SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom Z    

ID / Description / Sequence
1 >lcl|XP_001362212.1|Plus11244326..1245585 NW_001581979 actin-like protein 7B-like LOC100010699 __SEG__ Chr6 {Monodelphis domestica} MATRNTPSPRPTMPVGTAQGDPGEASVLMNLDGKSMDNGTPTQMKMKPKKTRKVKALIIDLGSQYCKCGYAGEPRPTYFISSTVGKHFQETANSGDNRKETYVGHELLNT
EVPLKLVNPLKHGIVVDWDCVQDIWEYIFQSAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFSIPAMHIASQSLLSIYSYGKTSGLVVESGHGASHVVPISEGDIM
PGLIGHVDYAGCDLTNYLMKLLNEAGHKFTDEHLHIMEHIKKKCCYAASNPEEEFSLPLEDLRVDYELPDGKLITIGKERFLCSEMLFKPSLAGASQQGLPSVTAASLNK
CEASFKEEMMANILLCGGCTMLDGFPDRFQRELSQLFPNDSPLVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEYEERGNAAIYSKC*
2 >lcl|XP_001362565.1|Plus1complement(954481..956934) NW_001587041 tax1-binding protein 1 homolog isoform 1 LOC100011071 __SEG__ ChrX {Monodelphis domestica} MTSFQEVPLSSTLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTQYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGATVNCLLSFQGYYLPNDDGEFYQFCYVT
HKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLEFKIEKTMKEKEELLKVTTVLEKETAQLREQVGRLEKELNHEKERCDQLQAECKGLVEASQNLQVE
SEELKKKHSEATSKVLQLEEDLMTVTQRAITKETDLDNLKDKLKKVTLEKEQLECQLKTEKDEKELYKVHLKNTEIENTKLVTEVQTLKNLDGNKETMIAHYKEEVGRLQ
LCVAEKENLQRAFLLTTSNKDDAANLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDQTMADLHSARLENEQVKKQLAETVAELRVAVVKKQQEKIDPVEQDLRREVE
DLKLRLQMAADHYKEKFKECQRLQKQVTRLSDQAKTGNQQKVMDASSNTEIADPPITIKLSAGAVGPATSEMVSEMVTKGQVCEMTKEIAEKTEKYKKCKQLLLDERAKC
STYADELAKMELKWKEQVKISEDLKLHLAEAEVQYKVELVQRDQEIRDMTFQLETLTREKEDEEKVLKKRLENPAERVMEGQNSWKSPVSNTLKEQNAPVPSVPNRKPVL
QFGNPYATQDTRDGADGAFYPDEIQRPPVRTFLWELEDNVVCSQPARNLSRPDGLEDPEDSNDDDENVLPAADPPSQLLHAHRTGFCFDSSFDVHKKCPLCELMFPPNYD
QSKFEEHVESHWKVCPMCSEQFPPDYDQQGFERHVQTHFDQNVLNFD*
3 >lcl|XP_001362585.2|Plus1complement(441472..442323) NW_001582020 hypothetical protein LOC100009954 LOC100009954 __SEG__ Chr8 {Monodelphis domestica} MRRSVRRRRRRPRAAAPAVVAAAAAAAAAAPGGGLRARGGDGLAAEREEKVVYSRSQLSLAGSTKALGDAFKLFMPRSTEFMSSDAELWSFLCSLKHQFSPHILRSKDVY
GYSSCRALVPDPPGPPPAANSHLARGGESPSPLLPPPPSRRPAPGAAAKRRRRGAGAARRVKKQQPALPQQPQPAPLLLLPPPRPEPSPPTPALPSPPPPLLLLPHAGRF
GGRTLEEIWKAATPVLTTFPTIRVGHDVWGERSLAAARRRAQQVLRVNLEPVVRLRRFPVATS*
4 >lcl|XP_001362988.2|Plus1complement(11796300..11797427) NW_001581995 actin, cytoplasmic 1-like isoform 2 LOC100011313 __SEG__ Chr7 {Monodelphis domestica} MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL
NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA
LDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII
APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*
5 >lcl|XP_001363096.1|Plus1complement(1461412..1461822) NW_001581961 gamma-aminobutyric acid receptor-associated protein-like 1-like LOC100010204 __SEG__ Chr4 {Monodelphis domestica} MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYS
DESVYGKKKALQTRVAGLAGGSFRHV*
6 >lcl|XP_001363119.1|Plus1complement(5975879..5976991) NW_001581860 mesoderm development candidate 1-like LOC100011181 __SEG__ Chr1 {Monodelphis domestica} MASGSSGKSTGEAASPPAPASGVCHSSAVGVGSQPRKRLVSVCDHCKVKMQLVADLLLLSSEARPVLLEGSTASSGPGSGESFEKCRDTIIARTKGLSILTHDVQSQLNM
GRFSEAGDSLAELGELVVSLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQGCGVLRATPLADMTPQLLLEVSQSLSRNLKFLTDACALASEKSRDRFARE
QFKLGVKCMSTSASALLACVREVKAAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAASVSPEGKAVQTAILGGAMSVVSACVLLTQCLRDIAQHPDGGAKMTDH
RERLRNSACAVSDGCNLLSQALRERSSPRTLPPVNSNSVN*
7 >lcl|XP_001363855.1|Plus1complement(597303..597839) NW_001581865 actin-related protein 2/3 complex subunit 3-like LOC100015059 __SEG__ Chr2 {Monodelphis domestica} MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPG
FPLNAIYARPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQSDKPSKWWTCFVKRQFMNKSLSGPGQ*
8 >lcl|XP_001364101.1|Plus1complement(3916104..3918686) NW_001581865 leucine-rich repeat-containing protein 8D LRRC8D __SEG__ Chr2 {Monodelphis domestica} MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKDQVVCLPVLPSSVNSKAHLASGSADVTTDVPKFEVTTDQGQGRWMTKGASFDEASTLTPGL
PLSRASSPPTDSPVPNQEMRKEIKDPTGRKTNLDFQQYVFINQMCYHLALPWYSKYFPYLALIHTIILMVSSNFWFKYPKTCSKVEHFVSILGKCFESPWTTKALSETAC
EDSEENKQRITGAQSLPKHVSTSSDEGSPSASTPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVEDSDLIYKLYVVQTVIKTAKFIFILCYTAN
FVNAISFEHTCKPKVEHLTGYEEFECTHNMAYMLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKVREESSFSDIPDVKNDFAFLLHMVDQYDQLYSKRFGVFL
SEVSENKLREISLNHEWTFEKLRQHVSRNAQDKQELHLFMLSGVPDAVFDLTDLDVLKLELIPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTD
VAEIPAWVYLLKNLRELYLVGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLTKLVIHNDGTKLVVLNSLKKMMNVAELELQNCELERIPHAIFSLS
NLQELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIVNIPPSITHVKNLESLYFSNNKLESLPAAVFSLQKLRCLDVSYNNISVIPLEIGSLQNLQHLHLTGNKVDLLP
KQLFKCVKLRTLSLGQNCITSIPEKIGQLSQLTQLELKGNCLDRLPAQLGQCRLLKKSGLVVEDHLFDTLPTEVKEALNQDTNAPFANGI*
