SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau Z    

ID / Description / Sequence
1 >lcl|NP_001033204.1|Plus1complement(643740..644873) NW_001493430 actin-related protein T2 ACTRT2 __SEG__ Chr16 {Bos taurus} MFDPHILDSPAVIFDNGSGLCKAGLSGEIGPRHVVSSVVGHPKFKTPLTGANQKKYFVGEEALHRHEVLQLHYPIERGLITGWEDMEKLWKHLFEWELGVKANDQPVLMT
EPSLNPRETREKMAEVMFESFNVPAFYLSDQAVLALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLYVAGRDITEHLTRLLLASGRTFSCVLDKALVDDIKEKL
CYVALEPDKELCRRPEEVLREYKLPDGNIVPIGDQLYQAPEALFSPEKLGIQNPGLSKMVSCSITKCDADIQKTLYGEIVLSGGTTLFQGLDDRLLRELEQLASKGTPIK
ITAPPDRWFSTWIGASIVTSLSSFKQMWVTSADFKEFGTSVIQRRCF*
2 >lcl|NP_001033658.1|Plus1complement(2065799..2067049) NW_001495328 actin-like protein 9 ACTL9 __SEG__ Chr7 {Bos taurus} MDPNQGNPLEPQDSPEIPKPSLNLSSILAKSTLPQEPPSMVGDRLPPKTGAVVIDMGTGTCKVGFAGQARPTYTVATIVGCQPQKPATSGQPVMETFIGEAARKRPELTL
VQPVHSGIVVDWDAAELIWRHMLEHDLRVATRDHPLLFSDPPFSPSTNREKLVEVAFESLSSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLPHATQR
LDLAGTHLTAFLAEMLLGSGLPLGQQDLDTVENIKHRYCYVAPDFLKEQARPELECRQTLKLPDGRTVTLGKELFQCPELLFSPPEIPGLSPVGVPTMAQQSLSKVAAEL
RTDLAQNVLLCGGSSLFTGFQARFQTELLRNLPPEAHVVVMAQPTRNFSVWIGGSILASLRTFQSCWVLREQYEEQGPYIVYRKCY*
3 >lcl|NP_001033659.1|Plus1348500..349816 NW_001495493 actin-like protein 7A ACTL7A __SEG__ Chr8 {Bos taurus} MALESVWAPQAAVIGDGLSERVGEQASPQTQVLQTASLKDGPAKRAVWVRRDHSEPEPTTSPEVKKPKLELTKAVVVDLGTGYCKCGFAGLPKPTHRISTTVGKPYMETA
KTGDNRKETFVGHELINPEVRLKLINPLRHGIIVDWDTVQDIWEYLFHQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFETFKTPAMHIAYQSRLSMYSYGRTSGLVV
EVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTTYLMCLMNTAGKHFTEGQLGIVEDIKKKCCFVALDPIEEKKVPATEHMIQYTLPDGQAIYLCQERFLCSEMFFKPSL
IKSMQLGLHTQTVSCLNKCDIALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDTPQVSVLPERDTAVWTGGSILASLQGFQPLWVHRSEYEEHGPFFLYRRCF*
4 >lcl|NP_001035651.1|Plus1complement(1359319..1360218) NW_001495086 capping protein (actin filament) muscle Z-line, alpha 3 CAPZA3 __SEG__ Chr5 {Bos taurus} MSRSTLSRKEKEKVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLSIDGNAVLLSHHNVVGDYRFFDYQSKLSFKFDLLQNQLKDIQSHGII
RNETEYLRTVVLCALKLYVNDHYPKGNCNVLRKTVKNKEFLIACIEDHSYETADYWNGLWKSKWIFQVNPFLTQVTGRIFVQAHYFRCVNLHIEISKDLKESLEVVNQAQ
LALSFARLVEEQENKFQAALLEELQELSNEALRKILRRDLPVTRTHIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII*
5 >lcl|NP_001069225.1|Plus1467479..468315 NW_001495024 leucine-rich repeat-containing protein 10 LRRC10 __SEG__ Chr5 {Bos taurus} MGNTIRAFVAFIPADRCQNYVARDLREMPLDRMVDLSGSQLRRFPVHVCSFQELVKLYLSDNRLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKL
CDLPRELSLLQNLRTLWVEANYLTKLPEVVCELSLLKTLHAGSNALRLLPGQLQRLRELRTIWLSGNLLTDFPPVLLHMPFLEIIDVDRNSIRYFPSLAHLSSLKLVIYD
HNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALAREESQEAQLPALPPLPPTNS*
6 >lcl|NP_001070014.1|Plus1complement(24171..26627) NW_001494056 fibrous sheath CABYR-binding protein FSCB __SEG__ Chr21 {Bos taurus} MEEKDESEQSISAGRQEIRKRRRPSQPMVDKSQQTEVTEKKKQLSIPQSSGPKAALSIGNIPGSKLNYECHRVSSQLQQTWIKRKRVQDMADKSLQTETIAEEKKEEIKL
VCEAVVPEEKPAAVEVGPEFPESVREVEVPPNRYSVQVKIDRSQQTTCTGDWTMMNFPQKDKLDKEQQTYFSESEIVVIGWPTNSFSKSKEGAQKRKSSGNIFLSEHPEF
QPTTSSNEEIRRPSISRTVSISPTKKDSPVPLEDEKDVPVEVQPPAAEEISAEEQLPLAETTSEEVPVAVQPPPAEEPPLEAQPSPTEEAPGDEAPAKVEPTPAEEALSE
KPPAEEALVEIQPSPVEEAAGDEAPAKVEATSSEETLLKEPLTEVQPPAAEEAPIQDTPELQLSPAVEAPAEEAPAEAEPPPAEEAPAEEAPEVQSPPAEEAPAEEPPEI
QSPPAEEAPAEEPPEVQSPPAEEAPAEEAPEVQSPPAEEAPAEEPPEVQSPPAEEVPAGEPPEVQSPPAEEAPAEEAPEVQSPPAEEVPAEEALAEVEPPPAEEAPAGEP
SEVQSPPAEEAPAEEAPEVQSPPSEEAPAEEAPEVQSVPAGQAPAEEPLEVQPPPAEDATEEEASEVQSLPTDEAPAEEGLGFQSPPADKAPEEEAPEVQSPPAEEAPAE
EPPEVQSLPADEAPAEEATEEVQSPPTEESPAEEAPAELQPPSTEETTSEMVSVEKQPSLTEEPFITPISLEETSAEVLLPPFEQTPADEALVENVSPVDQAPKEADVLV
EKLESGNLDDKPKSEEPLERDTIPKDSSGTKNEGVSFEIKGVIHIELE*
7 >lcl|NP_001070524.1|Plus1complement(562378..562710) NW_001494727 late cornified envelope-like proline-rich protein 1 LELP1 __SEG__ Chr3 {Bos taurus} MSSDDKNKPGEPKNEPKQCDPGCEQKCETKCQPSCLKRLLQRCSEKCQPPKCPPPKCTPCPPCPPSCPPPPKCPPPCPPPCPPPCPPPCPPKPCVKSCPPKCPPPCPPPE
*
8 >lcl|NP_001070526.1|Plus1complement(2688261..2689028) NW_001494477 leucine rich repeat containing 18 LRRC18 __SEG__ Chr28 {Bos taurus} MAKGAKGPKGKKITLAVAKNCIKITFDGKKRLDLSKMGITTFPKCILRLTDVDELDLSRNLIKKIPDAISKFQNLRWLDLHSNYIDKLPETIGQMTSLLYLNVSNNRLTT
NGLPVELNQLKNIRTVNLGLNHLDSVPTTLGALKELHEVGLHDNLLSNIPNSISKLPKLKKLNTKRNPFPKAESSDMFMDSIRRLDNLHLVEEKDLCGTCLKKCQQARDK
LNKIKSMATTIPRKAIFSTLVSPNSMAKESQEDWR*
9 >lcl|NP_001070992.1|Plus11526400..1527722 NW_001493658 oligodendrocyte myelin glycoprotein OMG __SEG__ Chr19 {Bos taurus} MEYQILKMSPSLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLTTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNN
IKLLEKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHTVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQAFDQLFQLQEI
TLYNNRWSCDHHQNITYLLKWMMETKAHVIGTPCSSQISSLKEHSIYPTPSGFTSSLFTVSGMQTVDTINSLSTVTQSKVTKIPKQYRTKETTFGATLSKDTTLTSTDKA
FVPYPEDTSTETINSREAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNDFSEMPQQSTTLNLRREETTTDGKTRLPSVASAWKVNASFLLMLNAVVMLAV
*
10 >lcl|NP_001072974.1|Plus122567..23085 NW_001494241 centrin-1 CETN1 __SEG__ Chr24 {Bos taurus} MASSYRKPTVASTSQKRKVGPKPELTEEQKQEVREAFDLFDADGSGTIDVKELKVAMRALGFEPRKEEMKRMIADVDKEGTGKISFNDFLAVMTQKMAEKDTKEEILKAF
RLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEDEFLRIMKKTNLY*
11 >lcl|NP_001074195.1|Plus12132755..2133312 NW_001494827 cbp/p300-interacting transactivator 4 CITED4 __SEG__ Chr3 {Bos taurus} MADHLMLAEGYSLVPRPPPAAPAHGPHALRTLQPYSSPGLDSGLRPRGAPLGPPPPPQGTVAYGAFGPSPTFQPFPAVPPPAAGNAHLQPVATLYPGRATMPPGAPGGPS
GPQPAPGAPAPPLQPPAHALGGMDAELIDEEALTSLELELGLHRVRDLPELFLGQSEFDCFSDLGSAPPAGSVSC*
12 >lcl|NP_001077133.1|Plus11415734..1416597 NW_001493535 transmembrane protein 119 TMEM119 __SEG__ Chr17 {Bos taurus} MVSAAAPSLAVSLLLLLRVLPTVSYSVSLQAGFLEDTGGSGEAEGSSASSPSLPPPQTPALSPTLVGPEPTPLAGPKPPTNFLDGIVDFFRQYVMLIAVVGSLVFLLMFI
VCAAVITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDGRPEETLDSSQQLQAHILAATQNLKSPSRAAPSSGDLARAPEGRSEEEEKGPREADLEAQGR
ALPADKPEVPPLPEEPCSVEADAAAGAAAADEGQGEPDVAPLLAQEAGGPAGPPENPCVCGSVPPSI*
13 >lcl|NP_001092636.1|Plus11516150..1517520 NW_001493658 ecotropic viral integration site 2B EVI2B __SEG__ Chr19 {Bos taurus} MDLKYFILILFCGHLNDTFFSETEATTTERQPQSTLFRPSMPYISANSQGTTENPSSQPTQFNNLSSGQPITTAKIAAGQPTPLAYASSGKPAAHTSPGQPLVYNVTRKT
IQIANTSSQGTALPVFTSAIQLSPSAYSSTRQSPPSVSTPTQQPSSTHTSSRKSISPTVHNISIQPTPTVKSSPRKTPGFNFEFSRTTNIPKEANYAYSIPAILIGAILT
TMLVVVLMIVLWQCLRKPVLNDQNWAGRSPFADGETPDICLDNIRENEAFPKRSSIISLMVWKPSKSALLADDLEIKLFESKENTEDSNNPKTERIKDQANGTSEDSGDG
STIGTAVSSSDDTDLPPPPASLLDIEGQEGNKSDKPTMITESPRPNNSTNLPASLDCLNQISEHHNSESKQSFPPPPDSFNLTVPPGDFMKNQEDCNNEIQCQEFPIPPD
FDQDLNESLPPPPAEL*
14 >lcl|NP_001094536.1|Plus1414646..415311 NW_001494179 histone cluster 1, H1d HIST1H1D __SEG__ Chr23 {Bos taurus} MSETAPVAPAAPAPAEKTPVKKKAKKSGVAAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNK
KAATGEAKPKGKKAGAAKPKKAAGAAKKPKKSTGAATPKKAAKKTPKKVKKPAAAAGTKKVAKSPKKAKAAKPKKPTKSPAKAKAPKPKAAKPKAAKPKATKAKKAVSKK
K*
15 >lcl|NP_001094651.1|Plus1919423..921474 NW_001493643 kinesin-like protein KIF2B KIF2B __SEG__ Chr19 {Bos taurus} MASQLFRPLTPRLSSLTPVKPHFGHLQAGISVAIQRTDGRIHLAVVTEVRRDNAWVTVEWAEKGVKKGKKVALETIFLLNPALALAGPAAQGRASRSVSLAPPSVIGDQR
TAARWAGKIPQRNETPSGDSLAVRVPSSPCLMTQRKSACLREIEKLQKQRERRRRLHREIRAQRARDADTGNAHYEIRRLIEECRRRLRGGRISGPEPRDGRRICVCVRK
RPLNRQEATREDLDIVTIPSDNVVMVHESKQKVDLTRYLENQTFCFDHAFDDTASNELVYQFTAQPLVESIFRHGMATCFAYGQTGSGKTHTMGGGFSGRDQDCSKGIYA
MVAQDVFLLLKTSAYEKLNLKVYGTFFEIYGGKVYDLLNWKKKLQVLEDGSQQIQVVGLQEQEVCCVEDMLNLVELGNSCRTSGQTSVNAHSSRSHAVFQIILKSRGKLH
GKFSLVDLAGNERGADTAKANRKRQLEGAEINKSLLALKECIRALGQNKSHTPFRASKLTQVLRDSFIGQNSSTCMIATISPGMASCENTLNTLRYANRVKEITLNLRPR
HRCLYPAEREMPRVLENHIRNSEMSLQGDEFIRIPCLQSEEEKETEEIKVLSSPLVDTTISWKEASQWPDNKIQDTSDEVNCNVDFCIAQLLSILEKKIDILTEIRRKLK
LLQADLQKENRHGEVNGERSDLK*
16 >lcl|NP_001094677.1|Plus1complement(1245167..1246480) NW_001495020 hypothetical protein LOC540367 FAM113B __SEG__ Chr5 {Bos taurus} MVHLLASEVRQLLHNKFVVILGDSVQRAVYKDLVLLLQKDCLLTLSQLKAKGEHTFEQDELVHGGQQGHMHNGTHYREVRQFCSGQHLVRFYFLTRVYSDYLEDVLEELQ
SGEHHPDLVIMNSCLWDITRYGKDFWPSYRRNLERLFGRLRQMLSESCLLVWNTAMPVGDKITSRFVPPEVQFTSSSVKISVIEANFYSSAEAQKHGFDVLDLHFHFRRH
TGKYLQTDGVHWNQCAHRHLSQLLLAHVADAWGVELPRRDPVDKWIPDGPGRRRPGRRLERQPLVCGDQPACPLPRPLPLPGRQPLLPTPPCPPLFPLLSPQRHPIPLHQ
VMPPFPFCPQETCFSSDHPFQSDQFSLNYLHSDVPPSIQTEFAVQGDFQYGPQPPMPRFPPPCYQQRVPEVHRGFPRYHPPDPYMPWRRRPKTSKRRASAYKEPRPQ*
17 >lcl|XP_001249299.2|Plus1217216..218346 NW_001493936 beta actin ACTBL2 __SEG__ Chr20 {Bos taurus} MSDDELSALVVDNGSGMCKAGFGGDDAPRAVFPSMVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILTLKYPIEHGVVTNWDDMEKIWHHTFYNELRVAPDEHPILLTEAP
LNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDVKEKLCYV
ALDFEQEMVSTAASSSLERSYELPDGQVITIGNERFRCPEAIFQPSFLGIESSGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIAERMQKEIVALAPSTMKIKI
IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRKCF*
18 >lcl|XP_001249802.1|Plus1complement(151320..151781) NW_001501971 profilin-2-like LOC783297 __SEG__ ChrX {Bos taurus} MQCIGDISEEVWQDCITLFLQTGMCYDAAIITNSPPWLLASYPEGNLFQLTQEEIQILLAREGREKLFLQGITLAGTKCLLIRDNLYTEGNNTMDLRTKGQSRGSQAVTV
VQIESVYLVVMGQKGTEGGPLNLKAFEMAGYIKEAINQHMAHF*
19 >lcl|XP_001250005.1|Plus1complement(352457..352879) NW_001502042 profilin 1-like isoform 1 PFN1 __SEG__ Chr1 {Bos taurus} MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTSGAPTFNITVTMTAKTL
VLLMGKEGVHGGTINKKCYEMASHLRRSQY*
20 >lcl|XP_001250860.3|Plus1complement(528016..528762) NW_001495188 tropomyosin 4 LOC783188 __SEG__ Chr6 {Bos taurus} MAAIAVTEAMKCKIQVLQQQADDAEERAKCLQQKVEGERWAREQAEAEVVSLNRRIQLVEEELNRAQERLATELQKLEEAEKAADESERVMKVIENQALKDEEKMELQEI
QLKEAKHIAEEAHRKYEEVARKLVIIEGDLERTEERAELAESRCRKMGEQTRLMDQHLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDL
EDKLKCTKEEDLCTQRMLNQTLLDLNKM*
21 >lcl|XP_001251046.1|Plus1553688..553957 NW_001508748 dynein light chain 1 LOC783688 __SEG__ ChrX {Bos taurus} MCDRKAVIKNADMTEEMQQDSVECAAQALEKYNIEKDIVAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG*
22 >lcl|XP_001251047.3|Plus1865225..866223 NW_001492961 coiled-coil domain containing 121-like CCDC121 __SEG__ Chr11 {Bos taurus} MSKCLLCSSFRLAEDTSNSLQPDVNFINTFLKPEKLTRVEKRFKGRAVMEMMKLDKAIKETQTRLEPLVVETRQLLEEKDHIQKENQFFQEYLTKQTEESRQRTEKLWNY
YLQQSRKIEQRKQELTSKYANKNSALKRELLEKENTLSNLNKQLEAMRDISVIKEKQDREIEKLQQEIKKTHDETAAKKQAMLVQFFQDKALLEAQLSELEARQSGKKLT
KELKSKNQALEKAAKQHVSEFHSNINRQHQQLQKELPELVQKCHQLEDTHSQLKKKQQLLQQEHWYVECLRRGRHQLQERRNRCPNGQGSPKTTRNPALGTKSKVHPKKF
LK*
23 >lcl|XP_001251494.1|Plus1complement(4853175..4853444) NW_001493050 dynein, light chain, LC8-type 2-like LOC783832 __SEG__ Chr12 {Bos taurus} MYDRKAIIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG*
24 >lcl|XP_001252597.2|Plus1complement(3690213..3690959) NW_001493600 tropomyosin 4 LOC784223 __SEG__ Chr18 {Bos taurus} MAAIAVTEAMKCKIQVLQQQADDAEERAKCLQQKVEGERWAREQAEAEVVSLNRRIQLVEEELNRAQERLATELQKLEEAEKAADESERVMKVIENQALKDEEKMELQEI
QLKEAKHIAEEAHRKYEEVARKLVIIEGDLERTEERAELAESRCRKMGEQTRLMDQHLKCLSAAEEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDL
EDKLKCTKEEDLCTQRMLNQTLLDLNKM*
25 >lcl|XP_001253476.1|Plus1530075..530494 NW_001494122 IQ domain-containing protein F6-like LOC785460 __SEG__ Chr22 {Bos taurus} MGGYPTEHLHVLPSPNQLEKAAIKIQSWWRGNMVRRTLLHAALRAWVIQCWWRSMQAKMLEQRRRLALRLYTCQEWAVVKVQAQVRMWQARRRFLQARQAACIIQSHWRW
HASQTRGLIRGRYEVRASRLELDIEILMT*
