus1complement(1630810..1631898) NT_039433 mesoderm development candidate 1 Mesdc1 __SEG__ Chr7 {Mus musculus} MASGSAGKPTGEAASPAPGSAVGGASSQPRKRLVSICDHCKGKMQLVADLLLLSSEARPVLFEGPASPGAGAESFEQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAGD
SLVELGDLVVSLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQGCAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVKC
MSTSASALLACVREVKAAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSTEGKAVQTAILGGAMSVVSACVLLTQCLRDLAQHPDGSAKMSDHRERLRNSA
CAVSEGCTLLSQALRERSSPRTLPPVNSNSVN*
30 >lcl|NP_659097.2|Plus1complement(37218764..37229113) NT_039621 epiplakin Eppk1 __SEG__ Chr15 {Mus musculus} MNGQAPPHDVVVANGTEKFIVPKIKKNQLGASTPSRPQAEAALPTTARSIAGVYVEASGQTQSIYAAIKQGLLPTGLGLTLLEAQAATGGLVDLAQGQLLPVSEALRRGL
VGLELKEKLLAAERAVTGYPDPYGGEKLSLFQAIKKEVVDRTLGWRLLEAQLATGGLVDPTQGVQVAPELACQQGLLDKETWLSLVESEPSMGTPGFSDPNTLEQLPYSV
LLGRCVQDPSSGLPLLPLKTTFHTLAGAASASMLLEAGVLNEEMVRDLQEGMLVVSDVGTRPEVRRYLEGTGGLAGVVLLPGGHKKSFFQATVEHLVSKGIALQLLEAQA
ATRTLVHPTTGQRLWVEEAVKAGLVGPELHEQLLVAEQAVTGYYDPFSSSRIPVFQAMKKGLVDQPLALRLLDAQLATGGLICPARRFRLPLEAALRFGCLDEETRQRLS
QAMGFSDPTTHDRLGYEQLLALSVTDPETGLAFLPLPGMSHANEPQGPTFIDHCTRQALSKATTSISVGRYQGRPVSLWELLFSESVPVKKRAMLAQRHQEGALSVEELA
AELKNIVEQAAATAKVTFAGLRDTVTPGELLKAEIINQDLFEQLERGQTSAQDVGSLDSVQRYLQGTGSIAGLLLPDSQERLSIYEARSKGLLRPGTALILLEAQAATGF
IIDPKENKRYSVEEALRAGVIGPDVYAKLLSAEHAVTGYTDPYSGEQISLFQAMQRDLIVRDHGIRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDQILNSILLDPSD
DTKGFFDPNTHENLTYLQLLERCVHDSETGLHLLPLSSTRPQLVDSSTRQAFQKLLLSVKYGRFRGQRVSAWELVNSEYFTEDRRRQLLQRYRQRKITLEQVTQLLEKEM
RRWTDITLPALQGQVTAYQLLEAHIINQELLDQVLTGTISPDALLQVGDVHRYLRGSGTVGGVLLKPSNQRISLYQAMKQKLLPPSTALALLEAQAATGTITDPCSMETL
SVDEAVCRGVVGAEVYGKLKRAEHSITGYRDPFSGKKVSLFRAMKKGLVPVEQATRLLEAQVSTGGVVDPTTHLHLPMPVAVQRGCIDREMEAALSRSPETFPTPDGRGH
TSYAQLLEHCLQDKASGLHLLPLTEDAPNVPTDTQIQETLQASAGTEDGLSLWDLLTSCHFTEEQRRGYLEDVKVGKISVPQLQNTVRSWVHSAKLLARARITVPGPRGE
VPATWLRDAGIITQETLEALAQGMQSPDEVAKQPTVKVCLWGTGCVAGVLLQPSGTKLSIAQAVRDGLLPTGLGQQLLEAQVASGFLVNPLTNQRLSVEGAVKAGLVGME
QSEHLRQVEKAVTGYSDPFSGGSLSLWQAMEKGLVTQSEAFPLLQVQLATGGVVDPVHGVHLPQEVAYKLGLLDEQTSRVLTATGKENKLFFDPNSREKVTYQQLRELCV
LDADTGLWLLPLPQGTVLEVDDHTAVALRAMKVPINMGRFQGHSVSLWDLLHSEYVGAEKRRELVALCCSGRAAALRQVIGMLTTLVEAAEKQPSQATFKGLRKQVSAGD
LFRSQLITKQTLDELNQGKRTVQEVTEMDSVRRSLEGGNFIAGVLIQDTKEKMSIPEALRRHILRPGTALVLLEAQAATGFIIDPVENRKLTVEQAFQAGMFGKETYMKL
LSAERAVTGYTDPYTGEQISLFQAMQRDLIVRDHGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRGYFNEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPET
GLYMLEIVKKGETYTYIDEATRQALTSRTVKMYVGKFAGQTVSVWDLLSSQYFTEGRRRKLLREYRAQNIGLENLLEVITSTVEETEKQSQIFKVPGIHGDVTAAELFNS
GILNKKTLDALRSGDRGFQDLRWLEDVRVYLEGSNYIAGVIAPLTQKVMSFYEASREELIPAGFAAQMLEAQAATGYLMDPCTNQRLCVDEAIAAGLVGEDLRERLVNAE
MAAKGYKDPATGETIPLYQAMERKLVGREEALRLLEVQVATGGVIDPRHHHRVPLDTACQRGCMCDDSLVLIADQKHMRKRFVDPNTQEKVTYQELQDRCQREEKSGWAL
FPVVKDKKDIEYVDEATKRALEAEQVEVTVGRYRGQRRSVWELLNSEYVSEEKKMELVRLYKEDTTRALQKVVELILQMIADKERRSRQLWFRGLRTQVTAEELLRSEVI
TKQTLEDLEEGRTTVDQIERKEDVKRYLKGTSCIAGVLVPVQGEPGRQEKMSIYQAMWKGVLRPGTALVLLEAQAATGFIIDPVNNRRLSVEEAVAAGVVGGEIQEKLLS
AERAVTGYTDPYTGDQISLFQAMQRDLIVRDHGIRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDEDMNSILADPGDDTKGFFDPNTHENLTYLQLLRRCVRDPETGF
YMLQLAGKGSSVHHLSEELRRALREARVTPGTGDFQGQSISVWELLFYREVPESLRQDLLRCYQAGGLTVHDVTTTLTSLLARAKDGSPRGDPQGALGKATMEVKRGHLR
GHEVPVWDILTSNYVSRDTRKELLAQFSSGSLTLPMLKRRLTTIIEEAEETQESKPKPRDASLKQQDTGARGSGTSPDEGDAQDSSESARQQQEQTLRATTMQVHRGQFR
DQQVSVWKVLFSSYLSETRREELLAQHLAGKLGVMELVSLLTQIIEETEERLSKVSFPGLRRQVSASELCTSGILDRDTMRELAQGTKTIHEVTEMDSVKRYLGGSSCIA
GVLVPVQGEPGRQEKMSIYQAMWKGVLRPGTALVLLEAQAATGFIIDPVNNRRLSVEEAVAAGVVGGEIQEKLLSAERAVTGYTDPYTGDQISLFQAMQRDLIVRDHGIR
LLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDEDMNSILADPGDDTKGFFDPNTHENLTYLQLLRRCVRDPETGFYMLQLAGKGSSVHHLSEELRRALREARVTPGTGDF
QGQSISVWELLFYREVPESLRQDLLRRYQAGGLTVHDVTTTLTSLLARAKDGSPREDPQGALGKATMEVKRGHLRGHEVPVWDILTSNYVSRDTRKELLAQFSSGSLTLP
MLKRRLTTIIEEAEETQESKPKPRDASLKQQDTGARGSGTSPDEGDAQDSSESARQQQEQTLRATTMQVHRGQFRDQQVSVWKVLFSSYLSETRREELLAQHLAGKLGVM
ELVSLLTQIIEETEERLSKVSFPGLRRQVSASELCTSGILDRDTMRELAQGTKTIHEVTEMDSVKRYLGGSSCIAGVLVPVQGEPGRQEKMSIYQAMWKGVLRPGTALVL
LEAQAATGFIIDPVNNRRLSVEEAVAAGVVGGEIQEKLLSAERAVTGYTDPYTGDQISLFQAMQRDLIVKNHGIRLLEAQIATGGVIDPVHSHRVPVDVAYQRGYFDQEM
NSILADPGDDTKGFFDPNTHENLTYLQLLQRATIDPETGL
31 >lcl|NP_666354.1|Plus158813866..58814690 NT_039500 leucine-rich repeat-containing protein 10 Lrrc10 __SEG__ Chr10 {Mus musculus} MGNTIRAFVAFIPTDRCQSYVVGDLREMPLDRMVDLSGSQLRRFPLHVCSFTELVKLYLSDNHLHSLPPDLAQLQNLQILALDFNNFKALPRVVCTLKQLCILYLGNNKL
CDLPDELSLLQNLRTLWLESNCLTRLPDVVCELSLLKTLHAGSNALRLLPGQLRRLRELRTIWLSGNQLADFPSVLLRMPFLEVIDVDRNSIRYFPSLAHLTNLKLVIYD
HNPCRNAPKVGKGVRRVGRWAEETPEPDPRKARRYALAKEENQEPPPPLLPSSS*
32 >lcl|NP_758497.1|Plus158500517..58501818 NT_039621 hypothetical protein LOC239647 Fam113b __SEG__ Chr15 {Mus musculus} MVRLLASEVQQLLHNKFVVVLGDSVHRAVYKDLVLLLQKDCLLTNKQLRTKGELSFEKDQLKMGGELDTLHNRTDYREVREFCSDHHLVRFYFLTRVYSEYMESVLEELQ
SGNHAPDVIIMNSCLWDVSRYGRNSLSSYKQNLENLFGRMDQVLPKSCLLVWNTAMPLGDKIKAAFLPQKCKGQYPRISVATLKRKVTQANLYSHAEATKHYFDVLDLNF
HFRQARKHLQGDGVHWNEHAHRKLSYLLLAHMADAWGVELPQRDSWEPDFEAWESSGQVEERQPQDNLGPQVFAPSPHCPFRPPPLLPSPGLPIRPPPLLGCPLPQPQQM
PPFPLYPQVSYFSSDPVFQSDEFYIHSDSPPPTHTGYAFEGDFSFYPQPPVPNFRPPCHQRQAPVVHRGFPRHFARGPYSNPWRDRPRRPPKHSPAGLESRPQ*
33 >lcl|NP_777364.3|Plus1complement(54485..55675) NT_166287 cysteine protease ATG4A Atg4a __SEG__ Chr3 {Mus musculus} MESVMSKYENQILIFPDYLEEFPDTDELVWILGKQHPLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWNWERQKEQPKE
YQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVIKKTHFI**MEFLGCLCFHG*HSGH*RYQENVLCSSCGCC*PSW*FSDCIQSE*RHLCPVLSLETP
AAHCAPSPGHKPNQSCVC*SIQRVF*DATVFRGFRRKAK*RLLFHRILRR*AHFFGPSHNPDFC*H*REWTSRRPDFSLPAVSTADEYPELGSFCGLGIFLQRRERL**L
V*PCSEGNSKGEFEDV*IGSEAPITLASLCTSSQARSDNHRGRIHRVD*TTGGL*AGGRF*NSECRL
34 >lcl|NP_780706.1|Plus119253990..19255120 NT_039590 beta-actin-like protein 2 Actbl2 __SEG__ Chr13 {Mus musculus} MVDDELTALVVDNGSGMCKAGFGGDDAPRAVFPSMVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILTLKYPIEHGVVTNWDDMEKIWYHTFYNELRVAPDEHPILLTEAP
LNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYNFTTTAEREIVRDVKEKLCYV
ALDFEQEMVTAAASSSLERSYELPDGQVITIGNERFRCPEAIFQPSFLGIESRGIHETTFNSIMKCDVDIRKDLFANTVLSGGSTMYPGIADRMQKEIVTLAPSTMKIKI
IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRKCF*
35 >lcl|NP_848816.3|Plus129712866..29715445 NT_109320 leucine-rich repeat-containing protein 8D Lrrc8d __SEG__ Chr5 {Mus musculus} MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKDQVVCLPVLPSPANSKAHTPPGNADITTEVPRMETATHQDQNGQTTTNDVAFGTSAVTPDI
PLQATHPHAESTLPNQEAKKEKRDPTGRKTNLDFQQYVFINQMCYHLALPWYSKYFPYLALIHTIILMVSSNFWFKYPKTCSKVEHFVSILGKCFESPWTTKALSETACE
DSEENKQRITGAQTLPKHVSTSSDEGSPSASTPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVEDSDLIYKLYVVQTLIKTAKFIFILCYTANF
VNAISFEHVCKPKVEHLTGYEVFECTHNMAYMLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKVREESSFSDIPDVKNDFAFLLHMVDQYDQLYSKRFGVFLS
EVSENKLREISLNHEWTFEKLRQHVSRNAQDKQELHLFMLSGVPDAVFDLTDLDVLKLELIPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDV
AEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERIPHAIFSLSN
LQELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIVAIPPSITHVKNLESLYFSNNKLESLPTAVFSLQKLRCLDVSYNNISTIPIEIGLLQNLQHLHITGNKVDILPK
QLFKCVKLRTLNLGQNCIASLPEKISQLTQLTQLELKGNCLDRLPAQLGQCRMLKKSGLVVEDQLFDTLPLEVKEALNQDVNVPFANGI*
36 >lcl|NP_899105.2|Plus119763699..19764946 NT_039649 actin-like protein 9 Actl9 __SEG__ Chr17 {Mus musculus} MDVNGHPKFQPSPETDGPLPLTSSTLMVSKSLQQDSLSMVGDRLPPKTGAVVIDMGTGTCKVGFAGQSQPTYTVATILGCQPKKQATKDQSELETFIGEAARSRPELRLV
KPIRNGIVVDWEAAELIWRHILEHDLQVATHEHPLLFSDPPFSPATNREKLVEVAFESLHSPALYVASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRL
DLAGNHLTAFLAEMLLGSGFSLQQEDLDLVENIKHHYCYLAPDFQKEQARPDEECKQSLKLPDGRTVTLGKELFQCPELLFHPPEIPGLSPIGLPAMAEQSLLKVPQELR
PHVARNVILCGGSSLFTGLEGRFRAELLHSLSPEDHVVVMAHPNRNLSVWIGGSILASLHAFQSCWVLREQYEERGPQVVYRKCY*
37 >lcl|NP_940801.2|Plus120631414..20633003 NT_039718 retinoic acid-induced protein 2 Rai2 __SEG__ ChrX {Mus musculus} MDDLQSQNLSMDMTDSPPTLANNRLENRMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNA
TYVMTTQGPVQLPVVLEQHVFQHLNSPLVLPQEAPCSSNAIHNNLFQGAEDSEAQPQLLDLRIPSQPQEPALPFEAVLQNLFPTQGSLGPPPCQPPPGYAPVPPQPFNSP
LSPLVPPATLLVPYPVIVPLPVPVPIPIPVPVPQSTESKFSPTFPKPPSSFGLHSFKGTQTTLEKDELKPLDILQSKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAG
EASPPVFQEDAALDLSLAAHRKAEAPPETLYNNSGSADIQGHTILEKLSSGMEMPFAPAKCSEASAMMESHSSNSNGTEMVSQPSHPGSELKAENNIEILSESQAAKVIV
SVEDAVPAIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESLGNAEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
38 >lcl|NP_997151.2|Plus11839482..1842049 NT_082868 coiled-coil domain-containing protein 87 Ccdc87 __SEG__ Chr19 {Mus musculus} MEPHSQEPDLKPIYHRLLSPLSLFPSKAKPPPEPPKRPSQDATPLQSIPLAKLKVGPLCRQVSKRLASSGRAARVTAKDRLRLTEVILEELKCNWREPPIEPILDYENNQ
KLRQRLESYVLISSEQLFVRYLHLLVTLPTSRRVFTESATLSRLAVNLARDCTVFLTSPDVYRCLLADFQTLLNLKHAQGGIVKLRPPPCPPGTFKLCPIPWPHSTGLDH
MPCSSLNLNYLVQLSRPYDFPSEPEPDPVEELKSIPQLKSRQQLLWVPSMIKDKEIESRPSPMVPLPSHSPSSESHQFPTSPVHSWLQRGQSMPCLHEGWSLADELCLLP
PSPHPLTPLILASESKPLPFRDIVAEDLKQKMKIMRMEWSRYSLLDSGLPPLLGVLTRRLTAQHHLEKLQQMIKSLQEEEASGKWDLQPPRIIPLHPQPVTVALKVHDQV
IVQVATVQLSERYFNDSFHVEGAGVLYNHLTGELDGKAIEEMDADRLVGNTTGEVYKELMSRVSVSHLSFEEGDQIEPSADKDWSSYLASSFLHQDKHMPIINRNLVGFY
SRRTSTPKPVPEKVPSLTLLPRHKSWDKRPNRHGVWMNWLKPSVSSEDYFKYLSFQESDFLHVIFQMYEKEAPVEVPVPVQEYLDIQQPPPLLQDEELEFMQGKWDWSSV
IEDGSGPGRAYIHNLQQRLKRLWVMLEVPEQNRLDMVIKYSSNARLQQLPALIKAWEQVLKPIQKRESLLGRLEWFEQQASDPNRFFQKPDLLMNRLLEENRFRSYLQRK
LNRMESNLVSLLERIESVFGEPVTFKGRSYLKKMKQDKVEMLYWLQQQRRIRNLTQAQKTFRQSCTFTGSSSQALVAPGNTPTTH*
39 >lcl|XP_001478273.1|Plus1complement(8511465..8511818) NT_165760 gamma-aminobutyric acid receptor-associated protein-like 2-like Gm3724 __SEG__ Chr5 {Mus musculus} MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKEEDGFLYVAYS
GENTFGF*
40 >lcl|XP_003084519.1|Plus112552395..12553096 NT_039185 putative transposase element L1Md-A101/L1Md-A102/L1Md-A2-like LOC100502613 __SEG__ Chr1 {Mus musculus} MAKGKRRNPTNRNQDHSPSSEPSTPTSPSPGHPNTPENLDLDLKAYLMMMVEDIKKNFNKSLKEIQENTAKELQVLEEKQENTIKQVEVLTEKEEKAYKQVMEMNKTILD
LKSEVETIKKTQSEAKLEIETLGKKSGTIDLSISNRIQEMEERISGAEDSIENIGTTIKENGKCKKILTQNIQEIQDTMRRPNLRIIGVDENEDFQLKGPANIFNKIIEE
NFPNIKKEIPMNI*
41 >lcl|XP_003084637.1|Plus13687206..3688372 NT_039264 actin, cytoplasmic 2-like Gm12715 __SEG__ Chr4 {Mus musculus} MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL
NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA
LDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII
APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*MD*AGARHLLHEL
42 >lcl|XP_003084702.1|Plus188661461..88662789 NT_039353 tubulin beta-3 chain-like LOC100502903 __SEG__ Chr6 {Mus musculus} MREIVHIQAGQCGNQIGAKFWEVISDDHGIDPSGNYVGDSDLQLERISMYYNEASSHKYLPRAILVYLEPGTMDSVRSGAFGHLFRPDNFIFGQSGTGNNWAKGHYREGA
ELEDSVLDVVRKQCENCDCLQGFQLTHSLGGGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNASLSIHQLVENMDETYCINNEALYDICFRTVKLATPTYGDLN
HLVSATMSGVTTSLRFPGQLNADLRKQAVNMCRSHVSTSSCPASPHLQTGAASSTVP*RCLSSHSRCSMPRT*WLPMTRATAAT*LWPLSSVGVCL*RRWTSRCWPSRVR
TAAT*WSGSPTTSM*PCVTFHPVGSRCHPPSLATARPPRSCSNAFPSSSQPCSGARPSCTGTRVRAWMRSSSPRPRAT*MTWCSSTSSTRTPLRRRRERCMKMTRNQKPR
GPS
43 >lcl|XP_003084837.1|Plus1complement(31069805..31070164) NT_039472 hypothetical protein LOC100504196 LOC100504196 __SEG__ Chr9 {Mus musculus} METPFWALDEARIRASWLTHSLQQPGFLIDGDYYIIDSLDRGVPALGTLPLLEVCLRAWHLPNPPYRPAVPTSPAPPPSGSGRPQEPPSLVARSRVLGQGGPRPGVRPAP
RRSLGRPAE*
44 >lcl|XP_003085099.1|Plus1301123..302238 NT_039613 putative transposase element L1Md-A101/L1Md-A102/L1Md-A2-like LOC100505360 __SEG__ Chr14 {Mus musculus} MAKGKRRNLTNRNQDHSPSPEPSTPTSPSPGNPNTPENLDLDLKAYLMMMVEDIKKDFNKSLKEIQENTAKELQVLKEKQENTIKQVEVLTEKEEKTYKQVMEMNKTILD
LKREVDTIKKTQSEATLEIETLGKKSGTIDLSISNRIQEMEERISGAEDSIENIGTTIKENGKCKKILTQNIQEIQDTIRRPNVRIIGVDENEDFQLKGPANIFNKIIEE
NFPNLKNEMHMNIQEAYRTPNRLDQKRNSSRHIIIRTSNALNKDRILKAVREKGQVTYKGKPIRITPDFSPETMKARRAWTDVIQTLREHKLQPRLLYPAKLSIIIEGET
KVFHDKTKFTHYLSTNPALQRIITEKNQYKNGNNALEKTRR*
45 >lcl|XP_003085325.1|Plus140337759..40338217 NT_039706 hypothetical protein LOC675747 LOC675747 __SEG__ ChrX {Mus musculus} MQSIEDVSHEVWQDCVKMCLQSELCSDAAIITNCPPWLLASFTEGNFTQITQEEIQTLLAREGREKLFLQGITLAGIKCLLIRDNLLTQGNSMDLRTKGQSRSSQAVTIV
QIESVFLVVMGKKGTEGGPLNLKAFEVAGYMREAILKKMAHS*
46 >lcl|XP_484859.3|Plus1complement(23440828..23441268) NT_039170 myosin light polypeptide 6-like Gm5526 __SEG__ Chr1 {Mus musculus} MSSAGPFPAVIKLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVT
LGEKMTKEEVEMLVAGHEDSNGCINYEELVRMVLNG*
47 >lcl|XP_486246.1|Plus110663816..10665168 NT_039476 tubulin alpha-1B chain isoform 1 Gm5620 __SEG__ Chr9 {Mus musculus} MRECISIHVGQAGVQIGNACWELYCLEHGIQADGQMPSGKTIRGGDDSFNTFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIG
KEIIDLVLDTIRKLADQCIGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIEH
PTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEHLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVIPKDVNAA
IATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVYWYVGESMEEGEFSEAREDMAALEKDYEEVGVDSVE
GEGEEEGEEY*
48 >lcl|XP_486686.1|Plus1complement(4882395..4883513) NT_039706 actin-related protein 2/3 complex subunit 1B-like Gm5637 __SEG__ ChrX {Mus musculus} MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWNKVHELKEHNGQVTGIDWAPEHNRIVTCGTDSNAYVWTLKGRTWKPTLVILRINRAARCVRWAPSENK
FAVGSGSRVISICYFEQENDWWVCKHIKKPISSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWV
SHDSTVCLVDADKKMAVATLASETLPLLAVTFITENSLVAAGHDCFPVLFTYDNAAVTLSFGGRLDVPKQSSQRGMAARERFQNLDKKASSEGGAATGAGLDSLHKNSIN
QISVLIGGKAKCSQFCTTGMDGGMSIWDVKSLESALKNLKIK*