SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr W    

ID / Description / Sequence
1 >lcl|NP_001124204.1|Plus1complement(462993..464732) NW_003536643 thrombomodulin THBD __SEG__ Chr17 {Sus scrofa} MLRVLLLGVLAPAGLGFPVLPEAQPLGSQCVEHDCFALFRGPATFLAASQACEHLQGHLMTVRSSVAAEVISLLLSGEGDGPRLWIGLQLPRDCVEPRHRGALRGFQWVT
GDNHTSYSMWARPQGDEEPICGTLCVAVSAAGAPVPGEPAWEEQQCEAEADGFLCEFHFPASCQPLAVKSDAAEAASFSITYSTPFGARGADFQALPVGSSVAVTPLGVE
LECAVWPGEAQARWVREAPGAWACGVENGGCQHACNGSAGESRCLCPADAALQEDGRSCEAPAEHPCHRLCEHICFHDPLDAPTNYTCFCEAGYRLAADGHRCEDVDDCA
EVPSPCPQSCVNTQGGFQCHCLPNYELVDGECVEPVDPCFGTDCEYECQVVGRTGYRCVCAEGFAPVPHAPHRCQMFCNQTSCPADCDPNKQDSCQCPDGYILDEGSICT
DIDECNNGYCPGECRNLPGTYECICGPQLDLAGHAGTDCDPIQENSREQGGGDEDVGSGEPAVSPTPGTTARPSPARPLHSGVLAGISIATLSLVVALLALLCHLRKKQG
TSRAELEYKCGVPAKEVVLQHVGQMPQKL*
2 >lcl|NP_001135461.1|Plus1complement(<95979..96368) NW_003536001 platelet glycoprotein IX GP9 __SEG__ Chr13 {Sus scrofa} MPAWAALLLLWTAVQAAEDCPAACSCRTLGTMGLEVDCQSRGLAALPALPAHTRHLLLANNSLRSVPPGAFDHMLQLQTLQLANNPWHCDCGLTYLRLWLRDRAPGELPR
VRCASPGHASGRALSQLIGS
3 >lcl|XP_001926288.3|Plus1complement(35366..36268) NW_003534837 carbohydrate sulfotransferase 11-like LOC100157186 __SEG__ Chr5 {Sus scrofa} MPHTVLSSGPLVSPLQLDLSNTAVLHQMRRDQVTDTCRASSAMSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLK
TLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIH
YDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE*
4 >lcl|XP_001927476.1|Plus1complement(466094..467353) NW_003299234 trophoblast glycoprotein-like LOC100158028 __SEG__ Chr1 {Sus scrofa} MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSLTSSASSTSSASFPASAASALPPLPGRCPQPCECSEAARTVKCVGRNLTEVPADLPPYVRTLFLTGNQLAVLPTGAF
ARRPPLAELSALNLSGSRLTEVQAGAFEHLPSLRLLDLSHNPLANLSAFAFSGSNASVAAPSPLVDLILNHIVTSAAQRQNRSFEGMVAAALRAGHALRGLRRLELASNH
LLYLPLDVLAQLPDLRHLDLRNNSLVSLTYVFFRNLTHLESFHLEDNALKVLHNGTLAELQSLPHVRVFLDDNPWVCDCHLADMVAWLKETEVVQDKARLTCAFPEKMRH
RVLLELNSSDLDCDPDLPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
5 >lcl|XP_001927676.3|Plus111284..13266 NW_003535285 leucine-rich repeat transmembrane protein FLRT2 FLRT2 __SEG__ Chr7 {Sus scrofa} MGRQTTRGPSQGAFFLKAWLLLSLGLSSQVSQLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHSVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRVLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKHIPA
SLNVRGFMCQGPEQVRGMAVRELNLNLLSCPTTTPGLPRVTLAPSPASPPTQPPTLSVPTLSRSSTPVTPTASKVPTHPDWDGRDRVTPPLSDRVQLSIHFVNDTSIQVS
WLSVFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
*
6 >lcl|XP_001927677.3|Plus1complement(27256..29343) NW_003535816 SLIT and NTRK-like protein 1 SLITRK1 __SEG__ Chr11 {Sus scrofa} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPSKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGGR
NKPPANSLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSRE
KFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSEV
LMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASEI
NSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
7 >lcl|XP_001928209.1|Plus1complement(142219..143505) NW_003535207 immunoglobulin superfamily containing leucine-rich repeat protein-like isoform 1 LOC100152082 __SEG__ Chr7 {Sus scrofa} MQELCLLCWVVLVGLVQACPKPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPSLPEGAFREVLLLQSLWLAHNEIRTVAAGALAPLGHLKSLDLSHNLI
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFEPLTALSHLQINDNPFDCTCSIMWFKTWALTTAVSIPEQDNITCTSPHVLKGTR
LNRLLPLPCSAPSVQLTYQPSQDGAELQPGFVLALHCDVDGQPAPQLHWHIQTPRGTVEIASPNVGADGRALPGALAASARPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDALGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRTGGPEAAATGEGVSAQQPPGLLLLGQSILLLVLTFF*
8 >lcl|XP_001928263.1|Plus1complement(178070..180310) NW_003535207 immunoglobulin superfamily containing leucine-rich repeat protein 2 ISLR2 __SEG__ Chr7 {Sus scrofa} MVLLRALWLALALLEVVGACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFANVTQVTSLWLAHNEVRTVEPGSLAVLSQLKNLDLSHNL
ISSFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCSLVWLQTWAASTRVSLPEPDSIQCSSPPALQGV
PVRRLPALSCAPPSVHLSVEPPPEAPGSPLRSGLALTLHCVAEGHPTPRLQWQLQIPGGTVVLVPPVLSGEDDGDGAEDGEEEGDGDGPTQTEAPTPTPAPAWPAPPATP
RFLALTNGSLLVPLLSAKEAGVYTCRAHNELGANSTSVRVAVAAAGPPKHASGAGGDPDGQAPTSERKSTAKSRGNSVLPSKPEGKIKGLGPGQVSFLGETEARPEEEEA
DEGEEAENQVSADRVKEQRCGHGDPSRYVSNHAFNQSAELKPHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAAGAGRPGRRPLRLLYLCPAGGGAAVQWSRVEEG
VNAYWFRGLRPGTNYSVCLALAGEACHVQVVFATKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAADPMEKRIAADFDPRASYLESEKSYP
AGGEAGGEEPEEAPGEGLDEDVEQGDPGGDLQREESLAACSLVESQSKANQDEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG*
9 >lcl|XP_003121642.1|Plus1complement(3920404..3921534) NW_003534012 carbohydrate sulfotransferase 14-like LOC100520059 __SEG__ Chr1 {Sus scrofa} MFPRPLTPLAAPNGAEPLGRALRRVPSGRARAGLGAPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPNREGAVWRETVPRSGGLLLDAGDSDLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLDNVDVRLKMDHRSDLVFLADLRPDEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVRYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCSAPRAVLQDVLPKYILDFSLFAYPLPNVTREACHQ*
10 >lcl|XP_003122907.1|Plus1868348..870270 NW_003534230 leucine-rich repeat-containing protein 4C LRRC4C __SEG__ Chr2 {Sus scrofa} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLVK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
11 >lcl|XP_003124312.1|Plus1complement(377925..379175) NW_003299647 carbohydrate sulfotransferase 12-like LOC100524793 __SEG__ Chr3 {Sus scrofa} MAKSRLLRLWLVLGSVFMVVLIIVYWDNVGAAHFYLHPARPRPPAPEPRPSGGPAPPRLLPARPLETLLLGGRQPGLAGRPAGQPWPRASRKPGPPGNLEESVRGYDWSS
PAAPQSADPDGRQAERRSVLRELCANASFVFPTKERSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSQSLSDRGVPYRDPLDIPREYVHNSSTHLTFNK
FWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLQMYSNHTSPPASVSEAFSAGLRVSFANFIQYLLDPHTEQLAPFNEHWRQVHRL
CHPCQIDYDFVGKLETLDQDAAQLLRLLKVDKLLHFPPSYRNRTASSWEEGWFAQIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
12 >lcl|XP_003128544.1|Plus1complement(142219..143565) NW_003535207 immunoglobulin superfamily containing leucine-rich repeat protein-like isoform 2 LOC100152082 __SEG__ Chr7 {Sus scrofa} MPPAGPQGHVGGMSFSAGVRMQELCLLCWVVLVGLVQACPKPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPSLPEGAFREVLLLQSLWLAHNEIRTVA
AGALAPLGHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFEPLTALSHLQINDNPFDCTCSIMWFKTWALTTAV