26 >lcl|XP_001253998.1|Plus1580551..581735 NW_001493630 actin-related protein 2 LOC788019 __SEG__ Chr18 {Bos taurus} MDSQGRKVVVCDNGTRFVKCGYVGSNFPEHVFPALVGRPIIRSTTKVGNIEIKDLMLDDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYIFGPEKLNIDTRNCKILLT
ESPMNPAKNREKIVEVMFETYQFSGVYVAIQAVLTLCAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRYITRYLIKLLLLREYAFNHSADFETVRMIKEKL
CYVGYNIEREQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNIIQVADIDTRSEFCKHIVLSGGSTVYRGLPSWLERELKQLYLERVL
KGDVGKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGMTVQ*
27 >lcl|XP_001254118.2|Plus1complement(23727..24230) NW_001502972 leucine rich repeat containing 58-like LOC786448 __SEG__ Chr1 {Bos taurus} MEEVGGAVATAGEAELNLSRLSVSLETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPGAFP
KGLAQSPLCRSLQVLNLSGNCFQEVPTSLLELRALQTLSLGGNQLQSIPAEIENLRR*
28 >lcl|XP_001254327.1|Plus1complement(1073664..1074182) NW_001493559 tumor protein, translationally-controlled 1 TPT1 __SEG__ Chr18 {Bos taurus} MIIYRDLISHDKMFSDIYKIREVADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPDGEGTESTVITGVDIVMNHRLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPER
VKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMETC*
29 >lcl|XP_001254702.1|Plus1526548..527537 NW_001494731 calponin 3 isoform 1 CNN3 __SEG__ Chr3 {Bos taurus} MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGANFQLGLKDGIILCELINKLQPGPVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLF
ENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGML
APGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYGDQGIDY*
30 >lcl|XP_001787225.1|Plus1complement(448081..449265) NW_001493630 actin-related protein 2 LOC788005 __SEG__ Chr18 {Bos taurus} MDSQGRKVVVCDNGTRFVKCGYVGSNFPEHVFPALVGRPIIRSTTKVGNIEIKDLMLDDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYIFGPEKLNIDTRNCKILLT
ESPMNPAKNREKIVEVMFETYQFSGVYVAIQAVLTLCAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRYITRYLIKLLLLREYAFNHSADFETVRMIKEKL
CYVGYNIEREQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQVADIDTRSEFCKHIVLSGGSTVYRGLPSWLERELKQLYLERVL
KGDVGKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGMTVQ*
31 >lcl|XP_001788439.1|Plus1complement(352540..354270) NW_001494732 hypothetical protein KPRP __SEG__ Chr3 {Bos taurus} MCDQQQIQCYQPHPQYCVTCSPCYISQTPCANSQVVVQAPCEMQIVECPAPCPVQVSQVKCQAPCQSKTTEVKGQAPRESKTIQVKGKAPCESKTTQVKGKASCESKTTQ
VKGQAPSQPQFTCVQCQVPCQSEVSYVQCEGPCPVQTCYVECAPVCYTETCYVECPGQSYVPCPAPQPVQTYVTGPLVCQPQGRFSTQCQYQGSYSGCDPQLQSRASFST
WAPQCQTRGSYGSFPAQSRSRSTSRCLPPRQLQPSYRSCSPPRRSEPYYSSSCLPSRCSLGSYNYCTPPRRSEPIYNSDCSRRPTLGCSQRCGPKCRIEISSPRCPRQVP
PQKCPVQIPPIRRCSESCAPRPSWGTSCPDLRSRAEPCPLPSFHPPRRLDQCPEPSLRRSPPPAPCPRPLPAPRTCSRPERCVSPEFRPCSPPRRLSEPCLYPEPRPVPY
PAPRHPRPVQCDLSAPRPYPQPYERQESFPLLEPIPLPEPIPLPSPCPSPEPCVEPRPNPCTGDLGCHESSPHRLDTEAPICGPAGYNWWQDSEPGCRPCDVGLPESQGL
GGCGDQGGVSVGMKGGTRGGVKGAYF*
