SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab Y    

ID / Description / Sequence
1 >lcl|XP_001493380.1|Plus1complement(19647008..19648561) NW_001867363 nuclear pore glycoprotein p62-like LOC100056315 __SEG__ Chr10 {Equus caballus} MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGSGGFNFGAPTQPAASAPATGLFSLTTQAPATQTTGFSFGTTTPAAGGSGFSLGINTPKLNLSNAAATPAAAQ
PGGFGLGSSTLTNTISSTVTSSQGTTPSGFVFGSTTTTSAAPSTTPGGFSFTSGSTSQTGASGFNIGSMASSAQPTALAGLPFTPATLAATGAGATQPAAPAPTATTTSA
GPTLFASLATAPTSSTTTGLALCAPATTAGASGAGALGFSLKAPGAVSATSTAASTAATTTTSSFALNLKPLAPAGIPSNTSATVTAAPGPIAPAGVSASPVMTYAQLES
LINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTVYLQHADEEREKTYKLAENIDAQLK
RMAQDLKDIIEHLNTSGGPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD*
2 >lcl|XP_001493410.3|Plus1complement(27294518..27297835) NW_001867394 ran-binding protein 6 RANBP6 __SEG__ Chr23 {Equus caballus} MAATGSAGIPATVSGKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSDVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGNQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAIPHILAMMVDLQDDEDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKLVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
NFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKSLLVLYLDSMVRNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIEEKFVPYYDIFMPSLKHIV
ELAVQKELKLLKGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMISAWARMCKILGNDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKLMVPLLKFYFHDNVRVAAAESMPFLLECARTRGPEYLAQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGEILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAVGKILRF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLSFLCDLIESNHPVVLGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEELWLECVSQLDNEQQEALQE
LLNFA*