SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul Y    

ID / Description / Sequence
1 >lcl|XP_001084233.1|Plus1complement(2689873..2691240) NW_001118164 keratin, type I cytoskeletal 18-like LOC695597 __SEG__ Chr5 {Macaca mulatta} MKNPSSRRHRSAKPESGRLTFLLYSISFTTRSTFSTNYRSLGSVQAPSYGTPPVSSAASVYASARGSGSRISVSRSTSLRGGMRSGGLASGMAGGLAGMGGIQNEKETMQ
SLNECLASYLDRVKSLEMENGKLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNACFAADDFRVKYETELAMRQSVEKDIHGLHKVIDDTNVT
RVQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLIVEVDAPKSQDLAKIMADIWAQYDELARKNREELDKYWSQQTEESTTVVTTQSAEVGAAETTLTELRGTVQS
LEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESEMAQTRAERQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTRQIVD
GKVMSETNDTKVLRH*
2 >lcl|XP_001085972.1|Plus12005128..2005460 NW_001218098 hypothetical protein LOC694887 isoform 1 LOC694887 __SEG__ ChrX {Macaca mulatta} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDKDDDVDTKKQKTDEDD
*
3 >lcl|XP_001086358.1|Plus1complement(2897760..2899052) NW_001098169 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr12 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLES
KIREHLEKKGPQVRDWSHYFKIIEDLRVQIFANTVDNARIVLQIDKARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNVTRLQLETEIEALEEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMVDIRAQYDEMARKNREKLDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTFQSLPINLDSMRNLKASLENSLREVEAR
YALQMEQLNGILLHLESELAQTRTEGQRQAQEYEALLNIKVKMEAEIATDRCLLEDGEEFNLGDALDSSNSTQTIQKTTTCQIVDGKVVSETNDTKVLRH*
4 >lcl|XP_001086760.1|Plus1complement(2625289..2626422) NW_001116476 nucleoporin Nup43 isoform 1 NUP43 __SEG__ Chr4 {Macaca mulatta} MEEIYAKFVSQKIRKTRWRPLPPERLQTAETFATGSWDNEENYVSPWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLPSFDRERIVTASSTGCVTVFLHHPNNQTLS
VNQQWTTAHYHAGPGSPSYSSAPCVGVVCNNPEIVTVGEHDHKEADHKEATRTIDNADSNTFHAVTFLQTPEILTVNSTGQLKTLDFRQQGNELSHILSLTSDRVPLHCV
DRHPNQQHVVATGGQDGIFSIWDVRQGTMPVSLLKAREAEMWEVHFHPSNPDHLFTCSEDGALWHWDASTDVPEKLSLFHQGGRSSTFLSQSISNQANVHQSVISSWLST
DPAKHRIETTSLLPSRSLSVNSLDVLDPCLVCGTDAEAIYVTRYLFS*
5 >lcl|XP_001088181.1|Plus16050813..6052105 NW_001114282 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr3 {Macaca mulatta} MSFTTRSTFSTSYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDTVRSLETENRRLES
KIQEHLEKKGPQVRDWSHYFKIIEDPRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNVTQLQLETEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETMLTELRRTVQSLEIDLDSMRNLKASLENSLREVEAR
YALEMEQLSGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH*
6 >lcl|XP_001090336.2|Plus14614139..4615584 NW_001116512 keratin, type II cytoskeletal 8 isoform 3 KRT8 __SEG__ Chr4 {Macaca mulatta} MSIRVTQKSYKVSTSGPRAFSSGSYTSGPGALISSSSFSRVGGSSFRGGLGGGYGGASGMGGITAVTVNQSLLSPLNLEVDPNIQAVRTQEKDQIKTLNNKFASFINKVR
FLEQPNKMLETRWSLLQKAARSNMDNMFESYINNFRRQLETLGQEKLKLEAELGNMHGLVENFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVEMESCLEGLTDEIN
FLRQLYEEEIQELQSQIWDTSVVLSMHNSRSLDMDSIIAEVKAQYKEIANRSRAEAESMYQIKYEELQSLAAKHGDDLRCTKTEISEMNRNISRLHAEIEGLKGQRASLE
AAIADAEQRGELAIKDANAKLSELEAALQRAKQNMARQLREYQELVNVKLALYIEIATYRKLLEGEESRLESGMQNMSLHMKTTSGYAGGLSSAYGGLTSPGLSYGLGSS
FGSGAGSSSFRRTSSSRAMVVKKIKTCNGKLVCESSDLLPK*
7 >lcl|XP_001098060.1|Plus111462336..11463628 NW_001114280 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr3 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSCSAQQVSSAAGVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDHRASYLDRVRSLETENRRLES
KIWEHLEKKGPQVRDWSHYFKIIEDLRPQIFANTVDNARIVLQIDNAPLAADDIRVKYETELAMRQSVENDIHGLRKVIDDTNVTRLQLEAEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQTEESTTVVTTQSAKVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEAH
YALQMEQLNGILLHLESELAQTRAEGQRQAQKYEALLNIKVKLEADIATYRRLLEDGEEFNLGDALDSSNSMQTIRKTTTRRIVDGKVVSETNDTKVLRH*
8 >lcl|XP_001108579.1|Plus1260004..261296 NW_001111343 keratin, type I cytoskeletal 18 isoform 1 KRT18 __SEG__ Chr20 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGVSGSRISVSRSTSFGGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLES
KIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNVTRLQLETEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELAGKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSPREVEAR
YALQMEQLNGILLHLESELAETRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH*
9 >lcl|XP_001112858.2|Plus115475503..15478820 NW_001101663 ran-binding protein 6-like LOC715799 __SEG__ Chr15 {Macaca mulatta} MAATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPADVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGTQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDEDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKVVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
NFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKSLLVLYLDSMVKNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIEEIFVPYYDIFMPSLKHIV
ELAVQKELKLLRGKTIECISHIGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGKDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKLMVPLLKFYFHDNVRVAAAESMPFLLECARIRGPEYLAQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGGILKIKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAIGKILKF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLSFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEDLWLECVSQLDDEQQEALQE
LLNFA*
10 >lcl|XP_002801401.1|Plus1complement(366778..368343) NW_001106523 nuclear pore glycoprotein p62-like LOC100426308 __SEG__ Chr19 {Macaca mulatta} MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPSQPTTSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMAN
PSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGVTQPAAPTATATTTGTGPT
LFASIATAPTSSATTGLSLCTPATTAGAPAAGTQGFSLKAPGAASGASTATSTTATAAATSSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAASSAMTYA
QLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEEREKTYKLAENID
AQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMGSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD*
11 >lcl|XP_002808189.1|Plus1complement(2532398..2533690) NW_001104434 LOW QUALITY PROTEIN: keratin, type I cytoskeletal 18-like KRT18 __SEG__ Chr17 {Macaca mulatta} MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLASGMAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLES
KIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVSDDTNVTRLQLETEIEALKEELLFMKKNHEEE
VKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRA*YDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEAR
YALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEEFNLGDALDSSNSMQTIQKTTTHRIVDGKVVSETNGTKVLRH*