SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor W    

ID / Description / Sequence
1 >lcl|NP_001014295.1|Plus1647948..649087 NW_048044 armadillo repeat containing, X-linked 3 Armcx3 __SEG__ ChrX {Rattus norvegicus} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGPGDVEDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTVTSRLNSSV
QLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLGAHVPSSLGSLFNKKEYKEVILKLLSIFENINDNFKWEENEPAQNHFSE
GSLFFFLKEFQVCADKVLGIESHHDFQVRVKVGKFVTKLTERMFPKSQE*
2 >lcl|NP_001032413.1|Plus1complement(26179410..26181368) NW_047689 leucine rich repeat containing 4 Lrrc4 __SEG__ Chr4 {Rattus norvegicus} MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNAI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEDRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSRVLLIDTGVYTCMVTNVAGNSNASAYLNV
SSAELNTPNFSFFTTVTVETTEISPEDITRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPVPSTDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLR
KRHQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
3 >lcl|NP_001032864.1|Plus1complement(2559516..2560775) NW_047369 carbohydrate sulfotransferase 12 Chst12 __SEG__ Chr12 {Rattus norvegicus} MTKPRLFRLWLALGSALMILLIIVYWDNVGTAHFYLHTSLSRPHILEPLPTQGLAEENVLASDVDEFLDTLLSSDAKHNDLSRRKTEQPPVLTPSKPVLSHMEENVRGYD
WSTHDAQQNPDRDRQQAERRSLLRDFCANASLAFPTKDRSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGSPYRDPLDIPREHVHNTSTHLT
FNKFWRRYGKFSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQV
YRLCHPCQIDYDFVGKLETLDEDAAQLLRSLKVDSQLHFPPSYRNRTASSWEEDWFANIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
4 >lcl|NP_001094467.1|Plus1complement(47014506..>47014712) NW_047625 hypothetical protein LOC678725 LOC678725 __SEG__ Chr2 {Rattus norvegicus} EEEEEEDKEEEEEEEEEEEEEEEEEEEEEEIKTKQNKTKTLNLKIFQTIGNKNKMVNLSRLPSKENCK*
5 >lcl|NP_001099383.1|Plus1complement(3119684..3122173) NW_047369 extracellular leucine-rich repeat and fibronectin type III domain containing 1 Elfn1 __SEG__ Chr12 {Rattus norvegicus} MAGHGWGAPWVLVAAATLLHACGLAQGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGMLRGLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGLTKLSVCEIYSNPFYCSCELLGFLRWLAAFTNATQTHDRVQC
ESPPVYAGYFLLGQGRHGHQRSILSKLQSVCTEGSYTAEVLGPPRPVPGRSQPGHSPPPPPPEPSDMPCADDECFSGDGTTPLVVLTTLVPQTEARPSMKVKQLTQNSAT
IMVQLPSPFNRMYTLEQYNNSKSFTVSKLTQPQEEIRLTNLYTLTNYTYCVVSTSSGTHHNHTCLTICLPKPPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCL
RKRRRQEEKHKKAVAAAAGSLKKTIIELKYGPEIEAPGLAPLTQGPLLGPEAVTRIPYLPAATSDVEQYKLVESGETPKATKGNYIEVRTGEPPERRGCELSRPAPETQS
SVAEISTIAKEVDRVNQIINNCIDALKSESTSFQGAKSGAVSAAEPQLVLLSEPLASKHSFLSPVYKDAFGHGGLQRHHSVEAATGPPRASTSSSGSARSPRTFRAETAG
AHKAPATETKYIEKSSPVPETILTVTPAATVLRAEADKSRQYGEHRHSYPGSHPAEPPAPPPPPPTHEGLGGRKASILEPLTRPRPRDLVYSQLSPQYHNLSYSSSPEYT
CRASPSIWERLRLSRRRHKDDAEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
