SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab W    

ID / Description / Sequence
1 >lcl|XP_001488212.1|Plus1complement(4058119..4060041) NW_001867368 leucine-rich repeat-containing protein 4C isoform 1 LRRC4C __SEG__ Chr12 {Equus caballus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLVK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
2 >lcl|XP_001489125.1|Plus1complement(37778612..37780702) NW_001867383 SLIT and NTRK-like family, member 1 SLITRK1 __SEG__ Chr17 {Equus caballus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSA
RNKPPANGLPCPGGCSCDHIPGSGLKINCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
3 >lcl|XP_001489985.1|Plus13729417..3731954 NW_001877048 SLIT and NTRK-like family, member 2 isoform 1 SLITRK2 __SEG__ ChrX {Equus caballus} MLSGVWFLSVLTVAGILRTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSTGDSSQRGSHADAHVQRLSPTMNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLYP
SMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTILSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRSANNL
DVSSFQLQYGSYNTETQDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYGNLEEKKEEPATLAYTISATELLEKQATPREPELLYQNIAERVKELPSAG
LVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
4 >lcl|XP_001490248.2|Plus1complement(39426170..39428692) NW_001867383 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr17 {Equus caballus} MKLWTHLFFSCLLACISSQSQSPKSSAGGSCDSLCNCEEKDGTMLINCEEKGIQKLSQISVPPSRHFHLNLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
ACNCDLIQLKIWLENMPPQCVIGDVVCNSPEFLKGSILSRLKTESICPTPPEFEEHEDPSGSLHLTVTSSISGSRMSTKTTSLLKPPTKAPGLIPYITKPSTQLPGPYCP
IPCNCKVLSPSGLLIHCQERNIESLSDLKPPPQNPRKLILAGNIIHTLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSGGMFLGLHSLEYL
YLEYNAVKEILPGTFSPMPKLKVLYLNNNLLQVLPPHIFSGVPLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDVLCTSPE
HLDRKELKALNSELLCPGLVNNPSLPTQTSYIIVSTPTATTTADTILRSLSDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQAEEQMRDNSPVHLQYSMY
GHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLERENHSPLTGSNRKYKTTDQSTEFLTFQDASSLYRNILEKERELQQLGI
TEYLRKNIAQLQPDVEVQYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
5 >lcl|XP_001490259.1|Plus1complement(2148853..2151369) NW_001877048 SLIT and NTRK-like family, member 4 isoform 1 SLITRK4 __SEG__ ChrX {Equus caballus} MFLWLFLILSALISSTNADSDITVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPSGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELMPKPLNAKKLHVNGNSIKDVDIADFTEFEGLDLLHLGSNQITAIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVIMRNVTDKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQQDKKNKKSLIGGNHSKIVVEQRKSSEYFELKAKLQNSPDYLQVLEEQTALNKI*
6 >lcl|XP_001490327.1|Plus139663852..39664625 NW_001867397 leucine-rich repeat-containing protein 3-like LOC100050523 __SEG__ Chr26 {Equus caballus} MGPMGRQSPSSLPVPTGGSCLLLLFCLRLGASCPQSCQCPDHAGAVAVHCSARGLQEIPKDIPTDAVLLKLDANKIARIPNGAFQHLNQLRELDLSQNAIETIGPAAFSG
LAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSIHHKTTDVAMLVTMFGWFAMVIT
YVVYYVRQNQEDARRHLEYLKSLPSAPVSKDPIGPVP*
7 >lcl|XP_001490974.2|Plus1complement(51032194..51034038) NW_001867387 leucine rich repeat and Ig domain containing 1 LINGO1 __SEG__ Chr1 {Equus caballus} MLAGGARSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFN
NLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLN
INAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNY
LRVLNVSGNQLTTLEESAFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVC
RADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKT
LIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSTDAPRKFNMKMI*
8 >lcl|XP_001492298.2|Plus1complement(4744725..4745984) NW_001867371 carbohydrate sulfotransferase 12-like LOC100059762 __SEG__ Chr13 {Equus caballus} MAKARLFRLWLVLGSVFMILLIIVYWDNVGTAHFYLHTSFSRPHPLEGLPTAGQREEKELPADVDEFLEKLLSGGAKQNVVSGKKLEQPSLLASGRPVLSNVEERIRGYD
WSTHGAQQSPDLDRRQAERRSVLRELCANASFVFPTKERSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDQGAPYRDPLDIPREYVHNSSTHLT
FNKFWRRYGRFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLKMYSNHTSLPASVSEAFSAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQV
HRLCHPCQIDYDFVGKLETLDQDAAQLLRLLKVDKLLHFPPSYRNRTASSWEDDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD*
9 >lcl|XP_001492514.3|Plus18819335..8821116 NW_001867419 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 LINGO4 __SEG__ Chr5 {Equus caballus} MAAATAPKQAWPPWSLLLFLLLLPGGSSGGCPAVCDCTSQPRAVLCAYRQLEAVPGGLPLDTELLDLSGNRLWGLQQGMFSRLGLLRELDLSYNQLSTLEPGAFRGLQSL
LTLRLQGNRLRIMGPGVFSGLSALMLLDLRLNQIVLFLDGAFGELGSLQQLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGLALAHLPALVALRLRELDIGRLP
AGALRGLRKLKELEIHHWPSLEALEPGSLLGLNLSSLAITRCNLSSVPFQALHHLSFLRVLDLSQNPISSIPARRLSPLVRLQELRLSGACLTSIAAHAFQGLTAFHLLD
VADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLREFSDILPPGHFTCQPAMIRKSGPRWVVAEEGGHAVFSCSGDGD
PAPTVSWMRPQGAWLGRAGRVRVLEDGTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQIEPPNGSFSDPNITMPGIPGPFFLDSRGIAMVLAVGFLPFLTSVTLC
FGLIALWSKGKGRVKHHTTFDFVAPRPSGDKNSGGNRVTAKLF*
10 >lcl|XP_001493246.1|Plus1complement(52498243..52499529) NW_001867387 immunoglobulin superfamily containing leucine-rich repeat protein ISLR __SEG__ Chr1 {Equus caballus} MQELRLLCCAVLLGLVQTCPEPCDCGEKYGFKIADCAYRDLEAVPPGFPTNVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALAPLGHLKSLDLSHNLI
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINDNPFDCTCGIVWFKTWALTTAVSIPEQDNVTCSSPHVLKGTP
LNRLLPLPCSAPSVQLTYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVDITSPNVGADGRALPGTPAASSRPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDALGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRARGPEAAAAGEGVRGQQLPGLLLLGQSLLLLLLPSF*
11 >lcl|XP_001493877.1|Plus1complement(33282859..33283638) NW_001867381 leucine-rich repeat-containing protein 3B-like LOC100051404 __SEG__ Chr16 {Equus caballus} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
12 >lcl|XP_001495121.1|Plus129845088..29847070 NW_001867395 leucine-rich repeat transmembrane protein FLRT2 isoform 1 FLRT2 __SEG__ Chr24 {Equus caballus} MGLQTTQWPSHGAFFLKSWLLISLGLYSQVSKILACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAVSLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLACPTTTPGLPLFTPAPSTVSPTTQPPTLSVPTPSRSYTPLTPTTSKLPTIPDWDGRERVTPPISERIQLSIHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYVNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGISYTDCHIPNNMRYCNSSVPDLEHCHT
*
13 >lcl|XP_001498583.1|Plus1complement(45593792..45595612) NW_001867394 leucine rich repeat and Ig domain containing 2 isoform 2 LINGO2 __SEG__ Chr23 {Equus caballus} MLHTATSCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIRDKKLQHLLVDEGQTVQLECSADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
14 >lcl|XP_001502654.1|Plus1complement(57508188..57510146) NW_001867413 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr4 {Equus caballus} MKLLWQVTVHHTWNAVLLPIVYLTAQVWILCAAITAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
STAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLR
KRHQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
15 >lcl|XP_001504615.1|Plus1complement(6262123..6265053) NW_001867385 SLIT and NTRK-like family, member 3 isoform 1 SLITRK3 __SEG__ Chr19 {Equus caballus} MMTSSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLG
NNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDH
IGRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHLTASSVEYKSS
NKQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHL
GNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLE
HLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPEMLHVPPAGASPAQPGESHLAGGPTSASPYEFSPPGGPVPLSVLILS
LLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSVQEAG
SAERGGPGTQPPGMGEVLLGSEQFSETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTGNHHHPHPHHPAVGGVSGVAAGSGGDLAGFRHHEKNGGVVLFPPGGGCGGG
SMLLDRDRPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTYRF*