SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam Z    

ID / Description / Sequence
1 >lcl|NP_001166015.2|Plus120074989..20076101 NW_876258 retrotransposon-derived protein PEG10 isoform 2 PEG10 __SEG__ Chr14 {Canis lupus familiaris} LGPDCPPPPPPPPPNGPSSSSSSCSSSSSSSSSSRSAPRGQYIPNLAERRRDDLSEEINNLREKVMKQSEENNNLQNQVQKLTEENTSLREQVEPAPQDEEDDLELRGAA
AAAAPPTPLEEECPDDLPEKFDGNPDMLVPFMAQCQLFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMTEMKHVFEDPQRREAAKRKIRRLR
QGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGLSDHIQAELSRLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHITSHHQVDPTEPVGGARMRLTQEE
KERRRKLNLCLYCGNGGHYADNCPAKASKASPAGNSPAPL*
2 >lcl|XP_003431483.1|Plus1complement(740148..740684) NW_876250 actin-related protein 2/3 complex subunit 3-like LOC100683087 __SEG__ Chr10 {Canis lupus familiaris} MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTPGITNFPIPGEPG
FPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ*
3 >lcl|XP_003432330.1|Plus110057902..10059677 NW_876264 keratinocyte proline-rich protein-like LOC100686380 __SEG__ Chr17 {Canis lupus familiaris} MCDQQQIQCCLPLPQCCVKGSSFYSSKSPSANSQVVVQAPREMQIIECPAPCPVQVSQVKCQASSQSKTTQVKCQAPCPSKTAQVKCQAPCPSKTTQVKCQAPCQSQISS
VQSQALCQPEVSYVQCEGPCPVQTCYVECAPVCYTETCFVEYPVQNFVPCPAPQPVQTYVACPSVSQTQGKFSTQRQYQGSYGRYALQGQSPASYNNCTPQFQSRTAYSN
CAPQRQSRASFSTCAPQCQARGSYGSFSSQRSRSQSTSRCLPPGPLQPLYRSCSPPRRSEPFHSRCLPSACSSGSYNYCTPPRRSEPIYSSGCPRGPSSGCAGRCGPKCR
IEISSPCCPKQVPPQKCAVQIPPIRRCSESCAPRPSWGASCPELRPPAESRPLPSFCPSRRLDRSPESSLQRCPLAAPSPCPRPAPRRYQRPEPCARSGPRSCPPPRRLS
EPCLCPEPRPAPRAAPRPRPVQREFPEPRPCPQPCERPAAYPLPEPSPLPAPCPSPEPCAEPLRCPSPSSGPRPNPGPGDLGCHESSPCLLDTEAPSCGPTGCNQWQGSG
DNFRPCDGIPEPQGFGDCGDQGGTCVGLKGGSDAGTKGAYF*
4 >lcl|XP_003432600.1|Plus15351151..5351957 NW_876269 microtubule-associated protein RP/EB family member 1 MAPRE1 __SEG__ Chr1 {Canis lupus familiaris} MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFEILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
FKKFFDANYDGKDYDPVAARQGQETAVAPSLVVPALNKPKKPLSSSSAAPQRPIATHRTTATPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGK
LRNIELICQENEGENNPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY*
5 >lcl|XP_003432671.1|Plus1complement(30013395..30014396) NW_876270 hypothetical protein LOC100684457 LOC100684457 __SEG__ Chr1 {Canis lupus familiaris} MPCPRPPWLPRPRTPQGSSPSSPSSLSATRSPSREGGEDDDGEEEEGDSSPVLGPILPSASPVECLICVSPFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGDAVACP
VCRAPTRLAPRRGLPALPTQPGLLPRDAHVAPPRQGSVRFDRRRGLLYLRPPPPPPGPRKFRAARPPPPPPPLRLGRPLSRRLSWTSPAWAFNAAVALAVLVAAGLVVSG
VYIFFLIPHATSSGPARPQLVALAPASGFSWFPPQPASGTPWTPAWTPRPVGPDQDTALPGAAEDVLEPEGVSEDTAEVEGTLDRPPDGLWGAEGEPGRAPRGWSRRRVW
GPQ*
6 >lcl|XP_003432802.1|Plus1complement(22886380..22887126) NW_876271 tropomyosin alpha-3 chain TPM3 __SEG__ Chr20 {Canis lupus familiaris} MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEI
QLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDL
EDKLKCTKEEHLCTQRMLDQTLLDLNEM*
7 >lcl|XP_003433236.1|Plus1complement(3330295..3330876) NW_876277 proline-rich protein 3-like LOC100687912 __SEG__ Chr24 {Canis lupus familiaris} MPLKYLPVGKKQNQQPPPPPQQPLLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHRGPPGSRGPMIPPVLSVPPPPRGRGPIWGGLGPRCSPYGHGWWGAN
TEPPFPGPGHGGPSRGGFHKEQRNPQRLKRWSLIKNTCPPDDGPQVMEDKSNLPVCRHFAKKGHRRYEDLCAFYHPGVNGPPL*
8 >lcl|XP_003434436.1|Plus125774749..25775633 NW_876307 actin, cytoplasmic 2-like ACTB __SEG__ Chr3 {Canis lupus familiaris} MEKIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSSDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMK
ILTERGYSFTTIAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF*
9 >lcl|XP_003435275.1|Plus1complement(11721917..11722222) NW_876332 dynein light chain 1, cytoplasmic-like LOC100683264 __SEG__ Chr9 {Canis lupus familiaris} MKDNMSLLFEALSFGYICYITMESLSEEMQQDSVECATQALEKYNKEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVIHETKHFIYFYLGQVAILLFKSG*
10 >lcl|XP_003435573.1|Plus156344076..56345047 NW_879563 coiled-coil domain-containing protein 160-like CCDC160 __SEG__ ChrX {Canis lupus familiaris} MDARRKHWKENMFAPFFSAQDVLDEASQPESSCEQMTLDKANRIEGLFNLSSRKFQEENKFKRKEFISQLNEKEQEPNLRERKINISKNEADTNSVSCESSNLDVVTEES
FNSTEDHSIWSTKELPILPRQDVKKKFTEGMSPKLRLNLLNEELEELNMKCRKIEEEFENAEKELLNSKKEVSSKPLRFQETGGETSKKDWELQALRNDLSEKATNVQNL
TEELQQAKELIHRLSLENRDLKEAVRKLKRQTEIGNALLKEEMKLYYELEMEKIRGELDAIKNELRAEKTLQARNNRALELLRKHFASVTSSSTLDSLTEDFF*
11 >lcl|XP_003435716.1|Plus152460289..52460933 NW_879563 UPF0594 protein C13orf38 homolog LOC100688376 __SEG__ ChrX {Canis lupus familiaris} MGDRREDNFEDMSIDCLKLELLEEIYMRDLVQLSILEIRHKIAELEAKPNTDNEGSEWKTRYEAQLELNNHLEKQIATLKEKMEKIHGNPSDRLSSIRVYERMPVESLNA
LLRQLEKEKRSLENQVKNCALRLEQESKAYNKTNDERRTYLAEMSQFSGSHQVSKRQQMDQLQKIKENHVKTGRYNSANQKIVNAKKVPAKKITKPNHLPKLNP*
12 >lcl|XP_532025.2|Plus154999314..55000636 NW_876253 actin-like 7A ACTL7A __SEG__ Chr11 {Canis lupus familiaris} MALDSMWAPQAGIIGDGPAKRGGEQAPLQAHVLQTASLKDGPAKRAVWVRCNRSEPEEPTKSTTVREKPRLEVTKAVVVDLGTGYCKCGFAGLPKPTHNISSTVGKPYME
TAKTGDNRKETFVGKELINPEVRLKLVNPLRHGIIVDWDTVQDIWEHLFHKEMKISPEEHAVLVSDPPLSPHTNREKYAEMLFETFSTPAMHIAYQSRLSMYSYGRTSGL
VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLMGLMNNLGKHFTEDQLSIVEDIKKKCCFVALDPIEEKKVPATVHTIQYTLPDGKEISLCQERFLCSEMFFKP
SLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDNPQVNVLPERDTAVWTGGSILASLQGFQPLWVHRFEYEEHGPFFLYRRCF
*
13 >lcl|XP_532347.2|Plus1complement(7741477..7750323) NW_876256 epiplakin EPPK1 __SEG__ Chr13 {Canis lupus familiaris} MMNGHASPPPDALAASSTALTGPKTMKAMAGTSTPSRPRPQPQAALSAQSKSIAGVYVEASSQAQSLYATMKQGLLSEELGLALLEAQAATGGLVDPTQSQVLSVSEAVQ
QGLVGLELKGKLLAAERAVTGYPDPYGGGRLSLFQAIRKEVVDRAQGWRWLEAQLATGGLADPIRGVRVAPELACQQGLLDQETWHVLLECKPGSGAPGFQDPNTLEWLS
YRELLGRCVRAPTTGLALLPLKITFHTLSGAVSLAELLEVGILDEETARGLQEGKLAVPDVSARADVKHYLQGTGGIAGVVQLPAGHKKSIFQAITEHLLPMGTGLLLLE
AQAATCTLVDPATGQWLSVDEAVRSGLLGPELHRKLLVAEQAVTGYHDPFSGTQVPLFQAMKKELVDRTLALRLLDAQLATGGLVCPARRLRLPLEAALRLGCLDEETQQ
CLSQAAGFSDPSTQESLGYGQLLARCVTDPETGLAFLPLSHGPPGDEPQGSPFIDHSTRQALSEATATVSVGKFQGRPVSLWELLFSGPVPAEQRAALAQQYRDSAISVE
EMAAVLTAALEQATAVARTTFAGLRVPVTPDELLKAEIIEQDVYERLKQGQTTAQEVGRLASVQKYLRGTGCIAGVLVPGSQERLSIYEAREKGLLRPGTALILLEAQAA
TGFILNPKENKSSSVEAALRAGLIGPDVFAKLLSAERAVTGYTDPYTGEQISLFQAMQKELIVRDHGIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLAD
PSDDTKGFFDPNTHENLTYLQLLERCVLDPDTGLYMLPLGNAQTQLVDGATQQAFQSLLLSVKYGRFRGQTVSAWELINSECFSEDQRRRVLQDYRRHRVSLEQVAQLLE
REIGRGLDVTLPTLRGRVPAHRLLEARIIDQELLDRVLEGVVSPEAVLHMDHVQRYLRGSGAVGGVLLRPSGQRLSLYEAMKQKLLGPGVALALLEAQAATGGISDPQGL
ETLSVDEAVRRRLVGPELYGRLRQAEDAVTGVHDPFSGKLVSLFQAMKKGLVPLEQAARLLDAQVATGGVIDPTGHYHLPLPVATQRGYIDQEMEMALSSSSETFPTPDG
QGHTSYARLLEQCLRDEASGLSFLPLPENAPAVPTDEQVQETLQGAEDGMSLWELLGSCHFTDEQRKSFLEDLRVGKTTVQQLHGAVQKRVQEAELLARARVTVPGPRGE
VPAVWLLDAGIITQETLTALAQGTQSPAEVAEQPTVKRHLWGTGCVAGVLLRPSGIKVSISQAVRDGLLPEGLGQRLLEAQVASGSLIDPLTNQRLSVEGAVQAGLVAGA
LSEQLRQAEKAMAGYTDPYSGGCLALWQAMEKGLVPRGEGLRLLQVQLATGGAVDPGHGVHLPEAVACRLGLLDKQVSRVLTSTDEDSKFFFDPSTKDKVTYSQLKERCV
LDADTGLWLLPLAQDMVLEVDEHTLLALRAMKVPVSTGRFKGLSVSLWDLLHSEYVGSNKRRELVALCQSGRATALRQVATAVTALVVASETQPSQATFRGLRKLVSASD
LFRSRLIDKETLDELNQGKKTVQEVTEMGSVRRYLEGGNFIAGVLVQGTKEKMSISEALRRHILRPGTALVLLEAQAATGFLIDPVRNQRLTVEEAFAAGMFGQETYRKL
LSAERAVTGYTDPYTGEQISLFQAMQKELIVRDHGIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVLDPDT
GLYMLQIVKKGETYIYTDEATRQVLQSQTTEMHVGRFAHQKISFWDLLSSEYFTEERKRELVQEVRAQNVPLEQLLEIITATVEETEEQYRGMKVAAIGGEVTAAELFNS
GIIDKRTLDALSREKSGAQDLSRMAHVRTYLEGRGCIAGVTVPLTQEVMSLYDASRKGLIPMGFAVQMLEAQAATGFVLDPCGQRKLSVQQAVAESLVGEEWQARLLEAE
KAARGYTDPATGYTLSLFQAMQRKMVRREDALRLLEVQMATGGVIDPLHHHRLPLDVAYRRGCLHQDTYPLVSDQRHMRKRFVDPNNQERVTYQQLQERSQKEAETGWAL
FMVTGDTQRSNYDDEATRRALEAEKVQVQVGRYKDQTLSVWEMMNSEYVTHKRKLELVREYKEHVNQVLEEAGNVILQIIEEQEKSKKQLWFPGIRKQITAVELFKAAIV
SKELLDNLAQGTKTPQEVTEMDSVKRYLRGTSCIAGVLVPAKDEPGRQEKMSVYQAMWKGVLRPGTALVLLEAQAATGFLIDPVRNQRLTVEEAVAAGLVGGEIQDKLLS
AERAVTGYTDPYTGEQISLFQAMQKELIVRDHGIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYVQLLRRCVLDPDTGL
YMLQLAGGGSAVHQLSEELRGALRDARVAPGPGVAQGQSVSVWELLFYREVPEGERQDLLRRYRAGSLTAHEVGAALTALLARRDPASPGARPPDPRGALRAATMEVKLG
RLRGPAVPVWDVLASSYVSGATREQLLAGFGSGTLGLAALTRRLTTIIEEVEAAGGPERAPGDAAGVQQEPRPAGPGGDGGRGAGPSPGEAATEPAGGPQEQALRAATME
VQAGPLRGQRPSVWDVLFSSYLSRARRDELLAQHAAGALALPGLVAVLTRAVEEAEERLSKVTFRGLRRQVSASELRSSGILGPETLRDLAQGTKTPQEVTEMDSVKRYL
RGTSCIAGVLVPAKDEPGRQEKMSVYQAMWKGVLRPGTALVLLEAQAATGFLIDPVRNQRLTVEEAVAAGLVGGEIQDKLLSAERAVTGYTDPYTGEQISLFQAMQKELI
VRDHGIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYVQLLQRAILDSETGLLFLSLE*
14 >lcl|XP_533170.2|Plus112407700..12408485 NW_876266 microtubule-associated protein RP/EB family member 1-like LOC475961 __SEG__ Chr18 {Canis lupus familiaris} MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMSVDKIIPVDKLVKGKFQDHFEFFQW
FKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSAAPQRPIATHRTTATPKAGPGEVRKNPDVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGK
LRNIELICQENERENNLVLQRIVDILYATDEGGPQEEQEEY*
15 >lcl|XP_533824.2|Plus114226274..14230020 NW_876272 hypothetical protein LOC476620 LOC476620 __SEG__ Chr20 {Canis lupus familiaris} MEVTKKVGGPDPSGPQGHPSASSQQLGGGHRGSQGPWINSGSVYFRQGLSLSTEAIIDRTCDPASQAHAPEPIHQLHQDPAEVGSQCGREQASQDAPKLPSTSPFPSSIV
GTQTHLIVENRTLTLPVDTRSDSTSDSLQHGFCRSRLRVHVAGEGKAPAKVLVGWGKGPCHPDKIAPLGSRKSRWLPYFLSGEDGLAATQGPLLTPAQGQGQGKGPCPPA
QAPPTPTQANTPAGDTTPMPAAAEPNTCNSDHLTDTTATTHGLSQELLLRKCGNQWSVLLESSEVVPSCQDKVDFCFQKEPPTPTPTPEESSDHVQELEVAGMQVLPTPP
ENPEEKPLVCTSRPGSPTPGSGPPGTPKSQRNSQENCSSQTDQQPLNVCNNTCSSVPPSAYQVSCHKQSPVQSPREAAQISPSSAPTCQLQDATEDHVLVFDMATGKTRI
GLLCHDPTGSRAVLVGVMPSHSSIYVPENVLSTAPLAMPILSPDNNRSSFWSTSHMLSSPAPSSLSTGSYREVALVPKEGRLNLESQDTPSSETPIRVFTGPVPLGMPLQ
LGERLLSHVRDPGCSKPDGVKSEPSHTVWMLDAFRMQHTSMIQPKKLRWMNSEQTPELAPEAQKQEVPRSLLQEDRGNHDQKEVLTAHPDSLRGEGAGQASLGGRSLLAE
QHPLAGQPSLTSQPPSAEQCPLTRPTHPSGQLLLAEQSPSTRQLPLPGQPPLTGTPLARQLSLTGQPPFSQEPPISKGPISGGPPIIREPSQASTMCQEGEPLGLPAHVG
VLQMPLAPEETCVYMSRDKVGGGATESSSTHRLSSWQPGSSPRTQEEQFSLVTFSTSGTGCKVLPVAMVGTEPQGPRFKVTPENIMHSSVVAHLGLLRGACYELVPTTDA
PPMQSPVLCRHSLGPYQDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQHPAQDEPRYAVPENQEGSYPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVA
DSPISPRTNREKVAEILFERFHVPAMQTVHQALLALYAYGRTTGLVLGSGYGTSYVAPILTGDLAPLDTYRLDVAGVDLTEYLAQLLLAGGYSLPKAGLVNQIKEGCCYV
AMNMTAEMARTRTQARVDFVLPDKQVITLGSERFCCPEALFQPSLLGLNQPGLPQLALLSISRLEAKQQEQLLANVVLDGGSTLINGFPERLRQELGPQATVLGSPHRAV
AAWLGGSIMASRDSFQSLWLSRREYEEEGPWAIYKYHL*
16 >lcl|XP_534382.2|Plus1complement(674767..675573) NW_876317 microtubule-associated protein RP/EB family member 1-like LOC606844 __SEG__ Chr6 {Canis lupus familiaris} MAVNVYSTFVTSDNLSRRDMLAWINESLQLNLTKIAQLCSGAAYCRFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMNVDKIIPVDKLVKGKFQDNFEFVQW
FKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSAAPQRPIATHRTTATPKAGSGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLDKERDFYFGK
LRNIELICQENEGENNPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY*
17 >lcl|XP_534875.1|Plus1complement(28383412..28384311) NW_876284 F-actin-capping protein subunit alpha-3 CAPZA3 __SEG__ Chr27 {Canis lupus familiaris} MSLSVLSRKEKERVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVVGDYRFFDYQSKLSFKFDLLQNQLRDIQSHGII
RNETEYLRNVVLCALKLYVNDHYPTGNCNVLRKSVKNKEFLIACIEDHSYETRDCWNGLWKSKWIFQINPFLTQVTGRIFVQAHFFRAVNLHIEISKDLKESLEVVNQAQ
LALNFARLVEEQENIFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII*
18 >lcl|XP_535560.2|Plus1complement(11863450..11866950) NW_876295 nuclear receptor-interacting protein 1 NRIP1 __SEG__ Chr31 {Canis lupus familiaris} MTHGEELGSDVHQDSIVLTYLEGLLMHQAAEGSGTAVDKKSAGHNEEDQNFNISGNAFPACQSNGPVLNTHSYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNV
KKEALLAGMVDNVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALGHDSLKVEKDLRCYGVASSHLKTLLKKSKAKDQKPDTNLPDVSKNLIRDRFVESPH
HVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKEVGSFQLSKGMSSHLNGQAR
TSSSKLMASKNTAFQNPMGVVPSSPKNAGYKNSLERNHLKQAANNSLLLHLLKSQTIPKPMNGHNHSERGSIFEDSSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPID
LSCKHRIEKPEPDQPVSLDNLTQSLLNTWDPKVPTVDVKEDQDTSKNSRLNSHQKVTLLQLLLGHKNEESVERNSSPQEVHGDVTKFGSQNFARTSVIESPSTSRTTPVS
TPPLLSSTKAESPINLSQHSLVIKWNPPPFACGSQAEKPATSASNPLMDLTKSKDPLGEKPAHSEGAQNSATFSASKLLQNLAQCGVQASAPGEEQRPSKQLLSVNADRP
LGMVERLSSPLLSNKTHAAEDNRAFGSPAAGPEAGLSGSEIENLLERRPVLQLLLGNPHKGKGDKKDKTPLRDESAQEHADRALSEQILTVKIKSEPCDDSRSPSPSVRL
SPDARGAPFPGAAPPAQRSAPDGLKAEPVSPQDFSFSKNGLLSRLLRQNQESYLAEEGDGSRRSGELALLEARTLCVVPKKRKLYSEPLENPFKRMRNSVADAADSHGAP
EGLYGPPLSQQELKCSRSDLEFKFPGSQGPAGDAEHRAWARESKSFNVLKQLLLSENCVRDLSQHRSGSAGEGRRKGHRGAAGGGKPELSIPALDGLLYGPAQPGGCGDS
RTGPGPRPGPGPGPHPRTCPCPARAPSSPPFPEPGGCAGSRPEPGPANGCAGGAGDKGPIKWVIADADRNGYERDCPRLTKTNPILYYMLQKGGGPVAGRDTQDKDAWGE
PSSAESVAQVTVKEEFVPAAETRAAGFSLRGPYSSPPGRSAPRPHSANGEGYGLLGNVLAIKKEAE*
19 >lcl|XP_536719.1|Plus1698265..699398 NW_876315 actin-related protein T2 ACTRT2 __SEG__ Chr5 {Canis lupus familiaris} MFNPHVLDSPAVIFDNGSGLCKAGLSGEIGPRHVISSVIGHPKFKTPSAGANQKKYFVGEEALHKQEVLQMHYPIERGLVTGWEDMERLCKHLFEWELGVKASDRPVLMT
EPSLNPREAREKMAEMMFENFNVPAFYLSDQAVLALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLYVAGRDITEHLTRLLLASGRSFPCVLDKALVDDIKEKL
CYVAVEPEKELSRKPEEVLREYKLPDGNIICVGEQLYQAPEALFAPDQLGIQNPGLSKMVSCSISKCDADIQKTLFGEIVLSGGTTLFQGLDDRLLKELEQLASKGTPIK
ITAPPDRWFSTWIGASIVTSLSSFKQMWVTSADFKEFGTSVVQRRCF*
20 >lcl|XP_537053.2|Plus131996328..31996879 NW_876321 cofilin-1-like LOC479927 __SEG__ Chr6 {Canis lupus familiaris} MESRVPAAAAAALLSSDPFCYLPFASGNIASGVAVSDCVIKMFNDMKVRKSSTPEEVKKRKKSVLLCLGEDKKNILEEAKEILVGDVGQTVHDPHATFVKMLPDKDCRYA
LYDTTYESKKEDLVFTFWAPESAPLKSKMIYASSKDAIKKKLTRIKHELQANCYKEVKKLGGSAVISLEGKPL*
21 >lcl|XP_538780.2|Plus1complement(54994941..54996179) NW_876253 actin-like 7B ACTL7B __SEG__ Chr11 {Canis lupus familiaris} MAVRSSPSPAPLGAARGDPGEAGALPGPDAGLRGARAAAPLKAKARKVRRIKALVIDLGSQYCKCGYAGEPRPTYFVSSTVGRPCAAAAQAGDTRKETYVGHELLRTGAP
LKLTNPLQHGVVVDWDCVQSIWEYVFRTAMKIRPEEHAVLLSDPPLGPAGQREKYAELLFEALGVPALHVAPQPLLSIYSYGRTSGLVLESGHGVSHAVPISEGNVLPGL
PGRADYAGGDLTRYLLRLLNESGHAFTDDHLHIVEHIKKQCCSAAPAPGRELGLRVDYELPDGRRLAVGPERFQCAEMLFRPSVAGSSQPGLPALAAACLQRCRDAGLGA
EMAANVLLCGGCTMLGGFPARFQSELGLLWPGGGLAVAAAPERKTSVWTGGSILASLQAFQQLWVSREEFAERGGAAIHSKC*
22 >lcl|XP_542131.1|Plus1complement(27996391..27997641) NW_876272 actin-like protein 9-like ACTL9 __SEG__ Chr20 {Canis lupus familiaris} MDANQSSSPKPQPSPKASRADVSPNSILVNKTLQQKTPSMVGDRLPPKTGAVVIDMGTGTCKMGFAGQAQPTYTVATIVGCQPKKPTTTGQPELETFIGEAARTRPELTL
VQPVRNGILVDWDAAELIWRHLLEHDLRVATRDHPLLFSDPPFSPTTNREKLVEVAFESLCSPAMYVASQSVLSAYAHGRVSGLVVDTGHGVTYTVPVFQGYNLPHATER
LDLAGTHLTAFLAEMLLGSGLTLGQQDLDTVENIKHRYCYVAPDFPKEQARLGQDCQQVLKLPDGRTVTLGKELFQCPELLFSPPEMPGLVPIGVPAMAKKSLQKVPLEV
RADVAQNVLLCGGSSLFQGFEGRFRAELLRSLPPEAHVVVAAQPTRHFSVWIGGSILASLRAFQSCWVLREQYEEQGPHIVYRKCY*
23 >lcl|XP_542635.3|Plus141134999..41135517 NW_876274 myosin regulatory light polypeptide 9-like isoform 1 LOC485516 __SEG__ Chr22 {Canis lupus familiaris} MSSRRAKTKTTKKHPQRTTSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDLEDLHDMLASLGKDPTTEYLDAMMNEAPGPINFAMFLTMFGEKLNGTDPEDVIRNAFACF
DEEATGTIQEDYLRELLTTTGDRFTDEEMDELYRDAPVDKKGNFNYIEFTRNLKHDAKDKDD*
24 >lcl|XP_543571.3|Plus1complement(4701942..4706885) NW_876283 RIMS-binding protein 3A-like LOC486445 __SEG__ Chr26 {Canis lupus familiaris} MTKDSPSPSGGGRATPKKPSSPGPSAAVLEEQRRELEKLRAELEAERARGRAERQRFASQARQLREAAERERQQLVDHLRSKWEAQRGRELRQLQEDVLREREAEIRQLL
RWKEAEMRQLRQLLHRERDGVLRQARELQRQLAEELVNRGYCGRAGAPEVAAAQCSCRLQEVLAQLRWDTDGEQASRIRHLQAALDVERQLFLKYILEHFRWHPALPGSH