SIPEQDNITCTSPHVLKGTRLNRLLPLPCSAPSVQLTYQPSQDGAELQPGFVLALHCDVDGQPAPQLHWHIQTPRGTVEIASPNVGADGRALPGALAASARPRFQAFANG
SLLIPDFGKLEEGTYSCLATNELGSAESSVNVALATPGEGGEDALGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRTGGPEAAATGEGVSAQQPPGLLLLGQSI
LLLVLTFF*
13 >lcl|XP_003130742.1|Plus11013734..1015554 NW_003535691 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2-like LOC100515620 __SEG__ Chr10 {Sus scrofa} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECNADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGIYVCIASNAAGNDTFTASLTVKGFTSDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVAEGEVAGPRRFNMKMI*
14 >lcl|XP_003132124.1|Plus1369399..370178 NW_003535939 leucine-rich repeat-containing protein 3B-like LOC100523139 __SEG__ Chr13 {Sus scrofa} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
15 >lcl|XP_003132649.1|Plus1complement(613888..615597) NW_001885223 platelet glycoprotein V-like LOC100523640 __SEG__ Chr13 {Sus scrofa} MLRSVLLGAALGLLRAQRFPCPPSCVCMFRDAAQCSGSSVARIAALSLPTNLTHLLLFRMGRGALQNHSFSGMTVLQRLMLSDSHVTAIAPGTLNDLIKLKTLRLSRNKI
THLPGALLDKLVLLEQLFLDGNELKSLDQNMFQKLVSLQELFLNQNQFAFLPASLFAHLENLKLLDLSGNNLTHLPKGLFGAQVKLEKLLLHSNQLVSLDSGLLDSLRAL
KELQLDSNHIRSVAPGAFDRLRSLSSLTLARNRLEGLPSALFLHSRSLTFLTLFENPLEELPEVLFGEMGGLQELWLNGTQLLTLPAAVFRNLSGLWVLRVTLSPRLSAL
PEDAFRGLGELRVLALSSNGLASLPAGLLRGLGRLRHVSLRRNRLRTLPRALFHNLSSLAEVQLDHNQLETLPGDMFEGLPQLAEVLLGHNPWRCDCGLRPFLAWLRQHA
ALVGRAEPPLCHGPRPHAGLPLWALPAGDPGCPRLGSPPPRSPALGSSEGPRRPALPAAPPGAAGGLNRSEPWAWHPQGAEGQSPNHSRFWGLYFLLLAVQALITGIIVF
AMIKLCRLFRKLIRECALV*
16 >lcl|XP_003135299.1|Plus150594..51733 NW_003536829 armadillo repeat-containing X-linked protein 3 isoform 1 ARMCX3 __SEG__ ChrX {Sus scrofa} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDVGDCPGARYNDWSDDDDDNSENKGIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTITSRLNSSV
QLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKFQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENIIDNFKWEEDEPTQNQFSE
GSLFFFLKEFQVCADKILGIESHQDFLVKVKVGKFMAKLAEHMFPKSQE*
17 >lcl|XP_003135482.1|Plus1complement(1626237..1628753) NW_003536860 SLIT and NTRK-like protein 4-like LOC100525800 __SEG__ ChrX {Sus scrofa} MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENSYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKGLSTRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPFNAKKLHVNGNSIKDVDISDFAEFEGLDLLHLGSNQIAAIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELRCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPIPAVTFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLANPE
CGSMQLQLRKHEHKSNKKDGLATEAFIPQTIEQMSKSHTCGLKESETGFMFADPPGQKVMMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI*
18 >lcl|XP_003135487.1|Plus168008..70557 NW_003536862 SLIT and NTRK-like protein 2 SLITRK2 __SEG__ ChrX {Sus scrofa} MLSGVWFLSVFTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSSSGSGGDSGQRGSHADTHVQRQSPTLNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGP
IMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLE
VLYPAMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEH
ANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTILSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRS
ANNLDVSSFQLQYGSYNTETQDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYSNLEEKKEEPATLAYTISATELLEKQATPREPELLYQNIAERVKEL
PSAGLVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
19 >lcl|XP_003353994.1|Plus1complement(111772..113283) NW_003534257 ras association domain-containing protein 10-like LOC100625955 __SEG__ Chr2 {Sus scrofa} MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRGRRRGAAGDPPGPAELTEALDEDDEDDDEGLPESMLCGPPQCYCIVEKWRGFERILPNKTRI
LRLWAAWGEEQENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCLARGVPARPSLALTQEKQRRVVRKAFRKLAKLNRRRQQQPSSPCSSTSSSTTSSCSSSPRATESA
SVERMETLVHLVLSQDHTIRQQVQRLRELDREIDRYEAKVHLDRMRRHGVNYVQDTYLVGAGIELDGPGPGEEPEEAAATMATPPLDGEAQAVALEELAQRCDDLLRLQE
QRAQQEELLERLSAEIQEELNQRWMRRRQEELSAREEPPEPDGGVDGELLLEQERVRTQLSTSLYIGLRLNTDLEAVKSDLDYSQQQWDSKERELQGLLQTLHTLELTVA
PDGTPVSGGPSREPGPQACAEVWVDQARGLAKSCPGNDEDSDTGLSSMHSQDSDSVPVCESLV*
20 >lcl|XP_003357919.1|Plus1653874..656768 NW_003535820 LOW QUALITY PROTEIN: SLIT and NTRK-like protein 5 SLITRK5 __SEG__ Chr11 {Sus scrofa} MHTCCPPVTLEQDLHRKMQSWMLQTLAFALTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLESLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYMGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKP
PKGTRQPNKPRVRPTSRQPSKDLGYSNYGPSIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYIALVRRSDFLEATGLDLLHL
GNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPGVVLWPAEPAVPFPSVQSHTRNSAWDFRSCPKPPAAIPE*QPPADHALRRLLRPDPPQAEPEE*PLHLPAGEWSSG
PAEVTHPNRPARQPLGLYLRRRGHEAVGGAAQSGCLGGRGHLQGAQEVC*DGYALH*VRAALPRLL*RGGFHTDALLHPGPGEDQRGDPRRAVEQHRGTSGLGSGWRRVI
GALVRVDPQPAAGVHYVGFCGCRALRASHEAQKEEPERPHQHQQFRRELLQHAVQCVWRRRRRRRGRPPARARAPPRACAAQGEDARRPRVRVHPPSTGPHVQKPHLPLQ
RGQLCGGLQRPARAQGHLQQQPPPAAAAAAAAAAAAAAAAAPAAAPTAAAAAAGGGGEAGKPPLAEPRL*RQHHRAPGGSTVAGAGHRPLLQGHFRTR*TLLHHPRRQ*P
PGIPQIPVQPRCLHFLP*L*PETPPSVFAPGGRGQQAAGTGALQPPQCCLCRTQPERISGVKSKTKR*AGLPRSAGKTDHI*PVL
21 >lcl|XP_003358710.1|Plus1complement(16793..19729) NW_003536031 SLIT and NTRK-like protein 3 isoform 1 SLITRK3 __SEG__ Chr13 {Sus scrofa} MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGN
NALQDIQTGAFNGLKILKRLYLHENKLDVFRNETFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHI
GRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLSSGKENAWPTKPSSMLSSVHFTASSVEYKSSN
KQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPEMLHIAPAGASPAQPRDSHLAEGPTSESPYEFSSPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFDDGGGGGGGSGGAGRPTISSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSVQ
EVGSAECGAPGTQPHGMGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTMNHHHPHPHHPAVGVSGVVAGTGGDLAGFRHHEKNGGVVLFPPGGGCG
GSSMLLDRERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTYRF*
22 >lcl|XP_003360195.1|Plus1199397..201379 NW_003301707 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr18 {Sus scrofa} MKLLWQVTVHHTWNAVLLPVVYLAAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
STAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVTATDTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLR
KRHQQRSTVAAARTVEIIQVDEDLPAAAAAAAAAAASAAATAAPAGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
*