SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor Y    

ID / Description / Sequence
1 >lcl|NP_001101054.1|Plus1complement(1702765..1706082) NW_047565 RAN binding protein 6 Ranbp6 __SEG__ Chr1 {Rattus norvegicus} MAAAGSAGLPATISDKQEFYQLLKNLINPSCMVRRQAEEVYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSEVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDENGTNHWPEGLKFLIDSIHSKNVVLWEVALHVFWHFPGIFGNQDRHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDDDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKVVLPMTKEHIMQMLQSHDWKCRHAGLMALSAIGEGCHQQMEPILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
SFQKKFHEIVITALLRTMENQGNQRVQSQAASALVIFIEDCPKSLLILYLENMVKSLQSILVIKLQELIRNGTKLALEQLVTTIASVADVIEENFIPYYDIFMPSLKHVV
ELAVQKELKLLRGKTIECISHVGLAVGKEKFMQDASNVMQILLKTQSDLNNMEEDDPQTSYMVSAWARMCKILGKDFEQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDEGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKMMVPLLKFYFHDNVRMAAAEAMPFLLECARIRGSEYLSQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGGILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAIGKIMKF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLNFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETISLEDPCAKRLANVVRQIQTSEELWLECTSQLDDEQQEALQE
LLSSA*
2 >lcl|NP_001102970.1|Plus1complement(12474347..12474856) NW_047626 late cornified envelope 1M Lce1m __SEG__ Chr2 {Rattus norvegicus} MSCQQSQQQCQPPPKCKIPKCPPSSCCSLGSGGCCGSSSGGCCSSGGGSCCLSHHKPRFSLRRRRHSSGCCSSGGSSCCGSSGGSSGGSSCCGSSGGSSSGSSCCGSSGG
SSCCGSSGGSSGGSSCCGSSGGSSGGSSSGCCGSSGGSSGGSSSHQQSGGSSCCSGGCC*
3 >lcl|NP_075586.1|Plus14257472..4259049 NW_047558 nuclear pore glycoprotein p62 Nup62 __SEG__ Chr1 {Rattus norvegicus} MSGFNFGGTGAPAGGFTFGTAKTATTTPATGFSFSASGTGTGGFNFGTPSQPAATTPSTSLFSLATQTSTTQTPGFNFGTTPASGGTGFSLGISTPKLSLSSTAATPATA
NTGSFGLGSSTLTNAISGASTSSQGTAPTGFVFGSSTTSAPSTGTTGFSFTSGSASQPGASGFNIGSVGSLAQPTALSGSPFTPATLATTTAGATQPAAATPTAATTSAG
STLFASIAAAPASSSTTVLSLSAPATTAATPTAGTLGFSLKAPGAAPGASTTSTTTTTTTTTTTASTSSSTTTTGFALSLKPLVPAGPSSVAATALPASSTAVGTTTGPA
MTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHADEEREKTYKLA
ENIDAQLKRMAQDLKDIIEHLNMAGGPADTSDPLQQICKILNAHMDSLQWVDQSSALLQRRVEEASRVCESRRKEQERSLRIAFD*
4 >lcl|XP_002727937.1|Plus118258532..18259986 NW_047356 keratin 8-like LOC100362689 __SEG__ Chr11 {Rattus norvegicus} MSVRVTQKSYKMSTSGPRAFSSRSFTSGPGARISSSSFSRVGSSSSSFRGSLGGFGGAGVGGITAVTVNQSLLNPLKLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVR
FLEQQSKMLETKWSLLQQQQKTSRSSMDNMFESYINNLRRQLEALVQEKLKLGVELGNMQGLVEDFKNKYEDEISKHTEMENAFVLIKKDVDEAYMNKVELESHLEGLTD
EINFLRQIHEEEICELQSQISDTSGVLSMDNSRSLHMDSIIAEVRAQYEEIANRSRAEAETMYQIKYEELQTLAGKHGDDPHRSKTEISEMNPNISRLQAEMDALKGQRA
TLEAAIADAQQRGELAMKDANAKLEDLKNALQKAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGTQNMSIHTKTTSGYAGGLSSSYGGLTSPGFSYGM
SSFQPGFGSVGGSSTYSRTKAVVGKKIETRDGKLVAESSDIMSK*