SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus W    

ID / Description / Sequence
1 >lcl|NP_001001999.1|Plus1complement(866955..867599) NT_039630 platelet glycoprotein Ib beta chain isoform 1 Gp1bb __SEG__ Chr16 {Mus musculus} MLPPHPSASLSGPRGALSLLLLLLALLSRPASGCPAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRA
WLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS*
2 >lcl|NP_001001999.1|Plus1complement(866955..867599) NT_039630 platelet glycoprotein Ib beta chain isoform 1 Gp1bb __SEG__ Chr16 {Mus musculus} MLPPHPSASLSGPRGALSLLLLLLALLSRPASGCPAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRA
WLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS*
3 >lcl|NP_001013780.2|Plus1complement(22628457..22630226) NT_039500 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 precursor Lingo3 __SEG__ Chr10 {Mus musculus} MTCWLHMLGLHLLLLPTAPLAAGCPARCECSASTRTVACGRRRLTAIPEGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIAHVEPGAFANLPRLRVLRLRG
NQLKLIPPGVFTHLDSLTLLDLSENKLVILLDFSFQDLRSLQRLEVGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRHLAIAALEDQNFQKL
PGLSHLEIDNWPLLEEVAPGSLRGLNLTSLSITHTNITAVPAAALRQQAHLTCLNLSHNPISMVPRGSFRDLVRLRELHLAGALLAVIEPQAFVGLRQIRLLNLSDNLLS
TLEENTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGRLPACATPAEVRGDALHNLPDSVLFEYFVCRKPKIRERRLQHVTATEGDDVRFLCRAEGEPAPTVAW
VTPQHHSVTAASRGRARVLPGGTLTIADTRPQDSGTYTCVASNAGGNDTYFATLTVQPAANRTQGDGHNETQVGVRFPLDLTTILVSTAMGCITFLGVVLFCFLLLFVWS
RGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI*
4 >lcl|NP_033404.1|Plus1complement(89273251..89274984) NT_039207 thrombomodulin precursor Thbd __SEG__ Chr2 {Mus musculus} MLGIFFLGVLAPASLGLSALAKLQPTGSQCVEHECFALFQGPATFLDASQACQRLQGHLMTVRSSVAADVISLLLSQSSMDLGPWIGLQLPQGCDDPVHLGPLRGFQWVT
GDNHTSYSRWARPNDQTAPLCGPLCVTVSTATEAAPGEPAWEEKPCETETQGFLCEFYFTASCRPLTVNTRDPEAAHISSTYNTPFGVSGADFQTLPVGSSAAVEPLGLE
LVCRAPPGTSEGHWAWEATGAWNCSVENGGCEYLCNRSTNEPRCLCPRDMDLQADGRSCARPVVQSCNELCEHFCVSNAEVPGSYSCMCETGYQLAADGHRCEDVDDCKQ
GPNPCPQLCVNTKGGFECFCYDGYELVDGECVELLDPCFGSNCEFQCQPVSPTDYRCICAPGFAPKPDEPHKCEMFCNETSCPADCDPNSPTVCECPEGFILDEGSVCTD
IDECSQGECFTSECRNFPGSYECICGPDTALAGQISKDCDPIPVREDTKEEEGSGEPPVSPTPGSPTGPPSARPVHSGVLIGISIASLSLVVALLALLCHLRKKQGAARA
ELEYKCASSAKEVVLQHVRTDRTLQKF*
5 >lcl|NP_035757.2|Plus15409417..5410697 NT_039476 trophoblast glycoprotein precursor Tpbg __SEG__ Chr9 {Mus musculus} MPGAGSRGPSAGDGRLRLARLALVLLGWVSASAPSSSVPSSSTSPAAFLASGSAQPPPAERCPAACECSEAARTVKCVNRNLLEVPADLPPYVRNLFLTGNQMTVLPAGA
FARQPPLADLEALNLSGNHLKEVCAGAFEHLPGLRRLDLSHNPLTNLSAFAFAGSNASVSAPSPLEELILNHIVPPEDQRQNGSFEGMVAFEGMVAAALRSGLALRGLTR
LELASNHFLFLPRDLLAQLPSLRYLDLRNNSLVSLTYASFRNLTHLESLHLEDNALKVLHNSTLAEWHGLAHVKVFLDNNPWVCDCYMADMVAWLKETEVVPDKARLTCA
FPEKMRNRGLLDLNSSDLDCDAVLPQSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
6 >lcl|NP_036173.1|Plus1complement(4425327..4426613) NT_039474 immunoglobulin superfamily containing leucine-rich repeat protein precursor Islr __SEG__ Chr9 {Mus musculus} MRALCLLCWAVLLNLVRACPEPCDCGEKYGFQIADCAYRDLEGVPPGFPANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLL
SEFAWSDLHNLSALQLLKMDSNELAFIPRDAFSSLSALRSLQLNHNRLHALAEGTFAPLTALSHLQINDNPFDCTCGIVWFKTWALASAVSIPEQDNIACTTPHVLKGIP
LGRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPVPQLHWHIHTPGGTVEIASPNVGTDGRALPGALATSGQPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDAVGHKFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGPPEAAIAADGRPAQQFSGILLLGQSLLVLSFFYF*
7 >lcl|NP_061232.1|Plus140041961..40042494 NT_039353 platelet glycoprotein IX precursor Gp9 __SEG__ Chr6 {Mus musculus} MTTWGLLFLLWPATTDTQACPRPCTCQSLETMGLKVNCEGQGLTALPVIPAHTRQLLLANNSLRSVPPGAFDHLPQLWDLDVTHNPWHCDCSLTYLRLWLEDHMPEALMH
VYCASPDLATRRPLGQLTGYELGSCGWKLPPSWAYPGVWWDVSLVAVAVLGLILLAGLLNTFTESRN*
8 >lcl|NP_067503.3|Plus11840694..1841953 NT_039316 carbohydrate sulfotransferase 12 Chst12 __SEG__ Chr5 {Mus musculus} MTKPRLFRLWLVLGSALMILLIIVYWDNVGTAHFYLHTSLSRPHILEPLPTQGLVEENVFTSDVDEFLDTLLSSDAKHNDLSRRKTEQPPVPAPSKPVLSHMEENVRGYD
WSTHDAHQNPDRDRQQAERRSLLRDFCANASLAFPTKDRSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGSPYRDPLDIPREHVHNTSTHLT
FNKFWRRYGKFSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQV
YRLCHPCQIDYDFVGKLETLDEDAAQLLRFLKVDSQLHFPPSYRNRTASSWEEDWFANIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
9 >lcl|NP_082146.2|Plus18856690..8857829 NT_039716 armadillo repeat-containing X-linked protein 3 Armcx3 __SEG__ ChrX {Mus musculus} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSV
QLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSE
GSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGKFVAKLTERMFPKSQE*
10 >lcl|NP_082393.3|Plus159793690..59794820 NT_039207 carbohydrate sulfotransferase 14 Chst14 __SEG__ Chr2 {Mus musculus} MFPRPLTPLAAPKSAETLGRTPRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILSEMKPLPLHPPSHKGAAWSGTDPKPRGLSLDAGDSDLQVREDIRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGILNNVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPEHMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCNVPRALLQDVLPKYILDFSLFAYPLPNVTKEACHQ*
11 >lcl|NP_473383.1|Plus12068126..2070423 NT_082868 endosialin precursor Cd248 __SEG__ Chr19 {Mus musculus} MLLRLLLAWVAAVPALGQVPWTPEPRAACGPSSCYALFPRRRTFLEAWRACRELGGNLATPRTPEEAQRVDSLVGVGPANGLLWIGLQRQARQCQPQRPLRGFIWTTGDQ
DTAFTNWAQPATEGPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALPLEVGQAGPAVYTTPFNLVSSEFEWLPFGSVAAVQCQAGRGASLLCVKQPSGG
VGWSQTGPLCPGTGCGPDNGGCEHECVEEVDGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYV
GGFECYCSEGHELEADGISCSPAGAMGAQASQDLRDELLDDGEEGEDEEEPWEDFDGTWTEEQGILWLAPTHPPDFGLPYRPNFPQDGEPQRLHLEPTWPPPLSAPRGPY
HSSVVSATRPMVISATRPTLPSAHKTSVISATRPPLSPVHPPAMAPATPPAVFSEHQIPKIKANYPDLPFGHKPGITSATHPARSPPYQPPIISTNYPQVFPPHQAPMSP
DTHTITYLPPVPPHLDPGDTTSKAHQHPLLPDAPGIRTQAPQLSVSALQPPLPTNSRSSVHETPVPAANQPPAFPSSPLPPQRPTNQTSSISPTHSYSRAPLVPREGVPS
PKSVPQLPSVPSTAAPTALAESGLAGQSQRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGSHAPNKRITDCYRWVTHAGNKSSTEPMPPRGSLTGVQTCRTSV*
12 >lcl|NP_619623.2|Plus1complement(25779656..25781614) NT_039340 leucine-rich repeat-containing protein 4 precursor Lrrc4 __SEG__ Chr6 {Mus musculus} MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PMHMRGRYLVEVDQAAFQCSAPFIMDAPRDLNISEDRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSRVLLIDTGVYTCMVTNVAGNSNASAYLNV
SSAELNTPNFSFFTTVTVETTEISPEDITRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPVPSTDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLR
KRHQQRSTVTAARTVEIIQVDEDIPAAAPAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
13 >lcl|NP_660134.1|Plus1complement(19694959..19695732) NT_039500 leucine-rich repeat-containing protein 3 precursor Lrrc3 __SEG__ Chr10 {Mus musculus} MGPRGRQSPSATLAPSQGSCFFILFCLRLGASCPQACQCPDHAGAVAVHCSSRGLQEIPRDIPADTVLLKLDANRISRVPNGAFQHLPQLRELDLSHNAIEAIGPAAFSG
LAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSAQEQFVGKPLIQVLDSGASFCSTHRKTTDVAMLVTMFGWFTMVIA
YVVYYVRHNQEDARRHLEYLKSLPSAPVSKEPLSPVP*
14 >lcl|NP_666164.1|Plus1complement(13190339..13191118) NT_039595 leucine-rich repeat-containing protein 3B precursor Lrrc3b __SEG__ Chr14 {Mus musculus} MNLVDLWLSRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
15 >lcl|NP_780488.2|Plus130697875..30699401 NT_039433 ras association domain-containing protein 10 Rassf10 __SEG__ Chr7 {Mus musculus} MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRCRQRRGQRRGLTEDPSGQLELPEPPDENDEDDDDAMPPGMLCGPPQCYCIVEKWRGFERILPNKTRI
LRLWTAWGDEQENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCLARGAPARPSLALTQEKQRRVVRKAFRKLAKLNRRRQQQPSSPCSSTSSSTASSCSSSARTHESA
SVERMETLVHLVLSQDHTIRQQVQRLRELDREIDRYEAKVHLDRMRRHGVNYVQDTYLVGAGIDLDGQTPEGEPEDATLEEKGTEPAAPLDSEAQAAALEELARRCDDLV
RLQEERAQQEELLERLSAEIQEELNQRWMQRRNEELAAREESLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLSTDLEAVKADLDYSQQQRDIKERELQGLLQSLHTFE
QTVVHDGALGSSGPSREPQPQTCAEMWVDQARGLAKSCPGNDEDSDTGLSSMHSQDSDSVPPVCESLV*
16 >lcl|NP_780708.1|Plus1complement(83584017..83586539) NT_039606 SLIT and NTRK-like protein 6 precursor Slitrk6 __SEG__ Chr14 {Mus musculus} MKLWTYLLYPSLLACLSLQSQSPMPSVRGSCDTLCNCEEKDGIMIINCEEKGINKLSQISVPPSRPFHLSLLNNGLTMLHTNDFSGLTNALSIHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITIIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
ACNCELLQLKNWLENMPPQSIIGDVICYSPPPFKGSVLSRLKKESFCPTPPVYEEHEDPSGSLLAITSSTSDSRLSSKNTSILKQPTKAPGLIPYLTKPSTQLPVPYCPI
PCNCKVLSPSGLLIHCQERNIESLSDLQPPPHNPRKLILAGNIIHTLMKSDLTDYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLNKGMFLGLHSLEYLY
LEYNAVKEILPGTFNPMPKLKVLYLNNNLLQVLPAHIFLGIPLTRVNLKTNQFTHLPVSNILDDLDFLIQIDLEDNPWDCSCDLVGLQQWIHKLGKGTMTDDILCTSPGH
LDKKELKALNSDLLCPGLVNNPSMPTQTTYVIVTSPTVAADTASTLFSSLTDAVPLSVLILGLLIVFITIVFCAAGIVVFVLHRRRRYKKKKVEEQLRDNSPVHLQYSMY
GHKTTHHTTERPSSSLYEQHMVSPMVHVYRSPSFGPKHLEEVEERNDKEGNDAKHLQRSLLERENHSPLTGSNMKYKTTDQSTDFISFQDASLLYRNILEKERELQQLGI
TEYLRKNLAQLQPEVEVNYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
17 >lcl|NP_780725.2|Plus1complement(4105706..4107526) NT_166289 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 precursor Lingo2 __SEG__ Chr4 {Mus musculus} MLHTAIPCWQPFLGLAVVLLLMGSTIGCPARCECSAQNKSVSCHRRRLLAIPEGIPIETKILDLSKNRLKSINPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYA
FKRLFHLKNLEIDYWPLLDLMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWLLQRQPNLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECNADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFTSDRFLYANRTPMYMTDSNDTVSNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
18 >lcl|NP_780731.1|Plus11288317..1290803 NT_039316 extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1 precursor Elfn1 __SEG__ Chr5 {Mus musculus} MAGHGWGTAWVLVAAATLLHAGGLAQGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGMLRGLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGLTKLSVCEIYSNPFYCSCELLGFLRWLAAFTNATQTHDRVQC
ESPPVYAGYFLLGQGRHGHQRSILSKLQSVCTEGSYTAEVLGPPRPVPGRSQPGHSPPPPPPEPSDMPCADDECFSGDGTTPLVILTTLVPQTEARPSMKVKQLTQNSAT
IMVQLPSPFNRMYTLEQYNNSKSFTVSKLTQPQEEIRLTNLYTLTNYTYCVVSTSSGTHHNHTCLTICLPKPPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCL
RKRRRQEEKHKKAVAAAAGSLKKTIIELKYGPEIEAPGLAPLTQGPLLGPEAVTRIPYLPAATSDVEQYKLVESSETPKATKGNYIEVRTGEPQERRGCELSRPGEPQSS
VAEISTIAKEVDRVNQIINNCIDALKSESTSFQGAKSGAVSAAEPQLVLLSEPLASKHSFLSPVYKDAFGHGGLQRHHSVEAAPGPPRASTSSSGSARSPRTFRAEATGT
HKAPATETKYIEKSSPVPETILTVTPAATVLRAEADKSRQYGEHRHSYPGSHPAEPPAPPPPPPTHEGLGGRKASILEPLTRPRPRDLVYSQLSPQYHNLSYSSSPEYTC
RASPSIWERLRLSRRRHKDDAEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
19 >lcl|NP_796167.2|Plus1complement(4466129..4468366) NT_039474 immunoglobulin superfamily containing leucine-rich repeat protein 2 isoform b Islr2 __SEG__ Chr9 {Mus musculus} MGPFGALCLAWALLGVVRACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFVNVTQVTSLWLAHSEVRTVESGALAVLSQLKNLDLSHNL
ISNFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLEPGTFDALSALSHLQLYHNPFHCSCGLVWLQAWAASTRVSLPEPDSIACASPPELQGV
PVHRLPALPCAPPSVRLSAEPPPEAPGTPLRAGLAFMLHCVAEGHPTPRLQWQLQIPGGTVVLVPPVLSKEEDGGDKVEDGEGDGDEDLPTQTEAPTPTPAPAWPAPPAT
PRFLALANGSLLVPLLSAKEAGIYTCRAHNELGTNSTSLRVTVAAAGPPKHAPGTGEEPDAQVPTSERKATTKGRSNSVLPFKPEGKTKGQGLARVSVLGEIEAELEETD
EGEQMEGQIPADPMGEKHCGHGDPSRYVSNHAFNQSSDLKPHVFELGVIALDVAEREARVQLTPLAARWGPGPDGASGARRPGRRPLRLLYLCPAGGGTAVQWSRVEEGV
NAYWFRGLRPGTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVTVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPA
RGEAGGEEPEEVPEEGLDEDVEQGDPSGDLQREESLAGCSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG*
20 >lcl|NP_835215.1|Plus1complement(58361415..58362974) NT_039621 amphoterin-induced protein 2 precursor Amigo2 __SEG__ Chr15 {Mus musculus} MSLRFHTLPTLPRAVKPGCRELLCLLVIAVMVSPSASGMCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDADWIPVSFVKLSTLILRHNNITSISTG
SFSTTPNLKCLDLSSNRLKSVKSATFQELKALEVLLLYNNHISYLDPAAFGGLSHLQKLYLSGNFLTQFPMDLYTGRFKLADLTFLDVSYNRIPSIPMHHINLVPGRQLR
GIYLHGNPFVCDCSLYSLLIFWYRRHFSSVMDFKNDYTCRLWSDSRHSHQLQLLQESFLNCSYSVINGSFHALGFIHEAQVGERAIVHCDSKTGNGNTDFIWVGPDNRLL
EPDKDMGNFRVFYNGSLVIENPGFEDAGVYSCIAMNRQRLLNETVDIMINVSNFTINRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCKAKRQKNTLSQSSAH
SSILSPGPTGDASADDRKAGKRVVFLEPLKDTAAGQNGKVKLFPSETVIAEGILKSTRAKSDSDSVNSVFSDTPFVAST*
21 >lcl|NP_848469.1|Plus1complement(81526795..81528744) NT_039207 fibronectin leucine rich transmembrane protein 3 Flrt3 __SEG__ Chr2 {Mus musculus} MISPAWSLFLIGTKIGLFFQVAPLSVVAKSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKV
FFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVR
GLMCQAPEKVRGMAIKDLSAELFDCKDSGIVSTIQITTAIPNTAYPAQGQWPAPVTKQPDIKNPKLIKDQRTTGSPSRKTILITVKSVTPDTIHISWRLALPMTALRLSW
LKLGHSPAFGSITETIVTGERSEYLVTALEPESPYRVCMVPMETSNLYLFDETPVCIETQTAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVSIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNLSESSSNRSYRDSGIPDSDHSHS*
22 >lcl|NP_848840.3|Plus138510490..38512412 NT_039207 leucine-rich repeat-containing protein 4C precursor Lrrc4c __SEG__ Chr2 {Mus musculus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
23 >lcl|NP_848855.2|Plus1complement(9107828..9110341) NT_039706 SLIT and NTRK-like protein 4 precursor Slitrk4 __SEG__ ChrX {Mus musculus} MFLWLFLIVSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFVNFSHAVSLHLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQQENGFTTPNGHTTQTTLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIV
SYQTRVPPLTPCPVPCFCKTHPSDLGLSVNCQEKNIQSMSELTPKPLNAKKLHVNGNNIKDVDISDFTEFEGLDLLHLGSNQITLIKGEVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSATFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNSE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVMMRNAADKDKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQQDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI*
24 >lcl|NP_851419.1|Plus1complement(2887850..2889694) NT_039474 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 precursor Lingo1 __SEG__ Chr9 {Mus musculus} MLAGGMRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFN
NLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLN
INAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIGTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNY
LRVLNVSGNQLTTLEESAFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRAHIRDRKAQQVFVDEGHTVQFVC
RADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKT
LIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMI*
25 >lcl|NP_942563.2|Plus111491187..11493727 NT_039706 SLIT and NTRK-like protein 2 precursor Slitrk2 __SEG__ ChrX {Mus musculus} MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRPGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISTIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSASGDSSQRSSHSDTHVQRLTPTTNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMV
YQTKSPVALTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLY
PSMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANS
PVIINEVTCESPAKHAGEILKFLGREAICPENPNLSDGTILSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPNVPRNATN
LDVSSFQLQYGSYNTETNDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQDFSYGNLEEKKEEPATLAYTISATELLEKQATPREPELLYQNIAERVKELPSA
GLVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
26 >lcl|NP_942564.2|Plus1complement(22234770..22237712) NT_039240 SLIT and NTRK-like protein 3 precursor Slitrk3 __SEG__ Chr3 {Mus musculus} MMKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRRLYTNSFLHLNNAVSINLG
NNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDH
IGRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSS
NKQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHL
GNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLE
HLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRTPENLTHRDVRTIELEVLCPEMLHIAQPGPSPPQPGDYHPNGGPTSASPYEFSPPGGPVPLSVLILS
LLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDSGGNSGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAASAA
QDTGATDRGGPGTQPTGMAEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSNSQLNTIVTVNHHHPHPHHSAVGGVSGVGGGTGGDLAGFRHHEKNGGVVLFPPGGG
CGGGSLLLDRERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTPKSDYLDLRAKLQTKPDYLEVLEKTAYRF*
27 >lcl|NP_951020.1|Plus1complement(81745448..81747538) NT_039606 SLIT and NTRK-like protein 1 precursor Slitrk1 __SEG__ Chr14 {Mus musculus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQDEHATPGAVPNGGTKIPGNWQLKIKPTPPIATGSA
RNKPPVHGLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIANIENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNEEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGSHRVYDCGSHSLSD*
28 >lcl|NP_958813.1|Plus1complement(281541..283565) NT_039687 fibronectin leucine rich transmembrane protein 1 Flrt1 __SEG__ Chr19 {Mus musculus} MVVAHSAATATTTPAATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPSDIPDDATTLYLQNNQINNAGIPQDLKTKVKVQV
IYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKG
LNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPW
FCGCNLMWLRDWVRARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFEAGSQGGAANAAAKTTVSNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLV
IQVKPLTADSIRITWKAMLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETGNTYVADETPVCAKAETADSYGPTTTLNQEQNAGPMAG
LPLAGIIGGAVALVFLFLVLGAICWYVHRAGELLTRERVYNRGSRRKDDYMESGTKKDNSILEIRGPGLQMLPINPYRSKEEYVVHTIFPSNGSSLCKGAHTIGYGTTRG
YREAGIPDVDYSYT*
29 >lcl|NP_958926.1|Plus17970207..7972189 NT_166318 fibronectin leucine rich transmembrane protein 2 Flrt2 __SEG__ Chr12 {Mus musculus} MGLQTTKWPGRGAFILKFWLIISLGLYLQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFANLRKLERLDISNNQLRMLTQGVFDHLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPVFTPAPSTVSPTTQSPTLSVPSPSRGSVPPAPTPSKLPTIPDWDGRERVTPPISERIQLSIHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRTVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
*