SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau Y    

ID / Description / Sequence
1 >lcl|XP_001790668.1|Plus1complement(515880..517442) NW_001493624 nucleoporin 62-like NUP62 __SEG__ Chr18 {Bos taurus} MSGFNFGGTGASTGGFTFGNTKTATTTPATGFSFSASSTGGFSFGTPSQSAASTPATSLFSLSTQTPATQTPAFSFGTTTPASGATGFSLGSNTPKLSLGSTAPAPAQPA
GFGLGGSTLSSAVSSASTSAQGAAPGGFVFGSATASAAPPTTSTSGGFSFTGGSTSQTGTSGFNIGSLGGPAQPPALGGLPFTAAAPAATGAGAAQPAAPTPAATTTSAG
PSLFTSLATAPTSSAATGLSLGTPATTTGTAGAGTVGFNLKAPGVASTTSTATTTTTTTAATTSTTGFSLNIKPLTPAGIPSNTAASGSAPSGASAAAGGSGSAALTYAQ
LESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGERITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTVHLQHADEEREKTYKLAENIDA
QLKRMAQDLKDIIEHLNTSGGPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD*