SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam Y    

ID / Description / Sequence
1 >lcl|XP_003431683.1|Plus1complement(18004717..18008034) NW_876253 ran-binding protein 6 RANBP6 __SEG__ Chr11 {Canis lupus familiaris} MAAAVSAGGPATVSGKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSDVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGNQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFSDLLPGILQAVSDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEIIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDEDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKLVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
NFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKALLVLYLDSMVRNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIEEKFVPYYDIFMPSLKHIV
ELAIQKELKLLKGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGSDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELGEGFVEYTEQVVKLMVPLLKFYFHDNVRVAAAESMPFLLECARIRGPEYLAQMWQFICDPLIKAIGTEPD
TDVLSEVMNSFAKSIEVMGDGCLNDEHLEELGEILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAVGKILRF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQSLSFLCDLIESNHPVVLGPNNSNLPKIISIIAEGKVNETINYEDPCAKRLANVVRQVQTSEELWLECISQLDDEQQEALQE
LLNFA*
2 >lcl|XP_541485.2|Plus136934304..36935887 NW_876270 nuclear pore glycoprotein p62 NUP62 __SEG__ Chr1 {Canis lupus familiaris} MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGTPSQPAASTPSTGLFSLTTQAPATQTPGFSFGTTTPATGGTGFSLGISTPKLNLGSVAATPATAH
PGGFGLSSSTLTNAISSTVTSSQSTAPTGFMFGSATTSAAPSTTPGGFSFTAGSTSQTGTSGFNIGSMGTSTQPTALAGLLFTPATPAATGAGATQPAAPAPTAATTSAG
PTLFASLATAPTSSTTTGLSLCTPSTTAGTPGAGTLGFSLKATGAASTASTTTSTTTATTTTAATTAATTTTTGFALNLKPLAPAGITSNAPAAVAAPPGPGAATGASTS
PVMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITTLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTVYLQHADEEREKTYK
LAENIDAQLKRMAQDLKDIIEHLNTSGGPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD*
3 >lcl|XP_850028.2|Plus18777188..8777796 NW_879563 nucleophosmin-like LOC608047 __SEG__ ChrX {Canis lupus familiaris} MEDSLDMDMSPLRLQNYLFGCEVKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDKLHIVEAEAMNYEGGPIKVTLATLKMSVQPTVSLGGFEITPPVVLQLKCGSGPVH
ISGQHLVAVEEDAESKDEKEEDMKLLSISGKHSAPGSGSMFPQKKVKLAANEDDDDDDDDDDDDDFDEYKHKNLQQNTIKLNLGTYKGDYMS*