SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro Y    

ID / Description / Sequence
1 >lcl|XP_001158862.1|Plus111807495..11808946 NW_003457226 keratin, type II cytoskeletal 8 isoform 4 KRT8 __SEG__ Chr8 {Pan troglodytes} MSIRVTQKSYKVSTSGPRAFSSRSYMSGPCARISSSSFSRVGSSTFRGGLGGGCGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAMHTQEKEQIKTLNNKFASFIDKVW
FLEQQNKMLETKWSLLQQQKTAQSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKHTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDE
INFLRQLYEKEIREPQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANCSWAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNQNISQLQAEIEGLKGQRAS
LEATIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLHEYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYGLG
SSFGSGAGSSSFSRTSSSRAVVVKKIETCDGKLVSESSDILPK*
2 >lcl|XP_003309947.1|Plus1complement(5994301..5994633) NW_003456882 prothymosin alpha-like LOC460522 __SEG__ Chr3 {Pan troglodytes} MSDAVVDTSSEITTKDLKEKKEVVEEAENGRDALANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESPTGKRAAEDDEDDDVDTKKQKTDEDD
*
3 >lcl|XP_003339376.1|Plus1complement(742204..743787) NW_003458523 nuclear pore glycoprotein p62 NUP62 __SEG__ Chr19 {Pan troglodytes} MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLTTQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMAN
PSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPAALPFTPATPAATTAGATQPAAPTPTATTTSTGPS
LFASIATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAAAAAATATATTTSSSSSTTSFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAAS
SAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEEREKTYK
LAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD*
4 >lcl|XP_528532.2|Plus1complement(5292078..5295395) NW_003457279 ran-binding protein 6 RANBP6 __SEG__ Chr9 {Pan troglodytes} MAATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPSLPADVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDEDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKVVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
NFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKSLLVLYVDSMVKNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIEEKFVPYYDIFMPSLKHIV
ELAVQKELKLLRGKTIECISHIGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGKDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKLMVPLLKFYFHDNVRVAAAESMPFLLECARIRGPEYLAQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGGILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAIGKILKF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLSFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQE
LLNFA*