6 >lcl|NP_001099527.1|Plus1complement(66969509..66972031) NW_047454 SLIT and NTRK-like family, member 6 Slitrk6 __SEG__ Chr15 {Rattus norvegicus} MKLRICLLYPSLLACLSLQSQSPMPPVRGSCDTLCTCEEKDGIMIINCEEKGINTLSQISVPPSRPFHLSLLNNGLTTLHTNDFSGLTNALSIHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEQSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
ACNCELLQLKNWLENMPPQSIIGDVICYSPPLFKGSILSRLKKESICPTPPVYEEHEDPAGSLLAITSSTSDSRLSSKNTSILKQPTKAPGSVPYLTKPSTQLPVPYCPV
PCNCKVLSPSGLLIHCQERNIESVSDLQPPPHNPRKLILAGNIIHTLMKADLMDYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLYKGMFLGLSSLEYLY
LEYNAVKEILPGTFNPMPKLKVLYLNNNLLHVLPAHIFLGIPLTRVNLKTNQFTHLPVSNILDDLDLLIQIDLEDNPWDCSCDLVGLQQWIHKLGKGTVTDDILCASPGH
LDKKELKALNSELLCPGLVNNPSMPTQTSYIIVTSPTMAADAAGTLLSSLTDAVPLSVLILGLLIVFITIVFCAAGIVVFVLHRRRRYKKKKVEEQLRDTSPVHLQYSMY
GHKTTHHTTERPSSSLYEQHMVSPMVHVYRSPSFGPKHLEEVEERSDKEGNDAKHLQRSLLERENHSPLTGSNMKYKVVDQSTDFLPFQDASLLYRNILDKERELQQLGI
TEYLRKNIAQLQPDVEVNYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
7 >lcl|NP_001100220.1|Plus114997202..14999184 NW_047762 fibronectin leucine rich transmembrane protein 2 Flrt2 __SEG__ Chr6 {Rattus norvegicus} MGLQTAKWPSHGTFVLKFWLIMSLGLYSHVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IADGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFANLRKLERLDISNNQLRMLTQGVFDHLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPVFTPAPSTVSPTTQSPTVSVPSPSRGSVPPAPAPSKLPTIPDWDGRERATPPISERIQLSIHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRTVEDTICSEATTHASYLNNGSNTASSHEQTTSHTMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
*
8 >lcl|NP_001100753.1|Plus1complement(65069042..65071132) NW_047454 SLIT and NTRK-like family, member 1 Slitrk1 __SEG__ Chr15 {Rattus norvegicus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKINGQDEHATPGAVPNGGTKIPGNWQLKIKPTPPIATGSA
RNKPPVHGLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRRSHFVDYKNLILLDLGNNNIANIENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYAKISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
9 >lcl|NP_001101153.1|Plus1complement(50061055..50063994) NW_047625 SLIT and NTRK-like family, member 3 Slitrk3 __SEG__ Chr2 {Rattus norvegicus} MKPTITEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGN
NALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHI
GRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSSN
KQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRTPENLTHRDVRTIELEVLCPEMLHIAQPGPSPPQSGDYHPNGGPTSASPYDFSPPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDSGGSGGGSGSGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAASAAQ
DTGATDRGGPGTQPPGMGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSNSQLNTIVTVNHHHPHPHHSAVGGVSGVGGGTGGDLAGFRHHEKNGGVVLFPPGGGC
GGGSLLLERERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTPKSDYLDLRAKLQTKPDYLEVLEKTAYRF*