DPQASHASEESPPHTAGDAHGPPKSVCGLESLDADSLSSGVRVRSRSLDVVPAGCSTSPDGLLHARAGSLDSLAPARSRSLDSTLSCPKESEEQASSPGASIVGSPSPPP
PPPPPPSEHRRPSDPPGEDSGSQPCEAGTPSPPGLDYQELLKRNSELSEALQVLARRCSSLREENTQLRRAGFQDKSDKVKRLKVKHAELTGLARRLEDRARKLRETNLR
AVSAPVPGESLAGLELCQAFSRQRARDLSEQASALLAKDKEIEELRQECHLLQASVASGFGSGLRPGGGAAQAQAQWLSISELDRLQRESQREVLRLQRQLTRQQATSSA
RAEADGQGAPCEEARRQVQALELELGARRRDCEELGAQAAAARRRSEEAETQLQAALREGARLAQENARLQAQADWTRKVAAENNDVRGQLGRACQERDAAGMLAEQLLQ
QAARGQDRQQQLQHDLQKALHDLQAAREEMLALHGQPGRPLQEAPEAPQAPEVQVRESGRTELQPGPEDQASSQRSRDKRESLEASPLESPVAIGEPGSDPQGPDKVPAN
RPLDSRSQAKKASSQSNSSSEVESVWATVPSCPTLDMDTASEVEDLEPDSVSSTLERGDPEAPLAPKLKIFLARYSYNPFKGPNEHPESELPLTAGDYVYIFGDMDEDGF
YEGELEDGQRGLVPSNLVEQIPDSDILGCLHSKSSDFGPTRLPPGQGTRLKEDTGHSLLPWKAQEAMDKGPCQMVRAGSQAEVATEISDAMIEDSWLGLLRCVEEKGFSR
PLLGPRGVLCMAPTQLHLQSVAATSAKITWVHSSSSYIHMVYLNDQEHALTPAGVSCYTFHSLRPGERYEARVEVQLPWDLLQVHWETMSSTITFNTPLAGPPDPPLDVL
VERHASPGLLVVSWLPVTIDSAGSSNGVQVTGYSVYADGLKVAEVADATAGSILLELSQVQLPMMSQNVSVRTMSLWGESLDSVPAQIPQDCFTCHQLPETSSFNYTCGD
PSICRVTVPVCSQRLALAPVNAKTSSHTPGSCGEPQAKFLEAFTEEPPKRQSPGPSLSPERECASAGSASQAQGLTEAQEVCRKDLLFQQSSPNHRPPLPSGQSRKEEDH
YWHTGTRQSPASGVIHLFPECRLKKELYPEKPALEKILRQKQDPQVFIPPQLDTSQPYVSDFHDILQKEEEAAVCFSLWGTERREQRKEFKTQNGRGQALGGKRECQLPK
SSPALCPAPSSKVIKISRGAPSPLGTGVDTLVRVFVALFDYDPLVMSANPEVAEDELAFQKGQLLRVWGSQDPCGFYHGECNGQVGNIPGHLVAEVKVGTEQTDGRWHLP
VQEYLPPVAHLDDFGELTSPQGSFPIPQGNPRMSPLWTPTTMMAALDYDPKDGCAGGRVKGKLSLRAGDVVTVYGPVDEKGFYYGESGGHRGLVPAHLLDHLSFHGE*
25 >lcl|XP_544346.1|Plus1complement(9863832..9864962) NW_876292 beta-actin-like protein 2-like ACTBL2 __SEG__ Chr2 {Canis lupus familiaris} MTDDELSALVVDNGSGMCKAGFGGDDAPRAVFPSMVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILTLKYPIEHGVVTNWDDMEKIWHHTFYNELRVAPDEHPILLTEAP
LNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYNFTTTAEREIVRDVKEKLCYV
ALDFEQEMGSAAASSSLERSYELPDGQVITLGNERFRCPESIFQPSFLGIESSGIHETTFNSIMKCDVDIRKDLYANIVLSGGSTMYPGIADRMQKEIMTLAPSTMKIKI
IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRKCF*
26 >lcl|XP_545332.1|Plus1complement(8373446..8374141) NW_876302 nuclear distribution protein nudE homolog 1 NDE1 __SEG__ Chr35 {Canis lupus familiaris} MEDSGKTFSSEEEEVNYWKDLAMTYKQRAENTQEELREFQEGSREYDAELETQLQQIETRNRDLLSENNRLRMELETIKEKFETQHSEGYRQISALEDDLAQTKAIKDQL
QKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPTSVEAERTDTAVQATGSVPSTPIAHR
GPSTSWVKMLL*
27 >lcl|XP_545882.1|Plus1complement(19474926..19476017) NW_876307 mesoderm development candidate 1 MESDC1 __SEG__ Chr3 {Canis lupus familiaris} MASGSAGKPSGEAASPAPASAVGAACSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPAASCAGAAESFEQCRDTIIARTKGLSILTHDVQSQLNMGRFGEAG
DSLVELGDLVVSLTECSAHAAYLAAVATPGAQPAQPGLVDRYRVTRCRHEVEQGCAVLRATPLADMTPQLLLEVSQGLSRNLKFLTDACALASDKSRDRFSREQFKLGVK
CMSTSASALLACVREVKAAPSELARSRCALFSGPLVQAVSALVGFATEPQFLGRAAAVSAEGKAVQTAILGGAMSVVSACVLLTQCLRDLAQHPDGSAKMSDHRERLRNS
ACAVSEGCTLLSQALRERSSPRTLPPVNSNSVN*
28 >lcl|XP_546045.1|Plus1complement(26632732..26633835) NW_876308 spermatogenic leucine zipper protein 1 SPZ1 __SEG__ Chr3 {Canis lupus familiaris} MEVSTLSKTLKPTPGLNQESLGPRIILALFEIGSLPPVSWCFLPSPNNSDHQVAEQQTAQKFENLLKDIKDIIKNVTSNEEKITEVKDSFEEISISEDVSELKEKIRELD
KINEVLLNNLLGCSDLEKEENAKKQMIVENQNCKDTVQVFRSDLVNCSEENRALDETQLSKEKAKYRLPHVQEENIKLRNNMEQLLQEAEHWNVQHAELSELIRTYQKSQ
KDIQETLKNNGAHFQTQSNEKVSAQHELEEQVKKLEHDTYSLHLISALLENECQILQQRIELLKELHHQKEGTLQEKPIQKNGEKDKKKQKLSAEHKPKMQEKEGTFQKK
DKFYRGLDAGSKKALNNHFNTHIARGTPVEKSSSSLT*
29 >lcl|XP_546207.1|Plus125657743..25658156 NW_876311 profilin-3 PFN3 __SEG__ Chr4 {Canis lupus familiaris} MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFLQAGLSIAGRRCCVLRDHLLSEGDGVLDARTKGLDGRAICVGHTPRVLLVL
MGRRGAHGGILNKTAHELINGLRTQGT*
30 >lcl|XP_547288.2|Plus1complement(41007828..41010404) NW_876321 leucine-rich repeat-containing protein 8D isoform 1 LRRC8D __SEG__ Chr6 {Canis lupus familiaris} MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKDQVVCLPVLPSPVNSKAHTPPGNADVTTSIPKMEAATDQDRDGRTTSDISFGASAVTPDIP
LRATYPHTDSTVPNQETKKEKKDPTGRKTNLDFQQYVFINQMCYHLALPWYSKYFPYLALIHTIILMVSSNFWFKYPKTCSKVEHFVSILGKCFESPWTTKALSETACED
SEENKQRITGAQTLPKHVSTSSDEGSPSASTPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVEDSDLIYKLYVVQTFIKTAKFIFILCYTANFV
NAISFEHVCKPKVEHLTGYEVFECTHNMAYMLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKVREESSFSDIPDVKNDFAFLLHMVDQYDQLYSKRFGVFLSE
VSENKLREISLNHEWTFEKLRQHVSRNAQDKQELHLFMLSGVPDAVFDLTDLDVLKLELIPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLYVKFTDVA
EIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERIPHAIFSLSNL
QELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIATIPPSITHVKNLESLYFSNNKLESLPVAVFSLQKLRCLDVSYNNISVIPIEIGLLQNLQHLHITGNKVDLLPKQ
LFKCVKLRTLNLGQNCITFLSEKIGQLSQLTQLELKGNCLDRLPAQLGQCRLLKKSGLVVEDHLFDTLPLEVKEALNQDLNIPFANGI*
31 >lcl|XP_547653.1|Plus13620438..3620956 NW_876324 centrin-1 CETN1 __SEG__ Chr7 {Canis lupus familiaris} MASGFKKSNVASTSQKRKVGPKPELTEDQKQEVREAFDLFDADGSGTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEGTGKISFNDFLGVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVAVELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTNLY*
32 >lcl|XP_548212.2|Plus1<11042603..11044342 NW_876332 kinesin family member 2B KIF2B __SEG__ Chr9 {Canis lupus familiaris} GDQGSATRWIAAIRQKNEMPSGDSLALRVPSNPCLMKRKKSPCLREIEKLQKQREKRRRLQLEIRAQRALNVNTGNPNCEIMRMIDEYRRHLDCSKVSSLEPREDHRICV
CVRKRPLNQRETTMKDLDIITIPSDNVVMVHESKQKVDLTRYLENQTFCFDHAFDDTASNELVYQFTAQPLVESIFRRGMATCFAYGQTGSGKTHTMGGAFSGGDQDCSK
GIYALVAQDVFLLLKTRAYEKLDLKVYGTFFEIYGGKVYDLLNWKKKLQVLEDGNQQMQVVGLQEQEVCSVEDVLNLVELGNSCRTSGQTSVNAHSSRSHAVFQIILKSG
GKLHGKFSLVDLAGNERGADTAKANRKRQLEGAEINKSLLALKECIRALGQNKSHTPFRASKLTQVLRDSFIGQNSSTCMIATISPGMASCENTLNTLRYANRVKELALD
LTPHHRCVYPVGPEVPRMLENHIRNSKTSLQRDGFINIPNIQSEKEKQAKDIETLSTPLVEDTGRTSWKESSQWPGNNIQETAGEGNYDADFCIAQLLSILDQKIGILTE
IQKKLKLLRADLQKKTKYNGANGKRSDLK*
33 >lcl|XP_549241.1|Plus1complement(50759173..50760306) NW_879563 actin-related protein T1 ACTRT1 __SEG__ ChrX {Canis lupus familiaris} MFNPHVLDIPAVIFDNGSGLCKAGLSGEIGPRRIISSVVGYPKFNMPSSEATKKKYLVGEKALYKYEALHLHYPIERGLVTRWDEMEKLWKYLFEWELGVNPCQRPVLMT
EPSLNPRETREKMAEVMFETFNVPAFYLSNHAVVALYASASVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLYVAGRDITEHLTRLLLSSGSTFPCILNKALVGDIKEKL
CYVALEPEKELCKRPEEVLREYRLPDGNVIYIGDQLHQVPEILFAPDQLGIHNPGLSKMVSSSIMKCDTDIQNNLFAEIVLSGGTTLFPGLEERLMKELEQLASRGTPIK
ITASPDRCFSAWIGASIVTSLSSFKQMWITSADFMEFGTYVVQRRCF*
34 >lcl|XP_848329.1|Plus1complement(832007..832774) NW_876285 leucine-rich repeat-containing protein 18 LRRC18 __SEG__ Chr28 {Canis lupus familiaris} MVKGGKAPKGKKITLNVAKNCVKITFDGRKRLDLSKMGITNFPKCILRLTDVDELDLSRNMIRKIPESISKFQNLRWLDLHSNYIDKLPESIGQMTTLLYLNVSNNRLTT
NGLPVELNQLKNIRTLNLGLNHLDSVPTTLGALKELHEVGLHDNLLTSIPNSISKLPKLKKLNIKRNPFPKTEESDIFLDTIKRLDNLYLVEDKDLCSNCLKKCQQARDK
LNKIKNMATATPRKAIFSNLVSPNSMAKDSQEDWR*
35 >lcl|XP_852075.2|Plus137737530..37738342 NW_876263 microtubule-associated protein RP/EB family member 1-like isoform 1 LOC609553 __SEG__ Chr17 {Canis lupus familiaris} MAVNVYSTSVTSENRSRHDMLAWINESLRLNLTKLEQLCSGAAYCQFMDILFPGCIALKKVKFRAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
FRKFFDANYDGTDYDPVAARRGQETAVAPSLVTPALNKLKKPLSPSQSAPQRPTGTHRTTTTLKAGQCGVQKNPVVGMGKGDGQVAVLIQQVNVLKLTIKDLEKERDFYF
GKLRNIDLICQENEGENNLVLQRIVDILYATHQGFVIPAEGGPQEEQEEY*
36 >lcl|XP_853429.2|Plus129790433..29790810 NW_876276 tubulin beta-4 chain-like LOC610786 __SEG__ Chr23 {Canis lupus familiaris} MSMKEVEEQMPNVQNKSSWILVEWIPNNVQTAVCDIPPRGLKMLATFIGNSTAIQELFKRISEQFTAMFQLKAFLHRYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
DEQGKFEEEEGEDEA*
37 >lcl|XP_853645.1|Plus1complement(17823432..17825048) NW_876251 ankyrin repeat domain-containing protein 57 ANKRD57 __SEG__ Chr10 {Canis lupus familiaris} MEGPAELSVEAVLRFLRERGGRAPHAELVQRFRGALGGDPEQRARARARFKELVNAVATVRTDPADGSKFVHLKKRFLEGAPPDLPRAAGTAEPAEPAEPAEPEASRGAP
PEVPDGGQRSEAASPEASPRPGGGPGDGGPPGVDRESGSGPPPSAGARPRHPRRDAQPHPRGPGPGPSEDPAPPPPPPPHGCAETDAGTAPGGVGTPRPPRQSLRDLVMG
SSPQLKRSVCAGGSSPGSSSGGGRGKGGGKADSASVASSSAEEDSCGGSLTLDPLEHAWMLSASDGKWDSLEGLLTCEPGLLAKRDFITGFTCVHWAAKHGRQELLAMLV
NFANKHQLPVNINARTSGGYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGRKASQYLSPSIAEEIKNLVGALDEDDGDCAAGGGGGRWRLSKVLPSHLITYKLSHVL
EDGGDHHHHHHHHHHHLTDGWAGGKVKDPGRKAPGSSSGRIKPRLNKIRFRTQIIHTTPSFRDPEQPLEEEGEEEEEDRALKGHSSSFKLRPKSNVFG*
38 >lcl|XP_854183.1|Plus133306465..33306926 NW_876270 cdc42 effector protein 5 CDC42EP5 __SEG__ Chr1 {Canis lupus familiaris} MPVLKQLGPAQPKKRPERGTLSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSAPPPAVPQPPPPALRAPAPADPLLSFHLDLGPSMLDAVLG
VMDAERPGAAATKPDLDLSSEAQHPRAHCRPSADLELDDVIGL*
39 >lcl|XP_861868.2|Plus1complement(18395820..18396338) NW_876257 myosin regulatory light polypeptide 9-like isoform 2 LOC475164 __SEG__ Chr13 {Canis lupus familiaris} MSSKRAKTKTIKKRPQHATSNVFAMFDQSQIQEFKEAFNMMDQNRDGFIDKEDLRDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLMMFGEKLNGTDPEDVIRNAFACF
DEEATGTIQEDYLRELLTTMGDWFTDEEVDELYREAPMDKKGNFNYTEFTRILKHRAKDKDD*
40 >lcl|XP_867980.1|Plus1complement(35260311..35261042) NW_876276 proline-rich protein 23A-like LOC611131 __SEG__ Chr23 {Canis lupus familiaris} MGSRPRSPSAHPEPCWGPPRGGPGPAKRRRTPEPEGPQGMEGPPAAGALASVVVLAAGSALQLLLDDVDLVLEPEPTSVLQVSLGGLTLLLVPEALLRAGGQGHPPAGPE
QGAVPSAPGHQAAGPHEALCASVPDVAAQEEACAEDADPELPPPRAGPTAGWAPELRACAGGVAGPRPRPRAPGPGPKRLSPLRYFDLDPHLLEPFPGSPLQPLPPSPSP
GPHVRPQRPPGPSPKARRRLFQE*