SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus Y    

ID / Description / Sequence
1 >lcl|NP_444304.1|Plus15727739..5729319 NT_039424 nuclear pore glycoprotein p62 Nup62 __SEG__ Chr7 {Mus musculus} MSGFNFGGTGAPAGGFTFGTAKTATTTPATGFSFSASGTGTGGFNFGTPSQPAATTPSTSLFSLTTQTPTTQTPGFNFGTTPASGGTGFSLGISTPKLSLSNAAATPATA
NTGSFGLGSSTLTNAISSGSTSNQGTAPTGFVFGSSTTSAPSTGSTGFSFTSGSASQPGASGFSLGSVGSSAQPTALSGSPFTPATLVTTTAGATQPAAAAPTAATTSAG
STLFASIAAAPASSSATGLSLPAPVTTAATPSAGTLGFSLKAPGAAPGASTTSTTTTTTTTTTTAAAAAASTTTTGFALSLKPLVSAGPSSVAATALPASSTAAGTATGP
AMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHADEEREKTYKL
AENIDAQLKRMAQDLKDIIEHLNMAGGPADTSDPLQQICKILNAHMDSLQWVDQSSALLQRRVEEASRVCEGRRKEQERSLRIAFD*
2 >lcl|NP_808389.2|Plus1complement(22996018..22999335) NT_039687 ran-binding protein 6 Ranbp6 __SEG__ Chr19 {Mus musculus} MAAAGSAGLPATVSEKQEFYQLLKNLINPSCMVRRQAEEVYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPPEVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDESGTNHWPEGLKFLIDSIHSKNVVLWEVALHVFWHFPGIFGNQDRHDLDIIKRLLDQCIQDQEHPAIRTLSARAAATFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDDDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKVVLPMTKEHIMQMLQSPDWKCRHAGLMALSAIGEGCHQQMEPILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
SFQKKFHEIVITALLRTMENQGNQRVQSHAASALVIFIEDCPKSLLILYLENMVKSLHSILVIKLQELIRNGTKLALEQLVTTIASVADAIEESFIPYYDIFMPSLKHVV
ELAVQKELKLLRGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGKDFEQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKMMVPLLKFYFHDNVRVAAAEAMPFLLECARIRGSEYLSQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGGILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAIGKILKF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLNFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETISHEDPCAKRLANVVRQIQTSEELWLECTSQLDDEQQEALHE
LLSFA*
3 >lcl|XP_001487841.1|Plus110491906..10492301 NT_166289 hypothetical protein LOC73350 1700045I11Rik __SEG__ Chr4 {Mus musculus} MERGQILPCSVGPQGLSAEPESQPKNTHPDLPARCRCGPGEMDVFAGSAPGAAVRHTTTTTTTTTTTTTTTTTTTTTTTTVGPTCVPPHLPPHWVVFLDLCRLVRTMSLH
QVAAAVMMVASLCPGVVCRGV*