32 >lcl|XP_001790534.1|Plus1complement(26897..27757) NW_001502937 ZW10 interactor-like LOC613611 __SEG__ Chr5 {Bos taurus} MGAAESEVETAAREVLAKVADILEPVGFQEEAELPAQILAEFVMDSRKKDKLLCSQLQVVDFLQNFLVQEGTAQDQNPLASEDTSRQKALEAKEQWKELKATYQEHVEVI
TNSLTEALPKVEEAQIKQAQLQEALKQLQAKKQMAMEKLRIAQKQWQLEQEKHLQNLAEASSEVRERQTGAQQELQRLYQELGTLKQQAGQEKDKRQRHQTFLQLLYTLQ
GKQLFNEAEAEIPQELDLPKDKLQQVTQPQEQNTQDTMGREADNPQPVGDAGLPWLPGRQQHKEES*
33 >lcl|XP_002700735.1|Plus1690572..690946 NW_001492885 doublecortin-like kinase 1 LOC100336133 __SEG__ Chr10 {Bos taurus} MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYT
IDGLKKISSLDQLLE
34 >lcl|XP_002700999.1|Plus1762825..763937 NW_001493064 actin related protein 2/3 complex subunit 1B LOC100300624 __SEG__ Chr12 {Bos taurus} MAYHSFLVESISCHAWNKDRTQIAICPNNHEVHIYEKSGNKWVQEHELKEHNWQVTGTDWAPETNRIVTCGTDRNANVWTLKGRTWKPTLVILRINRAARCVRWAPSEKK
FAVGSGSPVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSANGSRVAWV
SHDSTLCLVDADKKMAFETLASETLLLLAVTFITENSLVAAGHDCFLVLFTYDSATGKLSFGGRLPKQRSQHGLTSRERFQNLDKKASSEGSAAAGAGLDSLHKNSISQT
SVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIV*
35 >lcl|XP_002702210.1|Plus1complement(3797366..3798505) NW_001493674 hypothetical protein LOC100296460 __SEG__ Chr19 {Bos taurus} METLCPAPRLAVPGSPRGSPCSPTPRKPRRGTQEFSPLCLRALAFCALAKPRASSLGLGPGELAPRAPVLLGPCAPLCTGGRAPDGLKHLAGQAGRSSDPNAPARQDADA
AVCRGRGEEEEGGGSFPHFSARSGVPPGHCPAPRRPRESPTSSVSAPPRPALALDSQPGPAASPHQEPGSRPPPPPAGLSSEPMGPGAAPEPPPPNQTAAVDGNPPKVAP
EAPASSPSTASEAPAAPGDLRQEHFNRLIRRSKLWCYAKGFALDTPSLRRGPERPPAKGPARGAAKKRRRPAPPQRSAQPRRPTPTLPTTSTFNLLDCFPCPPALVLGED
GDLGPASSLRLQGDAKPPPAHPLWRWQIGGPAVPEPPGLKFWGINLEQP*
36 >lcl|XP_002702429.1|Plus1complement(1571492..1574173) NW_001493848 filamin A interacting protein 1-like FILIP1L __SEG__ Chr1 {Bos taurus} MVVDEQQRLTAQLALQRQKIQDLTTSAKETHAKLALAEARAQEEEQKATRLENELQTQTTKFHQNQETIMAKLTNEDSQNRQLRQKLAALSRQIDELEETNRSLRKAEEE
LQDIKEKINKGEYGNSSIMTEVEELRKRVLEMEGKDEELIKMEEQCRDLNKRLEKETSQSKDFKLEVEKLNKKIMALEKLEDAFSKSKQECYSLKCNLEKERMTTKQLSQ
ELESLKIRIKELEAIESRLEKTEFTLKEDLTKLKTLTVMLVDERKTMSEKLKQTEDKLQAAASQLQVEQNKVTTVTEKLIEETKRALKSKTDVEEKMYSVTKERDDLKNK
LKAEEEKGNDLLSKVNVLKNRLQSLEAIEKDFLKNKLNQDSGKSTTALHQENNKIKELSQEVERLKLKLKDMKAIEDDLMKTEDEYETLERRYANERDKAQFLSEELEHV
KMELAKYKLAEKTESSHEQWLFKRLQEEEAKSGHLSREVDALKEKIHEYMATEDLICHLQGDHSVLQKKLNQQENRNRDLGREIENLTKELERYRHFSKSLRPNLNGRRI
SDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLYEESEDQDEDPNDEESVLSFKCNSSTPCPVNRKLWIPWMKSKESHPQNGKIQTKPNGNFMQPGDLVLSHTPGQ
PLHIKVTPDHVQNTATLEITSPTTESPHSYTSTAVIPNCGTPKQRITILQNASITSVKSKTSAEGLMNLEQGMSPVTMATFARAQTPESCGSITPERTMSPIQVLAVTGS
ASSPEQGRSPEPIETSAKHAIFRVSPDRQSSWQFQRSNSNSSSVITTEDNKIHIHLGSPYMQAVASPVRPASPSTPLQDNRTQGLTNGALNKTTNKVTSSITITPTATPL
PRQSQITVSNIYN*
37 >lcl|XP_002702522.1|Plus1345841..346338 NW_001493917 hypothetical protein LOC100335284 __SEG__ Chr20 {Bos taurus} MAAVGRELERDRARFVYVTRFGSHQCGGVLALGGRRAQGPKNAGLKHGHSQEKPRAAAPGSPGAGELPLGFRSGALAASSPAPSSSEPSRRMPAARGGRAAGWAGGASGS
ADLSIRLSSHFTRGSSQLNGRLLSLSPAATPPPPPPHPHRPSVGGSGLVALLSGR*
38 >lcl|XP_002703665.1|Plus1complement(20682..21044) NW_001494596 dynein light chain 1-like LOC100335866 __SEG__ Chr2 {Bos taurus} MRQGFRCDPLSGVSLASPSPRRLLQSASPCSLVTIGDRKAEIKNADMSKEMQQDLVERATQALERYNIEKDIAACIKEFNKKYNPTWRCIVGRNFGSYVTRETKHFIYLG
QVAILLFKSG*
39 >lcl|XP_002703667.1|Plus1complement(316239..316502) NW_001494599 dynein, light chain, LC8-type 2-like LOC100335965 __SEG__ Chr2 {Bos taurus} MRDRKAEIKNNDMSKEMQQDLVECATQALERYNIEKDIVAHIKKEFDKKYNPTWHCIVGRNFGSYVTRETKHFIYLGQVAILLFKSG*
40 >lcl|XP_582214.3|Plus1complement(713064..713663) NW_001495562 transgelin 2 LOC505856 __SEG__ Chr9 {Bos taurus} MANRGPAYGLSQEVQQKIDKQYDADLEQILIQWITTQCRKHVSRPQPGCTNFQNWLKDGTVLCELINGLYPEGQAPVKKIQASTTAFKQMGQISQFLQAAERYGINTNDI
SQTVDLWEGKNMACVQRTLMNLGRLVVAWDDGLFSGDPNWFTKKSKENPRYFPDNQLQEGKNLFGLQMGTNHGASQAGLTDYAMPCQIL*
41 >lcl|XP_586997.3|Plus1809803..811374 NW_001508846 retinoic acid induced 2-like RAI2 __SEG__ ChrX {Bos taurus} MDDLQSQNLAMDMSDSSPTLTNNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGVALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNQSGNA
TYVMTAQGPVQLPVVLEQHVFQHLNSPLVLPPEAPGSSSTIHNNLFQGARDPEAQPQLLDLRIPSQPQEPPLPFEAVLHNLFPAQGALGPPPCQPPPGYTPVPPQPFNSP
LSPLVPPATLLVPYPVIVPLPVPLPIPIPIPVPQSSEAKFSPTCPKPPSAFGLHPFKGPQSPLQKEEVKPFDLFQPREYFQLGRHTVIKMGSENEALDLSMKSVPWLKAG
EVSPAMDQEDTALDLSLSAHRKPEPPPETLYDSSGSVDSPGHPVLEKLPSGMEVPFAPTTTQEAASVMESHGGGSDATEPPSQPSGEVKAENLVSESQAAKVIVSVEDTV
PTIFCGKIKGLSGVSTKNFSFRREDSVFQGSDANSPGEEALGNMEALRKPTKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
42 >lcl|XP_600414.2|Plus1718657..720072 NW_001493023 CAP1 protein-like isoform 2 LOC522140 __SEG__ Chr12 {Bos taurus} MADMRNLVERLERVVGRLEAVSHASDTHCGYGDSAAKGTTPYVQAFDSLLAGPVAEYLKISKESGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQ
IQEVVTFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGLYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSRTGPVAKELSGLP
SGPSAGSGPPPPPRQVHLPPPVPTSSGSDDSASRSALFAQINQGESIIHALKHVSDDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELEGKKWRVEN
QENVSNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVTVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVIPTE
GGDFNEFPVAEQFKTLWNGQKLVTTVTEIAG*
43 >lcl|XP_601670.2|Plus1986201..988354 NW_001508821 ring finger protein 219-like RNF219 __SEG__ ChrX {Bos taurus} MAQTVQNVTLSLTLPITCHICLGKVRQPVICINNHVFCSVCIDLWLKNNSQCPACRVPITPENPCKEIIGGTSESEPMLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEV
DELKSKNLSLESQIKTILDPLTLMQGNQNEDKLPVADNPSKIDPETVAEWKKRLRTANEIYEKVKDDVDKLKEANKKLKLENGGLVRENLRLKAEVDNRSPQKFGRFTVA
ALQSKVEQYERETNRLKKALERSDKYIEELESQITQLKNSSDEKEAMNAICQRALSTDGKGSKGTEEDMASKNQGDGARKQLGSATSSSHLAKPSSSSVRQEGTSKTEPN
CSKNQDLYQKRVETMLTVTDTSMDTYLEREWGNKPSDCMPYKDEELYDLPASCAPLSLSCLQLNTPDNRESSVVKAGGSKKQSNHLRKLMFDEFCDSPNVCNKDSSEDDR
SESEKKSECFTSPKTGFWDCCSTSYAPSLDFENSEENTIANCVGEISSKLSEKPGSCLSKRLNSLRSFEMNRTRTSSEASMDAAYLDKISELDSMMSESDNSKSPCNNGF
KSLDLDGLSKSSQCSEFLEETDKLEERTKPNLSKGSLTTDQLENGDEWKPNSFFLLSPSDQEMNEDFSLHSSSNPGTNEIKPPSCLFQTEFSQGVLLSSTNRLFEDQRFG
SSLFKMSSEMPGLHTHLQSPWSTSFVPEKRNKNVNQSAKRKIQSSLSNASPSKATKS*
44 >lcl|XP_604681.3|Plus164719..65711 NW_001508680 testis expressed sequence 13A LOC526313 __SEG__ ChrX {Bos taurus} MALDGEDPRSGFRHRDVVTFINQEVLGNGGGPDFYMTYRSRPWNEIEDELQSVLADIHVPLNLKRACAWSALALSVRVATRQREQQARRVQRLQEQVEERETATWALASQ
LQRLREERKQVVMQLRRTRQDLQQALSEREALRGQLLQAQRAVSSRSPQLRADTWPVTAEERNKLLVATSQRRRLEAQREEAQYALAGGVQYVQGAQGPWAQVAQPPAPM
PCPRHTPYPMPFPYPPPPPPRVLSEAEGAAATAAACAAPQMPAPVMCAPAMWPVVVSQEEVALPWYQRVEGRGEGPHFGNPEGHFQVDPMYQHSQDRMPRTPDGKKAFEP
*
45 >lcl|XP_607415.3|Plus1231590..236395 NW_001493552 hypothetical protein LOC528977 __SEG__ Chr17 {Bos taurus} MSKDSPSPADGGRAASQKPATPGPAAAALEEQRRELEKLRAELEAERARGRAERRRFSAGARQLREEAERERQQLADHLRSQWEAQRSRELRQLREDVLREREAEIRQLL
RWKDAEMRQLQQVLRRERDGVARQARELQRQLAEELLSRGYGGGRAGPPEDAGARCRCRLQEVLSQLRWETHGEQASRIRHLEAALDVERRLFLKYILEHFHWHPALPSA
PDAPLPLGEPTREAAAKARDGRSAGVRARSRSLDRVPAARARSPDSPLPTRASSLDSLAPAGPRPSLDGSPSHPRAPESSSPDASLSGSLRPLPPPPSPPPSERQIPSHL
REGEEAGSRPCEALSPPPPGPDHCELLRRNSELSEALQELARRRCGLREENVRLRRLGLPDEADEKAKRLKGKRAELTGLARRLEDRARKLQEANLRAVSAPVPGESRPG
LELCQALAHQRARDLSEQASALLAKDKQIEELRQERHLLRARVASGLGPLPGEGAASAQWLSIGDLDRLQRESQREVLRLQWQLTLQQAAGGARAEAGGQSAPCEAARRQ
VRALERELSARRQECEELGAQAAAAQRRGREAEAQLQVALREGAWLAKENARLQAQADWTRKVAAENEDVRGQLGRACQQRDSASLLAEQLLQQAAQRQDWQQQLQHDLQ
KVLCDLQAARDEMWALQCQPAHPPQDNRGTEPQLGPANPASPVPSRDKQGRKEDLLLESPAALGQPAWAPQAPDSSGQPLDSRPQPQRTGSQSNSSSEVESAWATVPSCP
ILDADTGSEAEDLEPDSLPSTLEAGDLEVSVATPKLKIFLARYSYNPFEEPSEHPESELPLTPGDHVYIFSDMDEDGFYEGALADGRQGLVPSNLVEQIPDGDIRGCLPT
ESPDRGPTWLPAARQGQAWKDDPSPGFLPGQAQAAVDRGPCPVARVGSRMEVATEVSDTKTEAGRLGSQESRDRQGSANAPPGNNRSPRMAPTHLHLRSVAATSAEVAWV
GGSHAHAVYLDGREHALTSMGVSSYTFRHLQPGTRYQVRVEVRPPGDSLQACREKTSSAVTFETPLAGPPHPPLDVLVERHPSPGLLVVSWLPVTIDAAGSSNGVPVTGY
AVYADGLKVADVAEATAGSTLLELSQLPWPETCQKISVRTTSLCGESLDSVPAQIPHDCFTCLHWPEMSPFGYTCRDPSAISGSFPVCPRRLGPTPLSAKACPHAPRSCE
EPRARCLEAFPEEPPRRWSPEPKLISEGGGPSSGSGSQAQGPAEARKPPRKDQLFEKRPWNHRPPLPRGQPGREGTQDRRMLTVPTPAAGVSHLSPEPAPGEELRQEKPA
SGKVLRQKADALVSTPPELGSSQQSASVFSGARQEDGRGAEGRERRRALRGRSTQGQALGARAGGRLRGPSSAPCPARRSKALGTPRGAAPPPGTRVGPRAGIFVTLPNY
EPLAVSATSEAAGGELALQKGQPQSAGGSQDPHGFCRGECSGPVGSITSHLVAEVDAGTECTDGHGRWHLPGHLDDSEGLTGPQGSSPLPQGSPGRPSSSLWAPKTMMAA
LDYDPQDWLARGPVKGQLSLRAGDVVTVHGPVDDKGFYSGEVGGHRGLVPAHLLGHMSLQE*
46 >lcl|XP_874820.3|Plus14723533..4724279 NW_001495141 tropomyosin 4 isoform 2 LOC540799 __SEG__ Chr6 {Bos taurus} MAAIAVTEAMKCKIQVLQQQADDAEERAKRLQQKVDGERWAREQAEAEVVSLNRRIQLVEEELNRAQERLATALQKLEEAEKAADESERVMKVIENQALKDEEKMELQEI
QLKEAKHIAEEAHRKYEEVARKLVIIEGDLERTEERAELAQSRCRKMGEQIRLMDQHLKCLSAAEEKYSQKEDKYEEEIKILTEKLKEAETRAEFAERSVAKLEKTIDDL
EDKLKCTKEEDLCTQRMLNQTLLDLNKM*