SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul W    

ID / Description / Sequence
1 >lcl|NP_001135785.1|Plus1complement(2030757..2031290) NW_001096632 glycoprotein IX (platelet) precursor GP9 __SEG__ Chr11 {Macaca mulatta} MPAWEALFLLWATAEATKDCPIPCTCRALETMGLWVDCRGRGLTALPTLPARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQ
VRCASPSLAAHGPLGQLTGYQLGSCGWQLQASWVRSGVLWDVALVAVAALGLALLAGLLCATTEALD*
2 >lcl|XP_001082914.1|Plus11148611..1149873 NW_001116512 trophoblast glycoprotein-like isoform 3 LOC693944 __SEG__ Chr4 {Macaca mulatta} MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAASAQPPLPDQCPALCECSEAARTVKCVNRNLTEVPTDLPLYVRNLFLTGNQLAVLPAGA
FARRPPLAELAALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLAYLSPFAFSGSNASISAPSPLVELILNHIVPPDDKRQNRSFEGMVAAALVAGRALQGLHLLELASN
HFLYLPRDVLAQLPSLRYLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHVRVFLDNNPWVCDCHMADMVTWLKQTEVVQGKDRLTCAFPEKMR
NRVLLELNSADLDCDPILPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
3 >lcl|XP_001085829.1|Plus1118316..120802 NW_001114183 extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1-like ELFN1 __SEG__ Chr3 {Macaca mulatta} MAGCGWGALWVCVAAATLLHAGGLARGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGMLRGLGKLEYLYLQANLIEVVMASSFWECPNIVNIDLSMNRIQQLNSGTFAGLAKLSVCELYSNPFYCSCELLGFLRWLAAFTNATQTYDRMQC
ESPPVYSGYYLLGQGRRGHRSILSKLQSVCTEDSYAAEVVGPPRPAPGRSQPGRSPPPPPPPEPSDTPCADDECFSGDGTTPLVALPTLATQAEARPLIKVKQLTQNSAT
ITVQLPSPFHRMYTLEHFNNSKASTVSRLTKAQEEIRLTNLFTLTNYTYCVVSTSAGLRHNHTCLTICLPRLPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCL
RRRRRQEEKHKKAASAAAAGSLKKTIIELKYGPELEAPGLAPLSQGPLLGPEAVTRIPYLPVAGEVEQYKLVESADTPKASKGSYMEVRTGDPPERRDCELGRPGPDSQS
SVAEISTIAKEVDKVNQIINNCIDALKSESTSFQGVKSGPVSAAEPPLVLLSEPLAAKHGFLAPGYKDAFGHSLQRHHSVEAAGPPRASASSGSSARSPRAFRAEAVGVH
KAAAAEAKYIEKGSPAADAILTVTPAAAVLRAEAEKGRQYGEHRHSYPGSHPAEPPAPPGPPPPPAHEGLGRKASILEPLTRPRPRDLAYSQLSPQYHSLSYSSSPEYTC
RASQSIWERFRLSRRRHKEEEEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
4 >lcl|XP_001086080.1|Plus1complement(1344474..1346987) NW_001218196 SLIT and NTRK-like family, member 4 isoform 1 SLITRK4 __SEG__ ChrX {Macaca mulatta} MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDMSDFTDFEGLDLLHLGSNQITVIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLS
DGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQPDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI*
5 >lcl|XP_001087022.1|Plus13577773..3580310 NW_001218196 SLIT and NTRK-like protein 2-like SLITRK2 __SEG__ ChrX {Macaca mulatta} MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSASDSSQRGSHADTHVQRLSPTMNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLYP
SMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTILSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRNTNNL
DVSSFQLQYGSYNTETHDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYSNLEEKKEEPATPAYTISATELLEKQATPREPELLYQNIAERVKELPSTG
LVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQAKPQSEPDYLEVLEKQTAISQL*
6 >lcl|XP_001090221.1|Plus1complement(8665331..8667292) NW_001114282 leucine-rich repeat-containing protein 4-like isoform 1 LRRC4 __SEG__ Chr3 {Macaca mulatta} MKLLWQVTVHHHTWNAILLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNS
IRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGL
EELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCH
APMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLN
VSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKL
RKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
7 >lcl|XP_001093240.1|Plus1complement(13947402..13949492) NW_001104501 SLIT and NTRK-like family, member 1 isoform 1 SLITRK1 __SEG__ Chr17 {Macaca mulatta} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSA
RNKPLANSLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLIFPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
8 >lcl|XP_001093404.2|Plus117608979..17611855 NW_001104501 SLIT and NTRK-like protein 5-like isoform 1 SLITRK5 __SEG__ Chr17 {Macaca mulatta} MHTCCPPVTLEQDLHRKMHSWMLQTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRRLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKP
PKGTRQPNKPRVRPTSRQPSKDLGYSNYGPSIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYIAVVRRTDFLEATGLDLLHL
GNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQAMPSGVFSGLTLLRLNLRSNHFTSLPVSGVLD
QLKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRLNSTGAPAGLGAGGGASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGGGGAGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREG
NSVEDYKDLHELKVTYSSNHHLQQQQQPPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKF
PCSPAAYTFSPNYDLRRPHQYLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF*
9 >lcl|XP_001093456.1|Plus1complement(15831780..15834305) NW_001104501 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr17 {Macaca mulatta} MKLWILLFYSSLLACMSLQSQTPVFSVRSSCDSLCNCEEKDGTMLINCEEKGIKTVSEISVPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
ACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSVLSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKTTSILKPPTKAPRLIPYITKPSAQLPGPYCP
IPCNCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNIIDSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLLNLYLNGNHLTLLSKGMFLGLHNLEYL
YLEYNAIKEILPETFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPG
HLDKKELKALNSELLCPGLVNNPSMPTQTSYIIVTTPTTTTNTADTILRSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSM
YGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEEGNEKEGSDAKHLQRSLLERENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLG
ITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
10 >lcl|XP_001093584.1|Plus12989653..2990432 NW_001112573 leucine-rich repeat-containing protein 3B-like isoform 2 LOC701323 __SEG__ Chr2 {Macaca mulatta} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
11 >lcl|XP_001096206.1|Plus1complement(5534844..5536529) NW_001112574 platelet glycoprotein V-like LOC707776 __SEG__ Chr2 {Macaca mulatta} MLRRTLLCAVLGLLRAQPFPCPPACKCVFRDAAQCSAGDVARIAALGLPTNLTHILLFGMGRGVLQNQSFSGMTVLQRLMLSDSHISAVAPGAFNDLVKLKTLRLSRNKI
THLPGALLDKTVLLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPAGLFTNLGNLKLLDLSGNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSELLNSLGAL
TELQLHRNHIRCITPGAFDRLPNLSSLTLSRNHLAFLPSALFLHSHSLTLLTLFENPLAELPGVLFGEMGGLQELWLNRTQLRTLPVAAFRNLSRLRSLGVTLSPRLSAL
PQGAFQGLGELRVLSLHSNGLTALPDGLLRGLGRLRQVSLRRNRLRALPRALFRNLSSLESVQLDHNQLETLPGDAFGALPRLKEVLLGHNPWRCDCGLGPFLGWLRQHP
GLAGLEEPPRCAGPGKLAGLPLWALPGGDAECPGPRGPPPHPAADSSSDSSPVHPALAPNSSEPWMWAQPVATGEYQDHGPFWGFYFLLLAVQALITVIIVLAMIKIGQL
FRKLIRERALR*
12 >lcl|XP_001096355.1|Plus1130641..132881 NW_001121177 immunoglobulin superfamily containing leucine-rich repeat protein 2-like isoform 1 ISLR2 __SEG__ Chr7 {Macaca mulatta} MFPLRALWLVWALLGGAGACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNF
ISSFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGV
PVYRLPTLPCAPPSVHLSAEPPLEAPSTPLRAGLAFMLHCIADGHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGTEEGEGEEGDGDLLTQTQAPTPIPAPAWPAPPAT
PRFLALANGSLLVPLLSAKEAGVYTCRAHNELGTNSTSVRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTGKGRGNSVLPSKPEGKIKGQGLAKVSILGETETEPEEDI
GEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELKPHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAGGDRRRGRRPLRLLYLCPAGGGAAVQWSRVEEG
VNAYWFRGLRPGTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYP
AGGEAGGEEPEDAQGEGLDEDAEPGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG*
13 >lcl|XP_001096685.1|Plus15926054..5927184 NW_001121149 carbohydrate sulfotransferase 14 CHST14 __SEG__ Chr7 {Macaca mulatta} MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGAAWRGKAPKPGGLSLSAGDADLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPQVQFPARQAWYRP
ASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ*
14 >lcl|XP_001097128.1|Plus1171819..173105 NW_001121177 immunoglobulin superfamily containing leucine-rich repeat protein isoform 1 ISLR __SEG__ Chr7 {Macaca mulatta} MQELHLLWWAVLLGLAQACPEPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLI
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFAPLTALSHLQINDNPFDCTCGIVWLKTWALATAVSIPEQDNIACTSPHVLKGTP
LSRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPSTPAASSQPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLGQSLLLHLFLTSF*
15 >lcl|XP_001103520.1|Plus1complement(608895..609668) NW_001114148 leucine-rich repeat-containing protein 3-like LOC712418 __SEG__ Chr3 {Macaca mulatta} MGTVRLPRPSLLLVSTRGSCLFLLFCLRLGATCPQPCRCPDHAGAVAVYCSLRGLQEVPQDIPADTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGPATFAG
LAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDVAMLVTMFGWFAMVIA
YIVYYVRHNQEDARRHLEYLKSLPSAPASKDPIGPGP*
16 >lcl|XP_001105006.2|Plus1complement(1987141..1988985) NW_001121182 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-like isoform 1 LOC714985 __SEG__ Chr7 {Macaca mulatta} MLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFN
NLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLN
INAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAMVEPYAFRGLNY
LRVLNVSGNQLTTLEESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVC
RADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKT
LIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSADAPRKFNMKMI*
17 >lcl|XP_001106330.1|Plus11341571..1343553 NW_001121214 leucine-rich repeat transmembrane protein FLRT2 FLRT2 __SEG__ Chr7 {Macaca mulatta} MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IADGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPLFTPAPSTASPTTQPPTLSIPNPSRSHTPPTPTTSKLPTIPDWDGRERVTPPISERIQLSIHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLMVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
*
18 >lcl|XP_001107400.1|Plus15233889..5235403 NW_001112550 amphoterin-induced protein 3 AMIGO3 __SEG__ Chr2 {Macaca mulatta} MTWLMLLGALLCMLCVGLGTPDSEGFPPRTPHNCPHKCICAADLLSCTGLGLQDVPAELPAATADLDLSHNALQRLRPGWLAPLFQLRALHLGHNELEALGLGVFANASG
LRLLDLSSNALRALGRHDLDGLGALEKLLLFNNRLVHLDEHAFHGLSALSHLYLGCNELASFSFDHLHGLSATHLLTLDLSSNRLGHISVPELAALPAFLKNGLYLHNNP
LPCDCRLYHLLQRWHQRGLSAVRDFAREYICLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYCNTSVPAMRIAWVSPQQELLRAPGSRDGSIA
VLADGSLAIGNVQEQHAGLFVCLATGPRLHHNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCCCCRRACRCRRWPRTPSPLHELSAQSSVLSTTP
PDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLCNPGDLQLKAGSESASSIGSEGPMTT*
19 >lcl|XP_001107663.2|Plus16..638 NW_001096993 plakophilin-2-like LOC716746 __SEG__ Chr11 {Macaca mulatta} KSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLRHQESRRAALLVPPRYARSEIVGVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPALLTY
PRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPLTQNRASRSSWHQSSFHSTRTLREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQL
20 >lcl|XP_001110151.1|Plus1complement(939232..939693) NW_001106424 growth arrest and DNA damage-inducible proteins-interacting protein 1-like LOC717998 __SEG__ Chr19 {Macaca mulatta} MAASVRQARSLLGLTATLAPGSRGYRARPPPRREPGPWWPDPEDLLTQRWQLGPRYAAKQFARYGAASGVAPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKHLAE
EQKRQERCVRAGRCAGLPSVPRGRTGPQAVPTPSGSRRSICML*
21 >lcl|XP_001114512.1|Plus14256679..4258601 NW_001100375 leucine-rich repeat-containing protein 4C-like isoform 1 LRRC4C __SEG__ Chr14 {Macaca mulatta} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
22 >lcl|XP_001115424.1|Plus1complement(1690770..1692794) NW_001100361 leucine-rich repeat transmembrane protein FLRT1-like FLRT1 __SEG__ Chr14 {Macaca mulatta} MVVAHPTATTTTTTTATVTATVVMTTSTMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQV
IYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKG
LNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPW
FCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGSQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRIPDSNIDYPMATGDGAKTLA
IHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMAG
LPLAGIIGGAVALVFLFLVLGAVCWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRG
YRDGGIPDIDYSYT*
23 >lcl|XP_002800117.1|Plus18162838..8164658 NW_001101662 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2-like LINGO2 __SEG__ Chr15 {Macaca mulatta} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECSADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAAVEGEVAGPRRFNMKMI*
24 >lcl|XP_002804323.1|Plus1complement(<2450453..2450656) NW_001118167 hypothetical protein LOC100425642 LOC100425642 __SEG__ Chr5 {Macaca mulatta} MTSLGDGTLRIGWSWDIVLAPYKIEKKKEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKKEG
25 >lcl|XP_002806356.1|Plus12095900..2097039 NW_001218169 armadillo repeat-containing X-linked protein 3 ARMCX3 __SEG__ ChrX {Macaca mulatta} MGYARKVGWVTAGLVIGAGACYCIYKLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTILSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSV
QLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQCGE
GSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE*