SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom W    

ID / Description / Sequence
1 >lcl|XP_001362458.1|Plus1116452..117711 NW_001581978 carbohydrate sulfotransferase 12-like LOC100010103 __SEG__ Chr6 {Monodelphis domestica} MTKMRLLRLWIVLGSVFMILLIIVYWDNVGTAHFYLHTSFSRPHPPGALPTTGKDEEREFVSDVDEFLDKLLSSSGRQNDPLRKKTEQPPLPGSSKPILGNMEENVRGYD
WSTHDAKQNPDQEKLQAERRNMLREFCANSSLVFPTKNRSFDDIPNYELNHLIVDDRHGIIYCYVPKVACTNWKRVMIVLSESLLDQGIPYKDPLDIPREHVHNTSTHLT
FNKFWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENDEFYRRFAVPMLKLYSNHTSLPTSVSEAFSAGLKVSFSDFIQYLLDPRTEKLAPFNEHWRQV
YRLCHPCQIDYDFVGKLETLDEDAAQLLQLLKVDKQLHFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLKD*
2 >lcl|XP_001362484.1|Plus18113613..8116159 NW_001587047 SLIT and NTRK-like family, member 2 SLITRK2 __SEG__ ChrX {Monodelphis domestica} MLNGVWFLSVLTVAGILQTESRTTGKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYLLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNELQEIRTGAFSGLK
TLKRLHLNNNKLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPNNVFRFVLLTHLDLRGNRLKMMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSASDSNHKGNHPSFSDTHMQKLSPTLNPALTPTRAPKASRPPKTRNRPTPRVTVSKDRQSFGPI
MVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISALHPKPTSPKKLYLTGNYLQTVYKTDLPEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEI
LYPSMFDGLQSLQYLYLEYNIIKEIKPCTFDALINLQLLFLNNNLLRALPENVFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHA
NSPVIINEITCESPAKHAGEILKFLGRETICPDNPGLSDATILSMSHNTDTPRSLSVAPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSGPSST
NNLDISSFQLQYGSYNADTADKTEGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYGNLETKKEGPTTLAYTISASELLEKQSTPREPELLYQNIAERVKELP
SAGVVHYNFCTLPKRQFAPSYESRRQNQDRLNKTVLYGTPRKYFADQSKPEHPLLQAKQQTEPDYLEVLEKQTAISQL*
3 >lcl|XP_001362539.1|Plus1complement(5636941..5638863) NW_001581971 leucine-rich repeat-containing protein 4C LRRC4C __SEG__ Chr5 {Monodelphis domestica} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLRDIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPANLKGRYIGELDQNYFTCYAPVIVEPPTDLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTLQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTENNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINNGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPIESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
4 >lcl|XP_001362989.1|Plus17497069..7500020 NW_001581996 SLIT and NTRK-like family, member 3 SLITRK3 __SEG__ Chr7 {Monodelphis domestica} MKPPMAEALQKGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFVHLNNAVSINLGN
NALQDIQSGAFSGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLSYRGMLDHI
GRSLMEIQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTELCPLLSDSEVEASLGIPQLSSSKENAWPTKPSSMLSSVHFTASSVEYKGSN
KQPKPTKQPRTPKPPPTSRGLYPGPNQPPIAAYQTRPPIPIICPTGCICSLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIERLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPLKQWIETISSVSVVGDVLCGSPENLTHRDVRTVELEVLCPEMVHLAPAGASPAMPGDVHPAGGPTGASPYEFAPPGGPVPLSVLILSL
LVLFFSAVFIAAGLFAFVLRRRRKKLPFRKRQEGVDLTGIQMQCHRLFEDGGGGGGGGGGGGVGGRPSHPSPEKAPPVGHVYDYIPHPVTQMCNNPIYKPREEEEASTVV
AGQEAGVPERGGPGTQPPGMGELLGGEQFPETSKENNSNYRTLLEKEKEWTLAVSSSQVNTIVTMNHPHPHPHPHHPAGSGVAGVVGSTGGDLAGFRHHEKNGGVVLFPP
GGGCGPSSILLDRERPQPTPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDPQTQKSEYLELRAKLQTKPDYLEVLEKTTYRF*
5 >lcl|XP_001364501.1|Plus141254380..41254898 NW_001581900 galectin-related protein A-like LOC100014815 __SEG__ Chr3 {Monodelphis domestica} MAGSVAQREALEKLEDRHLNNFLGSTFHAEVYLPRLIIPFCGPIKGGMRPGKKILVMGIVDLNPESFKISLTCGDSEDPPADVAIELKAVFTDKQLIRNSCISGERGEEQ
SAIPYFPFIPDQPFRVEILCEHPGFRVIVDGRQLFDFYHRIESLSTIDTIKINGDLQITKLG*
6 >lcl|XP_001365152.1|Plus1complement(32053745..32055565) NW_001581976 leucine rich repeat and Ig domain containing 2 LINGO2 __SEG__ Chr6 {Monodelphis domestica} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCDCLPHNKSVSCHRKRLIAIPEGIPIETKILDLSKNRLKSVNPEEFMSYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRNLISLHLRYLNINVMPVYA
FKRLFHLKHLEIDYWPLLDLMPANSLYGLNLTSLSITNTNLSTVPYPAFKHLVYLTHLNLSYNPISTIEAGMFADLIRLQELHVVGAQLRTIEPHAFQGLRFLRVLNVSQ
NLLETLEENVFYSPRALEVLSISSNPLACDCRLLWILQRQPLLQFGGQQPMCAGPDSIREKPFKDFHSTALSFYFTCKKPKIRDKKMQYLLVDEGQTVQLVCNADGDPQP
VISWATPRRRLITTKSNGRVTVLGDGTLEIRFAQDQDTGVYVCIASNAAGNDTYTASLTVKGFASDRFLYANRTPMYMTDSNDTSSNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
7 >lcl|XP_001366278.1|Plus1complement(29919370..29921322) NW_001582020 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr8 {Monodelphis domestica} MKLLWQVTVYHTWNAILLPIVYLTAQVWILCVAIAAAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRN
SIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVG
LEELEMSGNHFPEIRPGSFRGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRC
HAPLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRIAELKCRTPPMSSVRWLLPNGTVLSHASHHPRISVLNDGTLNFSHVLLTDTGVYTCMVTNVAGNSNASAYL
NVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKVAVTTADTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKL
RKRHQQRSTVSAARTVEIIQVDEDIPATTAAAAPSSVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
8 >lcl|XP_001366795.1|Plus1complement(34421755..34423740) NW_001581835 leucine-rich repeat transmembrane protein FLRT2-like LOC100016482 __SEG__ Chr1 {Monodelphis domestica} MGLKTTKWPSHRALLLKSWVIISLGLYMQVSKNMACPNVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHSVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLSKLKEFSIVRNSLSHPPPDLPGTHLVKLYLQDNQINHIPLTAFSNLHKLERLDISNNQLRMLAQGVFDNLSNLKQLTARNNPWFCDCGIKWVTEWLKFIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGFSLMTPPPSVIPPTTQIPTQPAATPSGNSTPLTPTVSKLLPTVPDWDGRERVTPVVSERILLSVHSVNDTSIQV
SWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQDLSLINLEPKSTYRICLVPLDAFNYRAGEDTVCSEATTHASHLNNGSNSASSHEQTTSHNMGSPFLLAGLIGG
AVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCH
T*
9 >lcl|XP_001366967.1|Plus172572589..72575114 NW_001581989 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr7 {Monodelphis domestica} MKLWIHLLYSALIASASIQSPPALSPVRGSCDSLCSCEEKDGLLLINCEKRGIKTLSQINVPPSRPFHLFLVNNGLTTLHTNDFSSLNNAILIHLGFNNIVDIEPGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLHRLKVLILNDNAIEFLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
VCNCDLLQLKTWLENMPPQSIIGDVVCSSPPFVKGSVLSRLKKESICPTPPVHEEYEDPSGSLHLVVTSSINDGHISTKMTSILKSPTKVPGFVPYATKPSTPIPGPYCP
IPCNCKVLTPSGLLIHCQERNIESLSDLRPPPQNPKKLILAGNIIQTVMKSDLVEYSTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLIKLKRGLFLGLQNLEYL
YLEYNAIKEILPGTFNTMPKLKVLYLNNNLLQTLPPHIFLGVPLTRINLKTNQFAHLPVSNVLDELDFLIQIELEDNPWDCSCDLVGLQQWIQKLSKDVVTDDVLCTSPE
HLDKKDLKSLNSELLCPGLINSPSQQTHPSFIIVTTPSTTTNTADTLLRSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRCKKKQVDEQMRDSSPVHLQYSM
YGHKMTHHTTERPGASMYEQHMVSPMVHVYRSPSFSPKHLEEEEEKNDKDGNDSKHLQRSLLERENNSPLTGSNVKYKATDQSAEFLSFQDASSLYRNILEKERELQQLG
ITEYLRKNIAQLQPEIEVHYPGTHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
10 >lcl|XP_001368220.2|Plus1complement(5884083..>5886671) NW_001587047 SLIT and NTRK-like protein 4-like LOC100013865 __SEG__ ChrX {Monodelphis domestica} CFLFFFLDSLSLFRSIKLFAECKKMLLWLFLVLSTPISASTNAESDPSVEICNVCSCVSVENVLYVNCEKVSVFRPNQLKPPWSNFYHLNFQNNLLIVLYPNTFLNFSHA
VSLQLGNNKLQNIEGGAFLGLSALKQLHLNNNELKVLRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPY
IGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCSMGTGSDFDVRVLPPSQLENGYTTPNGHTTQTSLQRLVTKPPK
TTNPSKISSIVAGKALSNRNLSQIVSYQTRVPPLTPCPIPCFCKTHPSDLGLSVNCQEKNIQSMAELMPKPLNAKKLHVNGNQIKDVDTSDFTEFEGLDLLHLGSNQITA
IKGEVFRNLTNLRRLYLNGNQLERLYPEMFAGLYNLQYLYLEYNWIIEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFAGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQ
IDLEGNPWDCTCDLVALKLWLEKLKDDIVMKELKCETPVQFASIELKSLKNEILCPKLLNKPSSPFTSPIPAITLTTPMGPIRSPPGGPVPLSILILSILVVLILTVFVA
FCLLVFVLRRNKKPIVKHEGLGNPECSSMQLQLRKHEHKTNKKDGLAAEAFIPQTIEQMSKSHTCGLKESEASFMFSEPPGQKVILRNAPEKDKDLVHVDTRKRLSTIDE
LDELFPGRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQQDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI*
11 >lcl|XP_001369917.1|Plus182455083..82455862 NW_001582021 leucine-rich repeat-containing protein 3B-like LOC100024760 __SEG__ Chr8 {Monodelphis domestica} MHLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLKSMASNHETANNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEADDISTVV*
12 >lcl|XP_001370777.1|Plus170300996..70302132 NW_001581861 carbohydrate sulfotransferase 14-like LOC100027325 __SEG__ Chr1 {Monodelphis domestica} MFPRPLTPLTAQKGPEPLGRPSRRSPPGGGRGRGGFGGPPLLLPSMLMFGVIVASSGLLLMIERGILAEMKPPPLHPHGRMDPVWRKGVAGGPGMALDPGDSDHQVRQDV
RNRTLRAICGQPSMPRDPWDLPAGQRRTLFRHILVSDQYRFLYCYVPKVACSNWKRVLKVLAGALDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPMER
LLSAYRNKFGEIREYQQRYGAEIVRRYRLGAGPSPAGDDVTFPEFLRYLVDEEPERMNEHWMPVYQLCQPCAVHYDFVGFYERLEVDANHVLEWVRAPPTVRFPSRQAWY
RPASPESLHYHLCNTPRALLQELLPKYILDFSLFAYPLPNVTREACRQ*
13 >lcl|XP_001372003.1|Plus1complement(5112850..5114694) NW_001581881 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4-like LOC100019018 __SEG__ Chr2 {Monodelphis domestica} MRGLESPSKRKRITYSRSKEGMVIDIISRWASASWPPLFFLLLLAGRSGRGCPAACDCDSQPQAVICASRLLEAVPGGIPPDTELLDLSRNRLWGLQRGMLSRLGPLLEL
DLSHNQLSTLEPGAFQGLRNLLTLRLRGNRLRIVAPGVFSGLTSLTLLDLSLNQIVLFLDGAFGGLSSLQQLEVGDNHLVFVAPGAFVGLAKLSILTLERCNLSTVPGPA
LARLPGLIGLRLRELDIGRLPTGALRGLGQLRELEIHQWPSLRALEPGSLAGLNLSSLAITYCNLSSVPFQALSHLSFLRVLDLSQNPISNIPARKLSFLVRLQELHLAG
AHLASIAAHAFHGLAAFCLLDVANNALQTLEEAAFPSPSSLVTLRLAGNPLICDCRLLWLLRLRHHLDFGKSPPACASPLHVRGKNLRDFSDILPPGHFTCRAALIQRSG
PRRVSAEEGQQAVFSCSGDGDPAPTVSWQGPQGTWLGRTGRVRVLEDGTLEIRAIQLGDGGAYVCVLSNVAGNDSLSTWLEVIRIEPPNGTLTDTNGTTLGTPGPFFLDS
RGLVVVLAVGFLPFLTSVTLCFGLIALWSKSKGRVKHHTTFDFVLPRSSGEGGAGGNRVTAKLF*
14 >lcl|XP_001374264.1|Plus1144955439..144957388 NW_001581841 leucine-rich repeat transmembrane protein FLRT3 FLRT3 __SEG__ Chr1 {Monodelphis domestica} MINPTWSIFLIWTKIGLFLKMAPQSVMAKSCPSVCRCDAGFIYCNDRALTSIPKGIPEDATTLYLQNNQINNAGIPSELKNLLKVERIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEDGAFRDNNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQDLTSLKRLVLDGNLLNNHGLGDKV
FMNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQENHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLFLRNNPWYCGCKMKWVRDWLQSLPVKVNVR
GLMCQAPEKVRGMAIKDLNTELFDCKDSGIVSTIQITTAIPNTLYPAQGQKPVSVTKQSEVKNPKLNKDYRTTVSPMRKIITITVKSVSTETIRISWKLALPMTALRLSW
LKLGHSPAFGSITETIVTGDRNEYLVTALEPDSPYRICMVPMETSNLYLSDETPVCIETETAPLKMYNPTTTLNREQEKEPYKNSNLPLAAIIGGAVALVAIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPINNEPISKEEFVIHTIFPPNGINLYKSNHSESSSNRSYRDSGIPDSDHSHS*
15 >lcl|XP_001378646.2|Plus175964778..75966868 NW_001581989 SLIT and NTRK-like family, member 1 SLITRK1 __SEG__ Chr7 {Monodelphis domestica} MLLWILLLETSLCFAAGNITGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQHFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFREQTFLGLDDLEYLQADFNLLRDIDPGAFRDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETSEQDLCPLKNRVDSSLAAPPAQEETCAPGPIPTPFKINGQEDPATPGAAPNGGTKIPVNWQIKIRPTAAVSAINA
KSKPSGRSMPCPEICSCDQIPDSGLKVNCNDRNVSSLADLKPKPSNVQELFLRDNKIHTIRKAHFLDYRNLNLLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFTGLLNLEYLNVEFNEIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFLYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGPE
VIMSDLKCESPEDFFKADFMFLSNDVMCPQLYAKISPTLTSHSKNSTGLAETGTHSNSYLETSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
16 >lcl|XP_001378994.1|Plus158378887..58381292 NW_001581976 extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1-like LOC100029173 __SEG__ Chr6 {Monodelphis domestica} MAGCRWGALCVCVAAASLLYARGLARADCWLIEGDKGFVWLAICSQNQPPYESIPQQINNTIVDLRLNENKIKSVQYASLSRFGNLTYLNLTKNEITYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGILRGLSKLEYLYLQANLIETVTATAFWECPNIMNIDLSMNRIQRLDSGTFTGLSKLSICELYSNPFYCSCELLGFLKWLADFTNMTRTYDRMQC
ESPPDYSGYFLLGQGRTGYRNALSMLSSLCTDGSYTVGARFVPARYPPTTPPPEGPCAEDECFSGDGTTTLVAFHTPATKSEVRPNIWVKHLTHNSATLGVQLPTPFRKM
YVLAQFENGFSSDITSLHKEREEIELSNLITHTNYTYCVVSLGHPLRYNHTCLTICPSKPPPSPGPVPSPSTATHYIMTILGCLFGMVVVLGAVYYCLRKRRRQEEKHKK
AAGGVKKTIIELKYGPELETPAIAQLSQGPVLGADAITRIPYLPSAGEVEQYKLLESSETPKATKGNYMEVRTAEQQERRECELALPPDTQSSVAEISTIAKEVDKVNQI
INNCIDALKSESTSFQAVKSGAVSTAEPQLVLLSEQIPGKHGFLSPVYKDSYSHPLQRHHSMEGPPKRSSTSSSGSVRSPRSFRSEGSSAHKTEAKYIEKTSPTADTILT
VTPAAAILRAEAEKIRQYGEHRHSYPGSHQGEPLPPPPHDGLGGRKPSILEPLTRPRPRDLAYSQLSPQYHNLSYSSSPEYTCKPSQSIWERFKLNRKRHKDEEEYMAAG
HALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
17 >lcl|XP_001379217.2|Plus117089982..17091238 NW_001581855 immunoglobulin superfamily containing leucine-rich repeat protein-like LOC100029479 __SEG__ Chr1 {Monodelphis domestica} MKQLHLLWLAGFLGSVSGCPEVCDCGEKYVFQIADCAYRDLQSVPPGFPANVTTLSLSANRLGDLEAGAFEEVPLLQSLWLAHNEIRVVAPGSLTSLVYLKSLDLSHNLI
SNFSWNDLHNLSALQLLKMDSNELAVIPRDAFKNLGDLRSLQLNHNRFLTLVDGTFEGLTSLSHLQINDNPFNCTCGLLWLKVWAVATAVSIPEQDNIACSSPPFLKGIP
LGRLPPLHCAPPTVQLTYQPNQDGAELRDGFVLALHCDTDGQPPPEVQWRIQTPGGKVEITSPNVGPDGRVPGVAGSPQPRFQAFANGSLLIPGFGKQEEGTYSCRATNE
LGSAEGSVNVALASPGEASEDALGRKFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSSTNPKKNKANSLELLGPWILLLCFSHLIF*