SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam W    

ID / Description / Sequence
1 >lcl|NP_001006954.1|Plus1597369..599105 NW_876277 thrombomodulin precursor THBD __SEG__ Chr24 {Canis lupus familiaris} MLRVLLLGVLAPAGLGLPTPAQPQPRSSQCVEHDCFQLFRGPATFLAASQTCEGLGGHLMTVRSSVAADVISLLLSGDGGDGPRLWIGLQLRRGCSDPGQGGPLRGFQWV
TGDNRTSYSRWARPHVGPAGPPCAPLCVAVSDAAAPAPGEPAWEEQRCAAEADGFLCEFHFAASCRPLLVDARAAAAAGVSVTYSTPFGARGADFQALPAGSSAAVAPFG
VQLACAAPRGEAEARWGREAPGAWDCSVENGGCQRACSASAGAPRCLCPADTYLQADGRSCATFAEHSCHKLCEHFCIPNASVPGSYLCMCETGYQLAADQHRCEDVDDC
IQVPSLCPQLCVNTRGAFECHCYPGYELVDNECVEPVDPCFGSKCEYQCQPVSQTDYRCICAEGFAPVPHDPHRCQMFCNQTACPADCDPNSPTSCQCPEGYILDDGFMC
TDIDECENGECPEACRNLPGTYECICGPDSPLAGQVATDCGRIISDPDGDSDSGSGEPPVTPTPGVTPSPSPVGPVHSGVLIGISIASLSLVVALLALLCHLRKKQGAPR
AELEYKCGAPAKEVVLQHVRTEQMPQKL*
2 >lcl|XP_003435105.1|Plus155206241..55208223 NW_876327 leucine-rich repeat transmembrane protein FLRT2 FLRT2 __SEG__ Chr8 {Canis lupus familiaris} MGLQTTQWPSHGAFFLKSWLLISLGLYSQVSKILACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVRSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAIISDMAFQNLTSLERLIVDGNLLTNKG
IADGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRVLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPAFTPAPSTAPPTTQPPTLSVPTPGRSHTPQTPTTARLPTVPAWDGRERATPPVSERIQLSVHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTVCSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHISNNMRYCNSSVPDLEHCHT
*
3 >lcl|XP_003435659.1|Plus1complement(1891480..1891887) NW_879563 galectin-1-like LOC491922 __SEG__ ChrX {Canis lupus familiaris} MACGLVASNLSLKPGQCLRVQCEVVPEAKSFVLNLGKDGDNLCLHFNPRFEAHSDVNTIVCNSKDGGARGEEHRESAFPFQPGTVTEVCISFDQADLTIKLPDGYTFKFP
NRLNLEAISYLAADGDMKIKCLAFD*
4 >lcl|XP_538692.1|Plus1complement(36968208..36970028) NW_876253 leucine rich repeat and Ig domain containing 2 isoform 1 LINGO2 __SEG__ Chr11 {Canis lupus familiaris} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSELIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIRDKKLQHLLVDEGQTVQLECSADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFTSDRFLYANRTPMYMTDSNDTMSNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
5 >lcl|XP_540322.3|Plus1complement(9300192..9302099) NW_876264 leucine rich repeat and Ig domain containing 4 LINGO4 __SEG__ Chr17 {Canis lupus familiaris} MLRQIAQSLVPLRRSREVQGHQPLKSLSKKDHVIICSRIEEGIAMATAPKRAPAPWLPLLFLFLLPGGSCGGCPAVCDCTSQPRAVLCAHRRLETVPGGLPLDTELLDLS
GNHLWGLQQGMLSRLGLLKELDLSYNQLSILEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALKLLDLRLNQIVLFLDRAFGELGSLQQLEVGDNHLVFVAPGAFAG
LAKLSALTLERCNLSTVPGLALARLPALLTLRLRELDIGRLPAGALRGLGQLKELEIHHWPCLEALEPGSLLGLNLSSLAITRCNLSAVPFQALHHLSFLRVLDLSQNPI
SAIPARRLSALVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTSPPACAGPRHVQGKSLQD
FSDILPPGHFTCQPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPQGAWLGRAGRVRVLEDGTLEIRSVQLQDRGAYVCMVSNVAGNDSLRTWLEVIQVDPPN
GTLSGSNITMPGIPGPFFLDSRGVAMVLAVGFLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF*
6 >lcl|XP_540535.1|Plus13539838..3541757 NW_876266 leucine-rich repeat-containing protein 4C LRRC4C __SEG__ Chr18 {Canis lupus familiaris} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
7 >lcl|XP_540833.1|Plus125695615..25697933 NW_876266 endosialin CD248 __SEG__ Chr18 {Canis lupus familiaris} MLLRLLLAWAAAAPTLGQAPWAAEPRAVCGPGSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGPGPASRLLWIGLQRQARQCQPQRPLRGFTWTTGDQ
DTAFTNWAQPATGAPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGSCPALLGEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVPCQAGREASLLCVKQPEGG
VGWSRAGPLCPGTGCGPDNGGCEHECVEEVDGRVSCRCTEGFRLAADGQSCEDPCAHAPCEQQCEPGGPQGYSCHCRLGFRPAEDEPHRCVDTDECQIAGVCQQMCVNYV
GGFECYCREGHELEADGISCSPAGAMGARASQDLGDELLDDGDDEEDEHEAWETFDGSWTEVPGIPWMEATQPPDFGLAYRPSFPEDREHQMPYLDPTWPPPLSAPRVPY
HSSVLSVTRPVVVSATRPTLPSAHRPSIISATRPPLAPAPEPPMIPDKHPALPPDHQFPMISANHPDLSSAYQPPIISATHPAWPPAHQPPVISAKHPQLSPGHQSPVFP
DTQVTDTQATAHLPQIPANHTPPVATPNTHQSLVTPDVLDLKGQATHLPLTSTVQPPLTTTPRPPVLPAHQVPVPAATQAPGLHTTLTSEPPGSPTNHTSLTSPTYPHSK
PSQVPREGAHDSKVAPWLPSAAPTALGEASMAGHSRRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGPHAPNKRVTDCYRWVTHAGSKGPTESMPHRGSLTGVQTCRT
SV*
8 >lcl|XP_540888.1|Plus1complement(27632083..27634107) NW_876266 leucine-rich repeat transmembrane protein FLRT1 FLRT1 __SEG__ Chr18 {Canis lupus familiaris} MVVAHPATTATTTPTATVTATVMMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQV
IYLYENDLDEFPVNLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPRTLEELRLDDNRISTIPLHAFKG
LNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLENLAQLLLRNNPW
FCGCNLMWLRDWVQARAAVVNVRGLMCQGPEKVRGMAIRDITSEMDECFETGSQGGAANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSSLDYPMATGEGAKTLA
IHVKPLTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETGNAYVADETPVCAKAETADSHGPTTTLNQEQNADAMAG
LPLAGIIGGAVALVFLFLVLGAICWYVHRAGELLTRDRAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKGTHTIGYGTTRG
YRDGGIPDIDYTYT*
9 >lcl|XP_542628.2|Plus1complement(36275508..36277598) NW_876274 SLIT and NTRK-like family, member 1 SLITRK1 __SEG__ Chr22 {Canis lupus familiaris} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSA
RNKPPANGLPCPGSCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATIENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
10 >lcl|XP_542630.1|Plus1complement(37863162..37865684) NW_876274 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr22 {Canis lupus familiaris} MKLWIHLLYSSLFACISSQSQSPMSSARGSCDSLCNCEEKDGTMLINCEEKGIKKLSQISVPPSRPFHLSLLNNGLTMLHTNDFSGLTNAISLHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
TCNCDLLELKIWLENMPPQSVIGDIVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSISDSRMSTKSTSLLRPATKAPVLIPYITKPFTQLPGPYCP
IPCNCKVLSPSGLLVHCQERNIESLSDLKPPPQNPRKLVLAGNIIHTLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFINLTRLQKLYLNGNHLTKLSRGMFLGLHNLEYL
YLEYNAVKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVSLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWLQKLSKNTVTDDILCTSPE
HLDKKELKALTSELLCPGLVNNPSLPTQASYIIVSAPTTTTTADTILRSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQTDEQMRDNSPVHLQYSMY
GHKTTHHTTERPTASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKDGSETKHLQRSLLERENHSPLTGSNMKYKTTDQSTEFLSFQDASSLYRNILEKERELQQLGI
TEYLRKNIAQLQPDMEVHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
11 >lcl|XP_542758.1|Plus1complement(17345170..17345949) NW_876276 leucine-rich repeat-containing protein 3B LRRC3B __SEG__ Chr23 {Canis lupus familiaris} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
12 >lcl|XP_544767.3|Plus137292750..37294993 NW_876294 immunoglobulin superfamily containing leucine-rich repeat protein 2 ISLR2 __SEG__ Chr30 {Canis lupus familiaris} MVPARALWLAWALLGVAAACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNL
ISSFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCSLVWLQTWAASTRVSLPEPDSIACASPPALQGV
PVHRLPALSCVPPSVRLSAEPPPEAPGSPLPAGLALMLHCVAEGHPTPRLQWQLQIPGGTIVLEPPVPSGEDEGLGAEDREEEGDGDGPTQTEAPTPTPAPAWPAPPANP
RFLALTNGSLLVPLLSAKEAGIYTCRAHNELGANSTSLRVAVAAAGPPKHAPGAGGDSEGQAPTSERKSTAKGRGNSVLPSKPEGKVKGQGLARVALGEAEAGPEEEEEA
EAEAGEGEEAEDQVSAHPVEEQRCGHGDPSRYVSNHAFNQSSELKQHVFELGVIALDVAEREARVQLTPLAARWGSGPGGPGRPGRRPLRLLYLCPAGGGAAVQWSRVEE
GVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFATKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSY
PAGGGADAGGPEEASGEGLDEDAEQGDPGGDLQREESLAACSLAESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYKQTAG*
13 >lcl|XP_544768.1|Plus137326086..37327372 NW_876294 immunoglobulin superfamily containing leucine-rich repeat protein ISLR __SEG__ Chr30 {Canis lupus familiaris} MPELRLLCWALLLGLARACPEPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPSLPEGAFREVPLLQSLWLAHNEIRAVAAGALAPLGHLKSLDLSHNLL
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGIFTPLTALSHLQINDNPFDCTCGIVWFKTWALTAAVSIPEQDNITCTSPHVLKGTP
LSRLLPLPCSAPSVQLTYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVEIASPNVGADGRALPGAPAASSRPRFQAFANGSLLIPDFGKPEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDVLGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGAPEAAAAGEGVPGQQPPGLLLLGQSLLLVLLTSF*
14 >lcl|XP_544925.3|Plus137587328..37588101 NW_876295 leucine-rich repeat-containing protein 3 LRRC3 __SEG__ Chr31 {Canis lupus familiaris} MGPVGRQSPAPLPVPAGGSCLILLFCLRLGAPCPQSCQCPEHAGAVAVHCSARGLQEIPRDIPANAVLLKLDANKIAHVPNGAFQHLNQLRELDLSQNTIETIGPAAFAG
LAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPESVDEIACHTAAREEYVGKPLIQALDSGVSFCSTHHKTTDVAMLVTMFGWFAMVIT
YVVYYVRQNQEDARKHLEYLKSLPSAPVAKDPVSPVP*
15 >lcl|XP_547014.1|Plus1complement(6424641..6427115) NW_876318 extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1-like ELFN1 __SEG__ Chr6 {Canis lupus familiaris} MAGCRWGVLWVCMAAATLLHAGGLAHGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIAYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGVLRGLSKLEYLYLQANLIEVVTPSAFWECPNIINIDLSMNRIQRLHSATFAGLAKLSVCELYSNPFYCSCELLGFLRWLAAFTNATQTYDRMQC
ESPPLYSGYFLLGQGRHGQRSILSKLQSVCTDGSYVAEPHPVPGRLPPGRSPPPPPPPPPPEPSEAPCADDECFSGDGTTPLVALPTLAPQAEARPLMKVKQLTQNSATI
MVQLPSPFTRMYTLEHFNNSRSSTVSRLTKPQEEIRLTNLYTLTNYTYCVVSTSSGLHHNHTCLTIGLPKPPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCLR
RRRRQEEKHKKAAAAGSLKKTIIELKYGPEMEAPGLAPLSQGPLLGPEAVTRIPYLPATASEVEQYKLVESGETPKASKGNYMEVRTGDQAERRDCELGRPGPDSQSSVA
EISTIAKEVDKVNQIINNCIDALKSEATSFQGGKSGAVSAAEPQLVLLSEPLAGKHGFLSPVYKDAFGHGLQRHHSVEAATGPPRASTSSSGSVRSPRAFRAEATGTHKA
AATEAKYIEKSSPATDAILTVTPAAAVLRAEAEKGRHYGEHRHSYPGSHPAEPPAPPAPPPHDSLGGRKASILEPLTRPRPRDLAYSQLSPQYHNLSYSSSPEYTCRASQ
SIWERFRLSRRRHKDDEEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
16 >lcl|XP_548956.1|Plus135737709..35739325 NW_879562 nyctalopin NYX __SEG__ ChrX {Canis lupus familiaris} MKVTGKQRGGLRGWEPPCALRSGSRKEATRGARLCRRYGNLVEGRILPHGQVGLYWGDAQADGCSFYFFPRPSHLPAVVFGAWAEEACTRTCPTACACSSTERGCSVRCD
RAGLLRVPAEFPCEAASIDLDRNGLRFLGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGELRYLHARTFAALGRLRRLDLASCRLFTVPERLLAELP
ALRELAAFDNLFRRVPGALRGLANLTHAHLEHSRIEAVASSSLLGMRRLRSLSLQANRVRAVHAGAFRDCGALEHLLLNDNLLAELPAEAFLGLRRLRTLNLGGNALGLV
ARAWFADMAELELLYLDRNSIAFVEEGAFQNLSGLLALHLNGNQLTVLAWAAFQPGFFLGRLFLFRNPWRCDCRLEWLRDWMESSGRVADVPCAAPGSVAGLDLSQVAFG
RSSDGLCVDPEELNFTASSPGPSPEPAATTVSRFSSLLSKLLAPRVPVEEVANTTEGPLDTSLSDSLPSSGLVVSGHDTRFLLSSGFLLSVVFVLSMD*
17 >lcl|XP_549303.2|Plus1complement(64198113..64200629) NW_879563 SLIT and NTRK-like family, member 4 isoform 1 SLITRK4 __SEG__ ChrX {Canis lupus familiaris} MFLWLFLILSALISSTNADSDVSVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRVLPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKSLSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELVPKPLNAKKLHVNGNSIKDVDVSDFAEFEGLDLLHLGSNQITAIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFAGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELRCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVIMRNVADKEKDLLHVDSRKRLSTIDELDELFPSRDSNVFIQNFLENKKEYN
SIGVSGFEIRYPEKQQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI*
18 >lcl|XP_549310.1|Plus165983067..65985604 NW_879563 SLIT and NTRK-like family, member 2 SLITRK2 __SEG__ ChrX {Canis lupus familiaris} MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLENLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSTGDSSQRGGHADTHVQRLSPTMNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYRNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLYP
SMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTVLSMNHNTDTPRSLTVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRSANNL
DVSSFQLQYGSYNTETQDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYGNLEEKKEEPATLAYTISASELLEKQATPREPELLYQNIAERVKELPSAG
LVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
19 >lcl|XP_849461.1|Plus18282044..8283996 NW_876258 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr14 {Canis lupus familiaris} MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
STAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPATDTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKR
HQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
20 >lcl|XP_851171.1|Plus1complement(17970717..17973656) NW_876301 SLIT and NTRK-like family, member 3 SLITRK3 __SEG__ Chr34 {Canis lupus familiaris} MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGN
NALQDIQSGAFNGLKILKRLYLHENKLDIFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHI
GRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSSN
KQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPEMLHVPPAGASPAQPGDSHLAGGPTSASPYEFSPPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSVQ
EAGSTERGGPGTQPPGIGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHPHHPAVGGVSGVVAGPGGDLAGFRHHEKNGGVVLFPPGGGC
GGGSMLLDRERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTYRF*
21 >lcl|XP_852017.1|Plus1complement(3031213..3031746) NW_876271 platelet glycoprotein IX GP9 __SEG__ Chr20 {Canis lupus familiaris} MPAWGALLLLWAATEATNDCPAECTCQTLETMGLWVDCRGRGLKALPALPVHTRHLLLANNSLRSVPPGAFDHLPGLQILDVMHNPWHCDCSLTYLRLWLEDHTPEALLQ
VRCASPALATTRPLGWLTGYELGSCGWQLQAPWTYPGVWWDVALAGVAALGLALLAGLLCTTTEMLG*
22 >lcl|XP_852023.1|Plus1complement(5853686..5854945) NW_876318 carbohydrate sulfotransferase 12 CHST12 __SEG__ Chr6 {Canis lupus familiaris} MTKTRLFRLWLVLGSVFMVLLIIVYWDNVGTAHFYLQTSFPRPHPLEPLPTPGHGAEKEFTSDVDAFLQKLLGGSLKQSPLSGKRPEQPSVPASSRPGLSNAEESVRGYD
WSARDTQQGPDPGGQQAERRSVLRGLCANASFVFPTKERSFDDIPNYELNHLIVDDRHGVIYCYVPKVACTNWKRVMIVLSESLLDRGTPYRDPLDIPREYVHNSSTHLT
FNKFWRRYGKFSRHLMKIKLKKYTKFLFVRDPFVRLISAFRSKFQLENEEFYRKFAVPMLKMYANRTGLPASVSEAFSAGLKVSFANFIQYLLDPRTEKLAPFNEHWRQV
HRLCHPCQIDYDFVGKLETLDQDAAQLLRLLKVDKVLHFPPSYRNRTASSWEEDWFATIPLAWRQQLYKLYEADFVLFGYPKPEHLLRD*