9 >lcl|XP_001364168.1|Plus1complement(1230479..1231813) NW_001581979 actin-like protein 7A-like LOC100010769 __SEG__ Chr6 {Monodelphis domestica} MAFTRTWAPQVATVGEGPAKRALLVKATEQLSKEPESFQVASLTEGPAKKALLINNKKKPEENALSTLVKEKPKRVKKTRAVVVDIGTGYCKCGYAGEPRPSHVISSMVG
KPYMETAKTGDNRKETFIGHELLYPDIRLKLVNPLRHGIIVDWDSVQDIWEYLFLHEMKIPPEEHAVLVSDPPLGPYTNREKYAEMLFETFNTPAMHIAYQSRLSMYSYG
KTSGLVVEVGHGVSYVVPIFEGYPLPSITGRLDYAGSDLTAYLMTLMNQYGKNFTEDQINIVEDIKKKHCFVALDPGQESPSIKDDKINYQLPDGEQITISQERFLCSEM
FFKPSLIKSMQLGLHTQTLTCLNKCDVALKRDLVNNVLLCGGSTMLNGFSARLQKELYKICPNDTPTVNVLPERDTSVWTGGSILASLQGFQSLWVQRSEYQEHGPFFLY
RRCF*
10 >lcl|XP_001364249.1|Plus15611498..5612475 NW_001581837 transmembrane protein 121-like LOC100012949 __SEG__ Chr1 {Monodelphis domestica} MVLPPPDKRHVCLTTVVIMSSMAFMDAYLVEQSQGPRKIGVCIIVLVGDVCFLLVLRYVAVWVGAEVRTAKRGYAMILWFLYIFVLQIKLYFIFQNYKAARRGAADPVAR
KALTLLLSVCVPGLFLLLVALDSMEYVRTFRKKEDLRGRLFWVALDLLDLLDIQANLWEPPRTGLPLWAEGLMFFYCYMLLLILPCVSLSEISMQGEHISPQKMMLYPVL
SLVTVNVVTVLVRAANMVLFHDSRVSTIFIGKNVVALATKTCTFLEYRRQVRDFPPPHGALALELQPPQPPPPQLLHNSVPHAPPIHSGPGAPHGPSPTRDTLDT*
11 >lcl|XP_001364814.1|Plus11212186..1212674 NW_001581876 actin-related protein 2/3 complex subunit 2-like LOC100011122 __SEG__ Chr2 {Monodelphis domestica} MNRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMEEFKEGRRASHTALQVLFSHREPPLELKDTDATVGDNIGYITFVLFPCHTNANARDNTINLIHTFL
DYLHYHIKCSKAYIHTRMRTKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR*
12 >lcl|XP_001365207.1|Plus1244493..245626 NW_001581943 actin-like LOC100017553 __SEG__ Chr4 {Monodelphis domestica} MLDPKVLEVPAVIFDNGSGLCKAGIAGDNVPRSVITAIVGRSKAKATMLGAGQKEYYVGEEAQSKRGVLSLNYPIDHGIVTSWDDMEHIWRHVYECELRVQANEHPVLLT
EAPLNPLQNREKMTEIMFESFKVPAMYVAVQATLALYASARTTGIVMDSGDGVTHTVPIYEGYCLPHAVSRLDVAGRDITEYLMRLLLESGHSFVSTAEREIVKDIKERL
CYVTFDPIQAMKIKSEEILKEYKLPDGNIIKIGNQLFRAPETLFMPANVGVEAPGVHKMLFNSIRKCDIDVRKNLYSNILLSGGSTLFHGLDERILKEIQLQAPGGISVR
IIAPPERKYCVWIGASILTSLTSFKHMWITTSDYKEFGPTMVHRKCF*
13 >lcl|XP_001365268.1|Plus1247167..248300 NW_001581943 actin-related protein T2-like LOC100017586 __SEG__ Chr4 {Monodelphis domestica} MFNPHILETPAVIFDNGSGLCKAGVSGEIGPRHVITTVVGHPRYKMGNSEQNQKLYYVGEEALYKGESLFLQNPIERGIITMWDDMEQLWRHLFDWELGIKSSERPVLMT
EPSLNPRNNREKMAELMFESFKVPAFYLSDQAVLALYASACVTGLVVDSGDSVTCTVPVFEGYSLPHAVSKLYVAGKDITDYLLRLLLNSGRTFPCTLDKGLVDDIKEKL
CYVALDPQKELSRRPEEVSRDYRLPDGNIIRFGDQLFQGPEVLFDPEELGIQLPGLSKMVPNSILKCDTDIQKSLFGDILLSGGSSLFPGLDDRLMKETEQQAPKDIPIK
ITAPPDRWFSTWIGASIVTSLSSFKQMWVTSMDYREFGTSVVQRRCF*
14 >lcl|XP_001365655.1|Plus119961991..19962572 NW_001581861 cysteine and glycine-rich protein 2-like LOC100016597 __SEG__ Chr1 {Monodelphis domestica} MPNWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTAAIHDDEVYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPENVQPHRPTTNPNTSKFA
QKFGGAEKCSRCGDSVYAAEKGIGAGKPWHKNCFRCAKCGKSLESMTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ*
15 >lcl|XP_001365701.2|Plus17335994..7336500 NW_001581992 centrin-2-like LOC100011661 __SEG__ Chr7 {Monodelphis domestica} MASNSQSSTWRRRKPKVTVELSEGQKREIKETFNFFDVDGSGNIDLKELKTAVCALGFEPKKEEIHKMMAEIDKEGLGTMNFESFLTVITTKMREKDEKEQLLKAFKLFD
DDNTGCITLKNIKKVAKELGENLSDDELQEMLDEAGRSGNGKLNEREFLKIMKKTSLY*
16 >lcl|XP_001365787.1|Plus119315790..19316308 NW_001581894 centrin-2-like LOC100017394 __SEG__ Chr3 {Monodelphis domestica} MASTTKKPNMGPSLPRRKLEPKPELSEDQKQEIREAFDLFDTDGTGTIDVKELKVAVRALGFEPKKEEIKKMISEVDKEGTGKISFNDFLAVMTQKMNEKDTKEEILKAF
KLFDDDDTGKISFKNLKRVARELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKSSIY*
17 >lcl|XP_001365902.1|Plus1complement(20311286..20312416) NW_001581894 beta-actin-like protein 2-like LOC100017686 __SEG__ Chr3 {Monodelphis domestica} MSDDDLSALVIDNGSGMCKAGFGGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGVVTNWDDMEKIWHHTFYNELRVAPDEHPILLTEAP
LNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYNFTTTAEREIVRDVKEKLCYV
ALDFEQEIASAATSSSLERSYELPDGQVITLGNERFRCPEAIFQPSFLGLESSGIHETTFNSIMKCDVDIRKDLYANIVLSGGSTMYPGIADRMQKEILTLAPSTMKIKV
IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPPIVHRKCF*
18 >lcl|XP_001365953.1|Plus1complement(20070582..20071346) NW_001581859 leucine-rich repeat-containing protein 18-like LOC100014490 __SEG__ Chr1 {Monodelphis domestica} MAKGKGPKGKKITLKVAKNCIKVTFDGRKRLDLSKMGITTFPKCILKLNDVDELDMSRNMIKKIPDSINKFQNLRWLDLHSNFIEKLPDTIGELASLHYLNLCNNKLTTN
TLPVELKELKNLRVLNLGLNHIDNIPTTLGQLKELHEMGAFDNLLTTIPTSIAKLPKLKKLNVKRNPFPQEDDSAEFIDSIKRLESLYLVEAKDLCGPCLKKCQDARDKL
NKIKSMAPAQARKPNFINLINPNSTAKESQEEWR*
19 >lcl|XP_001368275.1|Plus153330041..53330310 NW_001581963 dynein light chain 1, cytoplasmic-like LOC100021555 __SEG__ Chr4 {Monodelphis domestica} MSDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYMGQVAILLFKSG*
20 >lcl|XP_001369024.1|Plus1complement(62200374..62201681) NW_001582021 microfibrillar-associated protein 1-like LOC100022405 __SEG__ Chr8 {Monodelphis domestica} MSVPSTLMKQPPINSTAGAIQVHNEKGEISMEKVKVKRYVSGKRPDYAPMASSDEEDEEFQFIKKANDQEVEPEEQGEDSPSDPRLRRLQNRINEDVEERLARHRKIVEP
EVVGESHSEVADVRQLEREDGREEKIDEEDIEWRHGMMRQRAQERKNEETELMEVEDEGHSGEESESESKYEEYTDSQDEMEPRLKPVFIQKKDRVTVQEREAEARKQKE
LEQEAKRLAEERRKYTLKIVEEETKKELEKNKRSLAALDALNTDDENEEEEYEAWKVRELKRIKRDREDREAMEKEKSEIEHMRNLTEEERRAELRENGKVITNKAVKGK
YKFLQKYYHRGAFFMDEDEEVYKRDFSVPTLEDHFNKTILPKVMQVKNFGRSGRTKNTQLVDQDTTSFDSAWSQDSAQNTKFFKEKASGVQDVFERPSAKKRKTS*
21 >lcl|XP_001369161.1|Plus1complement(62356489..62357796) NW_001582021 microfibrillar-associated protein 1-like LOC100022683 __SEG__ Chr8 {Monodelphis domestica} MSVPSTLMKQPPINSTAGAIQVHNEKGEISMEKVKVKRYVSGKRPDYAPMASSDEEDEEFQFIKKANDQEVEPEEQGEDSPSDPRLRRLQNRINEDVEERLARHRKIVEP
EVVGESHSEVADVRQLEREDGREEKIDEEDIEWRHGMMRQRAQERKNEETELMEVEDEGHSGEESESESEYEEYTDSQDEMEPRLKPVFIRKKDRVTVQEREAEARKHKE
LEQEAKRLAEERRKYTLKIVEEETKKELEKNKCSLAALDALNTDDENQEEEYEAWKVRELKRIKRDREDREAMEKERAEIEHMRNLTEEERQAELRANGKIITNKAVKGK
YKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFNKTILPKVLQVKNFGRSGRTKYTHLVDQDTTSFDSAWSQDSAQNTKFFKQKAAGVQDVFERPSVKKRKTT*
22 >lcl|XP_001369414.1|Plus153671463..53672782 NW_001581837 tubulin beta chain-like LOC100024672 __SEG__ Chr1 {Monodelphis domestica} MREIMPLQARQCQISTKFWEVISDKHGIDPTRTYHGESNLQLERIHIYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSVAGNNWAKGHYTEGAEL
VDSVLDVVRKEAESCDCLPGFQLMHSLGVGTGSGMGTLLISKIRADRIMNTFSVVSSPKVLDTVVEPYNATLSVHQLVENTDETYCIDNEAFYNICFRTLKLTSPTYGDL
NHRVSATMSGVTTCLCFPGQLNIDLSKLAVNLVTFPRLHFFMPGFAPLTICGSQQYHALTVPELTQQMFDAKNMMAACDPWHGCYLTVAAVFRGHISMKEVDEQMLNVQN
KNSSYFVEWIPNNVKTAICNIPSRGLKMSATFIGNSTAIQELFKHISEQFTAMFHRKAFLHWYTGEGMDEMEFTEAESNMNDLVSKYQQYQDATAEEEGNFEETEEEVE*
23 >lcl|XP_001369527.1|Plus1complement(459116..459973) NW_001582015 leucine-rich repeat-containing protein 10-like LOC100015471 __SEG__ Chr8 {Monodelphis domestica} MGNTIRALIALVPTSGCQNYLLGELQEMPLDKMVDLSSSQLRRFPLRVCSFRELVKLYLSDNNLSSLPPELEQLQNLQILALDFNNFKALPRVVCTLRQLCILYLGNNKL
RDLPPELSWLQNLRTLWLENNSLTQLPDVVCELSLLKTLHAGSNALRLLPRQLSRLQELRTIWLSGNLLSDFPAVLLHMPFLEVIDVDRNNISHFPSLLHLAGLKLVIYD
HNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRLRMAKEEEAEEAQAAAPPAPPPLPPPAGEDP*
24 >lcl|XP_001370707.1|Plus14744933..4745646 NW_001581931 TMF-regulated nuclear protein 1-like LOC100017018 __SEG__ Chr4 {Monodelphis domestica} MPGCRISACGTAPRPGEPPPPPFSPPLPPHSSPAPSDPGDEQGSPPPSPPPQPPPHPQSAASGTTTATTTTPAPPAEKGTGRGLELQRWRPGGHGAAGAAAAGSRALELA
EARRRLLEVEGRRRVVSELESRVQHLHRVFLAAELRLAHRAESLSRLGGSVSQAELYLAAHGQRAKKGLRRGKRPRPPALLASALGLGGCVPWAAGRLRRAGAAAASPEP
DSPFRRSPPRGPASPQH*
25 >lcl|XP_001371801.1|Plus1complement(2086511..2086927) NW_001581873 cornifin-A-like LOC100018686 __SEG__ Chr2 {Monodelphis domestica} MSSHQQKQPNIIPPQLQQHQVKQPCQPPPQEPCDPKGPQPGTTKLPQPNYPKVPEPGTTKLPEPCHPIVPEPGTTKLPEPCQPTVPGQHPTKKPEPYYPVVSVPTQPKIP
EPGTTKVPGSYPPPAQEKYPQVPNTKQK*
26 >lcl|XP_001371985.1|Plus118289859..18290488 NW_001581839 translationally-controlled tumor protein-like LOC100018984 __SEG__ Chr1 {Monodelphis domestica} MITYQDLISHDEMFVNIYKIQEILNGLFLEVEGKLISRTEGTIDDSLIGGNASAEGPEVQVITGVDIVINHHLQENSFTKESYKKYIKDYMKSIKGRLEEQKPDRVKPFM
TGVTEQIKHILANFNNYQFFIGENMNPDGMVALLDFHEDGVTPYMIFFKDGLEMEKCNKFSQLCWVTCHHNWLLLFVIYTTSGLGQISTDITLSFIHLF*
27 >lcl|XP_001373262.1|Plus120462030..20462548 NW_001581837 myosin regulatory light polypeptide 9-like LOC100020953 __SEG__ Chr1 {Monodelphis domestica} MLSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEGFNMIDQNQNGFIDKEDLHDMLASLRKNPTDEYLEEMMSEAPGPINFTKFLTIFGEKLNGTDPDDVIRNAFACF
DEEASGVIQEDHLRELLTTMGDRFMDEEVDEMYREAPIDKKGNFNYVEFTQILKHGTKDKDD*
28 >lcl|XP_001374276.1|Plus133827925..33828341 NW_001581981 gamma-aminobutyric acid receptor-associated protein-like 1-like LOC100022419 __SEG__ Chr6 {Monodelphis domestica} MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKNLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYS
DESVYGKPRKKALQTRAAGLAGGSFLHV*
29 >lcl|XP_001374664.2|Plus127798871..27799257 NW_001581837 translationally-controlled tumor protein-like LOC100022984 __SEG__ Chr1 {Monodelphis domestica} MIIYPDLLSHEEVFSDSYKFLEIENRLCLEVEGKMVRKAEGAIDDSLIGGNASAEGPEGEETDATKMTGVGIVINHHLQETSFTKESYKKYIKDYMKSSKGRLKDQKPDR
VKPFLTGATEQINVNKFS*
30 >lcl|XP_001374910.1|Plus1253671..254807 NW_001581943 actin-like LOC100023336 __SEG__ Chr4 {Monodelphis domestica} MIASEITKIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQDNRSILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLT
EAPLNPPENRAKMVEIFFETFQVPALYVALQGLMALYATGKSTGVVLECGDGVTAVIPIYQGRCLFQSISRSDFAGGDVTNYLAGLFLEKGISLMNTGSKDIITDIKERL
CYIIPDPHERMKEENLDCSIYNYILPDGQTMQIGDELFQVPECLFQPSKAGSSAPGIHTLVTESVLKSSHHFQKDLLNNLILSGGSTLCPGMKRRLWREIQSLMKGSLKV
NIMAPSDRLLSVWIGASVITSLSTFQQMWMSSSDYNELGPSAKQNCFW*
31 >lcl|XP_001376549.1|Plus1433653..436109 NW_001581987 NF-kappa-B-repressing factor-like LOC100025699 __SEG__ Chr6 {Monodelphis domestica} MAGERLLLGDDFLSPPTPPPLPPPLPLQPPPIPSPPPPLPPSPSPPLPELQPEPEPDPEPEPDPEPDPEQKLEESLAQWRYSHESDRQWGLRRQFICRHLHNYTGPGAIE
KLLSLSTAWTNHIFLGCKYGPQLMEKILQMAEGIDIGEMPSFKLVVPEPPKVQKRPLSPHADPSPPKKKAAPRFLVRPRFEPVHFVASSKEEERKKDPTDSRNEWGDPQV
DSIKWPVDSLKSYVRDRFRARFGKTRFSQTRFSFVERKPTTTRTFSSYGDPETYNLYSQSVDESSSAATFSHLVLATKQSFIERLSGAVQRNMPRKEVSHRSEKSSYTFI
LSRCFHACRTNPEYIYASLKEISPSDIPRSKKFLTDGYACEVRCQSVYLTTGYAASKNASRDRATEQAVKLLQKPVEVKIVKRKFKHTYHDDLVVFPAGLSSYDFPPALR
VPEDFLSTRNEFGQLNYDSAFPLSKRWNNFVLIENASDSIGILNKSASFNRMAIEYKYDIMPNNSWRCQVVLEGQCLAEGYGSKKTSKYAAADEALNILQKMKSNIAATQ
VQPVSYSTKDYGRRKDLRDRRVYGNSSNPVHTLNDTTQFNKMTVEYIFEKLTVLQWKCKVMLEKELITEAVGIRRGVKHETVEEVVKILKKTRPTAFNHLKRGAIEDMIT
RSEIRGRSGDDGYQQEIKEDNIGNQLLRKMGWMGGGLGKCGEGICEPISVKEQHKREGLGLDVEKPNKLYKRYIDQIIKNYAHSECHADLVFSTEFTSDERKQIHQMAQK
YGLKSKSHGMGHDRYLVVGRKKRKEDLLDQRKKEGQVGHYDFHMSQGN*
32 >lcl|XP_001376843.1|Plus12099732..2100862 NW_001581926 coiled-coil domain-containing protein 89-like LOC100026119 __SEG__ Chr4 {Monodelphis domestica} MSSSTSSSKVTEIEDTIESLDEDGDDDDDDDDDDDDDDMECKELEGLKEALENLRGLSSEEKNEKAMLRSRLQEQSQLICILKRRADETLERCRVLEQLNTELEEKRMND
AERLEAQTQRTLKLESRFMDLASNHEEMIRFKDEHKRQNVKLREENEMLRRENREHFSQALKDQEAKVCHLTAQGEKLSKELETLKGKCAEDTSRAKAREKELLDLQQQQ
ALSHAKETSNLRNQLQALEDLHRKTLAKMIKSEEKQKGLSSDMSNRLEKVTKEKEELLQLSMERGKVLQNKQLEIQQLEEKLEAAEVGRKNALDRFEQEAALVNSNLKVQ
ELSRKVEGIQNAYDELWLQSEAFKKHSLDLLTKERELNAKLRHLFP*
33 >lcl|XP_001377247.1|Plus1complement(62656..63912) NW_001581909 actin-like protein 9-like LOC100026731 __SEG__ Chr3 {Monodelphis domestica} MDVHCNESPVIGHAPRFHKGHPQTSTILDDVSLPVDIEMPFVLGDGLIEKTGAVVIDMGTGTCKSGFAGQAKPVSTVATVLGHLPEKASTASRPQLPTFIGECARGHPGL
SLIQPLRNGIIVDWEAAETLWHYVFYNDLGVAPEDHPLLLSDPPFSPTTNREKLVEVVFESLHSPGMYVAYQSVLSVYAHGLVSGLVVDSGHGVTHTVPVYQGYNLPHAT
ERLDLAGSHLTAFLAEMLRGAGYPFGERDTLILESIKHQCCYVADDFVAEQNLPTKAIRENFRLPDGKVISLGKERFQCPELLFNPPEMPGLVPLGIPDMAKESLRKVPS
EAREDISQNVLLCGGSSLFPGLEQRFSKELLQGAPPQTFKSVCAQPLRNYSVWIGGSILASLRAFQSCWIQRNQYEEQGPYIVYQKCY*
34 >lcl|XP_001378238.2|Plus1complement(48389608..48390981) NW_001581981 actin-like protein 7B-like LOC100028132 __SEG__ Chr6 {Monodelphis domestica} MASQSTNTKSTQNVDGKVSYGKSTAKTLPFTTYCRPGVTYKILPMTEVEKGPHCVKYSLTESSENHSVVKHYGSFQGSHHELVSTADFQERPPAQMTSSHTTASYKNLAA
VVIDTGTGYSKCGLAGEDRTRAIVPTRVGRHLNSEGDKTPYYITEEAEAACSTLIRGVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREKVVELLFENF
GVPAMQTVHQALLSLYAYGRTTGLVMGSGHGTSYVAPIITGELAPLNLYRLDVAGKDLSEYLSQLLLAGGQPPPKIDVLTHMKETCCYVTLDMVSELCQLESKNRLDFVL
PDKHILSLGAERFRCPEALFKPDVLGLNQPSLPELAQISISQLEPHLQDQLLANVVLEGGTTLLNGFSERVQQELGSTANVLSLPHRAMAAWLGGSIMASLDSFQTLWLS
RGEYQEEGPWAIYKYHL*
35 >lcl|XP_001379436.1|Plus1complement(18185152..18186282) NW_001581855 actin, cytoplasmic type 5-like LOC100029767 __SEG__ Chr1 {Monodelphis domestica} MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP
LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDVKEKLCYV
ALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESIFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI
IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*
36 >lcl|XP_001381523.1|Plus1complement(97589640..97590170) NW_001581837 SCAN domain-containing protein 1-like LOC100032535 __SEG__ Chr1 {Monodelphis domestica} MAAEPESAGPLSPAPPENEAASPVKLEEPAASRDSSKAPASLPGPVAPEASPRVPAASPPASPPAPGPAAQATSPPSPVPFPAVLEASPLAPSPAGSRPGPETFRQRFRQ
FRYHEAAGPREAFHQLRELSRQWLRPEVRTKEQIVEMLVQEQLMAILPEELRARRRGRRSDVRITG*
37 >lcl|XP_001381563.2|Plus1complement(164246459..164247508) NW_001581879 proline-rich protein 18-like LOC100032587 __SEG__ Chr2 {Monodelphis domestica} MPFPPIQQQQPQQQQQQQQQQQVPGVPTPPTVNAAATRELPKKPTTQRKTAVHAPPVPGSLAPTAGGEKKKRPPEKAEMLLSSSWPSATLKRQLAKRTPGPAASRTQPQP
PLRPTQQPLAPATATTSTPTRPLLPATCTMPGLAHSCESLAAGGSSVPGPGAGTSSGGEEEAVRFSLSLTPEAILVIQRRNLEKQLLARQRRPFPSPAADTKRLLSSCPR
SKAGAMGTTSGQRKGIAISGAGGTPVGGFGSTSRRPTQSQPQLLSGAMQPLSTTSRGGHLGSGDLRTLLKISLLNEHHKYDDVEYEEEAEAVDEGLVRKCTEWLRGVENA
AATRDRAEKLETLPHLGTL*
38 >lcl|XP_003339654.1|Plus1complement(25486915..25487433) NW_001581839 translationally-controlled tumor protein-like LOC100017156 __SEG__ Chr1 {Monodelphis domestica} MIIYRDLISHDEMFSDIYKIREIANGLCLEVEGKMVSRTEGTIDDSLIGGNASAEGPEGEGTDATVITGVDIVINHHLQETSFTKESYKKYIKDYMKSIKGRLEEQKPDR
VKPFMTGATEQIKHILANFNNYQFFIGENMNPDGMVALLDFREDGVTPYMIFFKDGLEMEKC*
39 >lcl|XP_003340178.1|Plus1complement(503127..503903) NW_001581870 hypothetical protein LOC100616734 LOC100616734 __SEG__ Chr2 {Monodelphis domestica} MSAPPRQPALPWPWLLLLLPLLLPAPPSRARGDSVPPAPPPPPSPEPEAEPGPDPPWCPYKVLSEGQEAGSGRLCFRSPEPDFRCQQRLCKAYRSAGRTLVANVLRNSSV
LLQWRPPPAAPARELRGFALNCSWDGSYTRFQCDRVQLGASCRDYLVPDVHDSVRYRLCLQPLLRRPRREPPRPGAPPAPTPPPPPPPPAECVEFAAEPAGMRDIVIAMT
AVGGSICVMLVIICLLVAYITENLMHPAFGRPRGRRQP*
40 >lcl|XP_003341267.1|Plus1complement(129640645..129641163) NW_001581961 translationally-controlled tumor protein-like LOC100026304 __SEG__ Chr4 {Monodelphis domestica} MIIYRDLISHGEMFSDIYKIWEIANGLCLEVEGKMVSRTEGTIDDSLIGGNASAEGPEGEGTHATVITGVDIVINHHLQETSFTKESYKKYIKVYMKSIKGRLEEQKPNR
VKSFMTGATEQIKHILANFNNYQFFIGKNMNPDGMVALLDFHEDGVTPYVIFFKDGLEMEKC*
41 >lcl|XP_003341701.1|Plus1complement(48355065..48355385) NW_001581978 hypothetical protein LOC100619937 LOC100619937 __SEG__ Chr6 {Monodelphis domestica} MNYGNPPPYSDPGPTAPYPPYPQQPQGYPSSGPYPPGPPGPYPPPNAGYPYQGYPQYCWQGGPPPEAPQTTVYVVEDQRRDDSDQTTCLTACWTALCCCCLWDMLT*