10 >lcl|NP_001101223.1|Plus123812228..23814150 NW_047657 leucine rich repeat containing 4C Lrrc4c __SEG__ Chr3 {Rattus norvegicus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
11 >lcl|NP_001101396.1|Plus1complement(26790058..26791878) NW_047711 hypothetical protein LOC313156 RGD1310773 __SEG__ Chr5 {Rattus norvegicus} MLHTAIPCWQPFLGLAMVLLFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSINPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLGYISHRALQWTI*LGAAHPGEVQLDSGTNRSPFPSPQPHHPASEASQYQQYACVC
L*KIIPPETTRDRLLAIAGYDASQ*PLWSQPHIPLDH*HQPVHCPFPRL*TPCIPDPP*PLLQSHQHY*SRHVL*PDPPTGASCSRGPAPHH*TSLLPRAPLPPRAQCIS
EPAGNIGRECLLFP*GFGGPEH*Q*PTSVRLPTSLAPAATGHPAVWRPAAHVCRARHHT*EVI*GFP*HCSFFLFYLQKTQNP*KEVTAPPSGRRTDGPAGVQRGWRPPA
RDFLGDTSKAFYHHQVQRKGHCVG*WHLRNPFRPGSRQWDVCLHS*QCCWE*HLHGISHCEGIHFRPLPLRKQDPYVHD*LQ*HRFQRH*CQYFFPGP*NNTGIYSHGLF
HIPGSGFILFSPSFCVEPRKGQTQKQH*P*VCAPKKQWCCCRRGGGWTQEVQHENDI
12 >lcl|NP_001102630.1|Plus1complement(18295351..18297375) NW_047563 fibronectin leucine rich transmembrane protein 1 Flrt1 __SEG__ Chr1 {Rattus norvegicus} MVVAHPAATATTTPAATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPSDIPDDATTLYLQNNQINNAGIPQDLKTKVKVQV
IYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKG
LNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPW
FCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFEAGSQGSAANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLV
IQVKPLTADSIRITWKAMLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETGNTYVADETPVCAKAETADSYGPTTTLNQEQNAGPMAG
LPLAGIIGGAVALVFLFLVLGAICWYVHRAGELLTRERVYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRSKEEYVVHTIFPSNGSSLCKGAHTIGYGTTRG
YREGGIPDVDYSYT*
13 >lcl|NP_001103079.1|Plus110387301..10389070 NW_047773 leucine rich repeat and Ig domain containing 3 Lingo3 __SEG__ Chr7 {Rattus norvegicus} MTCWLHMLGLHLLLLPTAPLATGCPARCECSASTRTVACGRRRLTAVPEGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIAHVEPGAFANLPRLRVLRLRG
NQLKLIPPGVFTHLDSLTLLDLSENKLVILLDFSFQDLRSLQRLEVGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRHLAIAALEDQNFQKL
PGLLHLEIDNWPLLEEVAPGSLRGLNLTSLSITHTNITAVPAAALRQQAHLTCLNLSHNPISMVPRGSFRDLVRLRELHLAGALLAVIEPQAFVGLRQIRLLNLSDNLLS
TLEENTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGRLPACATPAEVRGDALHNLPDSVLFEYFVCRKPKIRERRLQHVTATEGDDVRFLCRAEGEPAPTVAW
VTPQHHSVTAASRGRARVLPGGTLAITDTRPQDSGTYTCVASNAGGNDTYFATLTIHPAANRTQSDGHNETQVGVRFPLDLTTILVSTAMGCITFLGVVLFCFLLLFVWS
RGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI*
14 >lcl|NP_001103109.1|Plus146840909..46842036 NW_047657 dermatan 4 sulfotransferase 1 Chst14 __SEG__ Chr3 {Rattus norvegicus} MFPRPLTPLAAPKSAKTLARTPKRAPLGRARAGIGGPPLLLPSMLMFAVIVASSGLLLMIERGILSEMKPLPLHPPSHKGAAWSGTDPKPRGLSFDAEDSDLQVREDIRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLNNVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPEHMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPSHVRFPARQAWYRP
ASPESLHYHLCNAPRALLQDVLPKYILDFSLFAYPLPNVTKEACR*
15 >lcl|NP_001119763.1|Plus1complement(19100521..19102470) NW_047658 fibronectin leucine rich transmembrane protein 3 precursor Flrt3 __SEG__ Chr3 {Rattus norvegicus} MISPAWSLFLIGTKIGLFFQVAPLSVMAKSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKV
FFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVR
GLMCQAPEKVRGMAIKDLSAELFDCKDSGIVSTVQITTAIPNTAYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPSRKTILITVKSVTPDTIHISWRLALPMTALRLSW
LKLGHSPAFGSITETIVTGERSEYLVTALEPESPYRVCMVPMETSNLYLFDETPVCIETQTAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVSIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNLSESSSNRSYRDSGIPDLDHSHS*
16 >lcl|NP_036927.1|Plus125737972..25739675 NW_047356 platelet glycoprotein V precursor Gp5 __SEG__ Chr11 {Rattus norvegicus} MLRSVLLSAVLSLVGAQPFPCPKTCKCVVRDAVQCSGGSVAHIAELGLPTNLTHILLFRMDRGVLQSHSFSGMTVLQRLMLSDSHISAIDPGTFNDLVKLKTLRLTRNKI
SHLPRAILDKMVLLEQLFLDHNALRDLDQNLFQKLLNLRDLCLNQNQLSFLPANLFSSLGKLKVLDLSRNNLTHLPQGLLGAQIKLEKLLLYSNRLMSLDSGLLANLGAL
TELRLERNHLRSIAPGAFDSLGNLSTLTLSGNLLESLPPALFLHVSCVTRLTLFENPLEELPEVLFGEMAGLRELWLNGTHLRTLPAAAFRNLSGLQTLGLTRNPLLSAL
PRGMFHGLTELRVLALHTNALEELPEDALRGLGRLRQVSLRHNRLRALPRTLFRNLSSLVTVQLEHNQLKTLPGDVFAALPQLTRVLLGHNPWLCDCGLWPFLQWLRHHL
ELLGRDEPPQCNGPESRASLTFWELLQGDQWCPDPRGLPPDPPTENALKAPDPTQRPNSSQSWAWVQLVARGESPDNRFYWNLYILLLIAQATIAGFIVFAMIKIGQLFR
TLIREELLFEAMGKSSN*
17 >lcl|NP_113995.1|Plus17354515..7355795 NW_047800 trophoblast glycoprotein precursor Tpbg __SEG__ Chr8 {Rattus norvegicus} MPGAGSRGPSAGDGRLRLARLALVLLGWVSASAPSSSLPSSSTSPAAFLASGSAQPPPAERCPAACECSEAARTVKCVNRNLLEVPADLPPYVRNLFLTGNQMTVLPAGA
FARQPPLADLAVLNLSGNHLKEVGAGAFEHLPGLRRLDLSHNPLTNLSAFTFAGSNVSVSTPSPLLELILNHIVPPEDQRQNGSFEGMVAFEGMVAAALRSGLALRGLHH
LELASNHFLYLPRDLLDQLPSLKHLDLRNNSLVSLTYASFRNLTHLESLHLEDNALKVLHNSTLAEWQGLAHVRVFLDNNPWVCDCYMADMVSWLKETEVVPDKARLTCA
FPEKMRNRGLLDLTSSDLDCDATLPQSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
18 >lcl|NP_663712.1|Plus13227112..3227885 NW_047598 leucine rich repeat containing 3 precursor Lrrc3 __SEG__ Chr20 {Rattus norvegicus} MGPRGRQSPSSPLAPSQGSCFFILFCLRLGASCPQSCQCPDHAGAVAVHCSSRGLQEIPRDIPANTVLLKLDANRISRVPNGAFQHLPQLRELDLSHNAIEAIGPAAFSG
LAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSAQEQFVGKPLIQVLDSGASFCSTHRKTTDVAMLVTMFGWFTMVIA
YVVYYVRHNQEDARRHLEYLKSLPSAPVSKEPLSPVP*
19 >lcl|XP_220923.1|Plus1212028..212795 NW_047339 leucine rich repeat containing 3-like RGD1563281 __SEG__ Chr10 {Rattus norvegicus} MLLLAPRLLPLLLVIGTGRSVSSPQTLPQGCYIAEEAGEQTFRCSRAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPALEELDLSHNVLVHLSGAAFQGLEATLR
HLDLSANQLASVPVAAFVGLQIQVNLSANPWRCDCALQEVLRHVRLAPGSGTGIVCGPEARPDLVGHEFLLLTGEEELCGTGRGGTRRSTDVALLVTMGGWLTLVVAYLI
HYVWQNRDETRHPVKRAPPVQPVRSEDSSTLSTVL*