SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom Y    

ID / Description / Sequence
1 >lcl|XP_001365497.1|Plus1complement(26094499..26095641) NW_001582021 nucleoporin Nup43-like LOC100017518 __SEG__ Chr8 {Monodelphis domestica} MEEIFAKFVSQKISKTRWRPVPFGSLQPPETFATGSWDNEENSVSLWCIGDFCNLSTDGGLEGDHQLLCDIKHHGDVIDLQFLDQERIVAASSTGCVTVFLHHPNNQTLS
VSQEWIGAHYHIGPCSPSYRSAPCTGIVCNSPEIVTVGEDGRINLFRVGYKEAVRTIDNADSSTLHAVAFLQTPGILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPL
HCVDRHPNQQHVVATGGQDGMLSIWDVRQGSMPVSLLKAHEAEMWEVHFHTSNPDHLFTCSEDGSLWQWDASTDVPEKSSLFHQGGRNSTLLAHPSSNQLNVNHSLISSW
LSTDPAKDRIEITSLLPNRTLSVNSLDVLGSCLLCGTDAEAIYVTRQLFS*
2 >lcl|XP_001377493.2|Plus178334193..78335479 NW_001581900 keratin, type I cytoskeletal 18 KRT18 __SEG__ Chr3 {Monodelphis domestica} MSFTTRSSTYSTNYRSLGSVRAPSHRIRPASSAASVYAGAGGSGSRISTARSSSFRGSWGAGSMMGGLAGIGGVHGEKETMQDLNDRLASYLDRVRSLETENRKLEGKIR
EHLDKKGPRIREWGHYFRTIEELRAQIFANSVDNARIVLQIDNARLAADDFRVKYEAELAMRLSVEKDIHGLRKVIDDTNVTRLQLESEIEALKEELLFMKKNHEDEVKS
LQAQIAGSGLTVEVDSPKSQDLSKVMADIRAQYDALAQKNREELDKYWSQQIEESTVAINTRSEEVEAARNTVTELKRTVQSLEIDLDSLRNLKTSLEESLREVETRYAI
QMEQINTALLHLEAELGQTRTEGRRQAQEYEALLNIKDKLEAEINTYRNLLENGEDFNLVHALDGSSSSLQSIHKTSTRRTVDGKVVAETNDTKVLRR*
3 >lcl|XP_001381498.1|Plus133781783..33784548 NW_001581894 nuclear pore complex protein Nup107-like LOC100032503 __SEG__ Chr3 {Monodelphis domestica} MDPNSGFWDMTSPVVRDVEVTRTARRQSAHKRVSTLPPQEDTLANTLPRNQGISRIPSLYRHTFTSLNRRQSDVSAILASGIRSPRLAPLTAFLGNLPSVTSLDESNWSA
AVSSPPSGLFTDVDPSNVAEDVSFSAVMLCEDDPGEAATMSIYFDFLYTFLKHASNTVFELVEEYESICDSHVNILGKIVSRATPGLQKFSKTASVLWLLQQEMVTWRLI
ASLYRDRIQSVLEEENAFEIASLNASEKTVVDTLFQRDSLIRQSQLVVDWLESIAKDDIRDISDNIEFYAKSVYWENTLHILKQQQLISFIGNSRPLVTELDPDAPIRQK
MPLDDLDREDDNRLLKFLFTLIRSGLTDEAQRLCKRCGQAWRAATLEGWKLYHDPNVNGGTELEPVEGNPYRCIWKISCWRMAEDELFNRYERAIYAALSGNLKQLLPVC
ETWEDTVWAYFRVMVDSLVEQEVRTSVVTLDETEELPREHLEANWTLEKVFEELQATDKKRVLEENQEHYHIIQKFLILGDIDSLMDEFTKWLSKGRSILPGHLLRFMIH
LILFFRTLGIQTKESVSVEVLKAYIQLLICKKHMRLIAFYTCHLPQDQGVAQYAEFLEGITEFEQRHHCLELAREAGLDVATITKTVVENTRKKDAGEFSHHDIAPCLDI
GTTEEDRLKIDVIDWLVFDPAQRAEALKQGNAIVRKFLASKKHEAAKEVFAKIPQDSIAEIYNQWEEQGMESPLPAEDDNAIREHLCIRAYLEMHEIFNEWFKHMNSAPP
KPTLLRQASFTEKVAYEHKEKKYEMDYGIWKAHLDVLTTEVKEKMYNVLLFVDGGWMVDVREDAEEDHERTHQMVLLRRLCLPMMCFLLHTILHSTDQYQECLQLADVIS
SERHKLYSVFSKEELRKLLQKLRESSLMLLDQGLDPLGYES*
4 >lcl|XP_003339592.1|Plus196537202..96539979 NW_001581837 hypothetical protein LOC100032391 LOC100032391 __SEG__ Chr1 {Monodelphis domestica} MDPSQIEKKIAEPTQAQRAKVQSLFEVPFLHKGTEEDGVLSQSQQSPKLSTATSKPSGSKTASSEENQNLTNTQEKTDHKDSKESAVINDISALIPFGEVAGCLSVHIKK
CRNFSTKISLEYYTKLFIRVSVSKEMKYTKSHFLDAEEKKPSIKFEEVKYFSIYVPRRQNDENNLIYLDLMEARDVDYPILVGSFHIHLYEVIQKGCFTEEFNLKLRNLI
ICKIEVEFMFCYGNFGYGFSHQLKPLQKMIQPTMFLCVPPPPHRTDTRANVITAQNIEYPRFLSKDLKATIGNPEELSPLVKLEKLQQKPRARLRKMKGEYRKLKTWEEK
SNYLRKILKLSPEAKDIFGPKDDNYLDVVTPEDKKKWLYPEKRQEPPVIAQKIYEPIVRSLPPKEITPLPPPVLLKSSSSITIESIYERVSIPVAEKPESKDKTPKMQTS
YSSSEEEEPIKQPLFTSKDKTPRMQTSYSSEEEVPIKQPLFTSKDKIPRMQTSFSSEEEAPIKQPLFTSKDKTPRMQTSYSSEEEVPIKQPLFTSKDKTPRMQTSYSSEE
EAPIKQPSFSSEEEAPIKRAFSSIDKTPTKHTSFSFEEKAPTKQASFSSEEEAPIKRTFSSIDKISTKQTSFSSDEEAPTKQTPFSSEEEASIKRTFSSIDKTPTKQTSF
SSEEEAPIKRTFSSIDKTPTKQASFSSEEEAPIDKTPTKQASFSSEEEAPIKRTFSSIDKTPTKQASFSSEEGAPITAQASFSSKDKTPTKQASFSSYFSQLSLDFMNEF
VPTTSFERNISDSDAPRQSLVEESKESREVPKDTETGPEGSLPPYISRSVSDEALFPLDLGEIDEVKDKPEEDEDSDIVISPAFKKDTSPFKPLRPEKLPPFQTCENLDR
DKFEPFLRDLNGDKKDRGIQDEPFHSIKKGTLSEQSIELEDQDPP*