SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau W    

ID / Description / Sequence
1 >lcl|NP_001074198.1|Plus1complement(1932993..1934279) NW_001494036 immunoglobulin superfamily containing leucine-rich repeat protein precursor ISLR __SEG__ Chr21 {Bos taurus} MQELRLLCLVVLVGLAQACPEPCECGEKYGFHIADCAYRDLQAVPSGFPANVTTLSLSANQLPSLPGGAFREVPRLQSLWLAHNEIRSVAAGALASLSQLKSLDLSHNLI
SDFAWSDLHSLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFAPLTALSHLQINDNPFDCTCGIVWFKTWALTTAVSIPEQDNITCTSPHVLKGTR
LNRLLPLPCSAPSVQLTYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVEITSPNVGADGRALPGVLAASSRPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDALGRRFQGKAAEGKVCYTVDNEVQPSGPEDNVVIIYLSRARGPEAAATAEGVPGKQPPGLLLLGQSLLFLFLASF*
2 >lcl|NP_001091481.1|Plus11547477..1548607 NW_001492809 dermatan 4 sulfotransferase 1 CHST14 __SEG__ Chr10 {Bos taurus} MFPRPLTPLAAPEGAEPLGRALRRAPLGRARPGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPNREDAVWRGTVPRPGRLSLDAGNSDLQVRQDVRN
RTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGVLDNVDVRLKMDHRSDLVFLADLRPDEIRYRLQHYFKFLFVRDPLERLL
SAYRNKFGEIREYQQRYGVEIVKRYRAGAGPSPAGDDVTFPEFLRYLADEDPERMNEHWMPVYHLCQPCAVRYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRP
ASPESLHYHLCSAPRALLQDVLPKYILDFSLFVYPLPNVTREACHQ*
3 >lcl|NP_001092354.1|Plus1complement(664759..665532) NW_001493790 leucine rich repeat containing 3 precursor LRRC3 __SEG__ Chr1 {Bos taurus} MGPTGRQSPSSLPVPAGGPCLLLLFCLRLGASCPQNCQCPDHAGAVAVHCSARGLQEVPRDIPADTVLLKLDANKIARIPNGAFQHLHQLRELDLSQNAIETIGPAAFSG
LAGGLRLLDLSHNRLRRIPKDALGKLSAKIRLAHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSVHHKTTDVAMLVTMFGWFAMVIT
YVVYYVRQNQEDARRHLEYLKSLPSTPMSKDPTSSAP*
4 >lcl|NP_001092865.1|Plus1complement(3468356..3469135) NW_001494427 leucine-rich repeat-containing protein 3B precursor LRRC3B __SEG__ Chr27 {Bos taurus} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMVSNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
5 >lcl|NP_001159994.1|Plus1282453..284189 NW_001493131 thrombomodulin THBD __SEG__ Chr13 {Bos taurus} MLRVLLLGVLAPAGLGLPAPPEPQPLGGQCVDLDCFAVFRGPATFLAASRVCERLQGHLMTVRSSVAEDVISLLLSGDGPRLWIGLQRPPGCDDPEHSGPLRGFQWVTGD
NRTSFSRWARPHDDGARLCGPLCVAVSAAAGALAPGEPAWEERPCDAEADGFLCEFHFAASCRPLAVDPGATAAAGLSITYGTPFGARGADFQALPLGSTAAVAPLGVEL
ECAAQPGETEGRWSREAPGAWACGVERGGCQHECKGSAGASNCLCPADAALQADGRSCGLPAEHPCHQLCEHFCHLHGLGNYTCICEAGYQLAADQHRCEDVDDCAQLPS
PCPQRCVNTEGGFQCHCDTGYELVDGECVDPVDPCFDNNCEYQCQPVGRSEHKCICAEGFAPVPGAPHKCQMFCNQTSCPADCDPHYPTICRCPEGYIIDEGSTCTDINE
CDTNICPGQCHNLPGTYECICGPDSALSGQIGIDCDPTQVNEERGTPEDYGGSGEPPVSPTPGATARPSPAPAGPLHSGVLVGISIASLSLVVALLALLCHLRKKQGASR
GELEYKCGVPAKELMLQQVKTERTPQKL*
6 >lcl|XP_001249506.1|Plus1complement(2465611..2468139) NW_001493065 slit homolog 1 protein-like SLITRK6 __SEG__ Chr12 {Bos taurus} MKLWIHLLYSSLLACISSQSQSPMPSASARGSCDSLCNCEEKDGTMLINCEEKGIKKLSQISVPPSRPFHLSLLNNGLTVLHTNDFSGLTNAISIHLGFNNIADIETGAF
NGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDN
KWACNCDLLQLKLWLENMPPQSVIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAVTSSISDSHMSAKTTSLLKPPTKAPGLIPYITKPSTQLPGLY
CPIPCNCKVLSPSGLLIHCQERNIESLSDLKPPPQNPRKLILAGNIIHTLLKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSGGMFLGLHNLE
YLYLEYNGVKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDEILCTS
PEHLHKKELKALNSELLCPGLVNNPSLPTQTSYIIVNTPTTTTTADNIFKSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQADEQMRDTSPVHLQYS
MYGHKTTHHTTERPTASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLERENHSPLTGSNMKYKTTDQSTEFLTFQDASSLYRNILEKERELQQL
GITEYLRKNIAQLQPDTEVHYPGAHEELKLMETLLYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
7 >lcl|XP_001253662.1|Plus1653427..655460 NW_001848878 fibronectin leucine rich transmembrane protein 3 FLRT1 __SEG__ Chr29 {Bos taurus} MVVAHPTAAAATTATPATTVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNV
QVIYLYENDLDEFPVNLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPRTLEELRLDDNRISTIPLHAF
KGLSSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSARLQKLYLQDNAISHVPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLENLAQLLLRNN
PWFCGCNLLWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFEAGAQGGAVNAAAKTTHASDHASVTTPQGSLFTLKAKRPGLRLPDSSLDYPMATGDSAK
TLAIHVKPLTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMDTGNTYVADETPVCAKAETADSSGPATTLNQEQNADP
MAGLPLAGIIGGAVALVFLFLVLGAICWYVHRASELLTRERAYNRGSRKKDDYLESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKGTHTIGYGT
TRGYRDGGIPDIDYSYT*
8 >lcl|XP_590571.1|Plus1384593..386413 NW_001495416 leucine rich repeat protein 1, neuronal-like isoform 1 LINGO2 __SEG__ Chr8 {Bos taurus} MLHTALSCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSINPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTIPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLTCDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECNADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
9 >lcl|XP_591589.3|Plus1complement(200667..203201) NW_001508708 slit homolog 1 protein-like SLITRK2 __SEG__ ChrX {Bos taurus} MLSGVWFLSVLTVAGILETESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKLMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSTGDSAQRGGHTDTHIPRLSPTLNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQMVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLFP
AMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDGPNLSDGTVLSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKRVPSVPRSANNL
DVSSFQLQYGSYNTETQDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYSNLEEKKEEPATLAYTISATELLEKQAPREPELLYQNIAERVKELPSAGL
VHYNFCTLPKRQFTPSYESRRQNQDRINKTVLYGTPRKCFVGQSKADHPLLQAKPQSEPDYLEVLEKQTAISQL*
10 >lcl|XP_593502.3|Plus1485387..486649 NW_001495544 trophoblast glycoprotein TPBG __SEG__ Chr9 {Bos taurus} MPGGCSRGPAAGDGRLRLARLALVLLGWVSSTSLPSSASSSTSSASLPAPAASGQPALPGRCPAPCECSEAARTVKCVNRNLTEVPADLPPYVRNLFLTGNQLAVLPAGA
FARRPPLADLAALNLSGNRLKEVDAGAFEHLPGLRQLDLSHNPLADLSPFAFSGSNASVATPSPLAELILNRLELPAAERQNLSLEGMVAAALRAGHALRGLRRLELASN
QLLYLPHDVLAHLPGLRHLDLRNNSLVGLTHVSFRNLTHLESLHLEDNALKVLRNGTLAELQSLPHVRVFLDDNPWVCDCHMVDMVAWLKETEVVQGKGRLTCAFPEKMR
HRVLLELNSSDLDCDPILPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
11 >lcl|XP_594906.3|Plus1524725..525864 NW_001508735 armadillo repeat containing, X-linked 3 ARMCX3 __SEG__ ChrX {Bos taurus} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDVGDCPGARYNDWSDDDDDNSENKGVVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTILSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTITSRLNSSV
QLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKFQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVVFENINDNFKWEENESTQNQFSE
GSLFFFLKEFQVCADKILGLESHQDFLVKVKVGKFVAKLAENMFPKSQE*
12 >lcl|XP_609417.2|Plus1complement(508130..510643) NW_001508705 slit homolog 3-like SLITRK4 __SEG__ ChrX {Bos taurus} MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKAPKTTNPSKISGIVAGKALSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPSNAKKLHVNGNSIKDVDISDFTEFEGLDLLHLGSNQITAIKGDVFRNLTNLRRLYLNGNQIERL
YPEMFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQALTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVMKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLGTEAFIPQTIEQMSKSHTCSLKDSETGFMFSDPPGQKVMMRNVTDKEKDVLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI*
13 >lcl|XP_872893.3|Plus1complement(450431..452521) NW_001493065 slit homolog 1 protein-like SLITRK1 __SEG__ Chr12 {Bos taurus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKHRVDSSLPAPPAQEETFPPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIGTGSA
RNKPPANGLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
14 >lcl|XP_875064.2|Plus11355191..1355733 NW_001494130 glycoprotein IX (platelet)-like GP9 __SEG__ Chr22 {Bos taurus} MPAWVALLLFWAAAEASEDCPAACACRALDTMGLQVDCRGRGLEVLPALPAPTRELLLTNNSLQSVPPGAFDHLPQLQALDLAHNPWRCDCGLVYLRLWLEDRAPEQLLR
LRCAGPAHAADRTPAQLSGSELGGCGWTLRESWAGPGSWWDAALVVVAALGLALLVSLLCTIPVPRASPR*
15 >lcl|XP_875409.1|Plus1complement(12935..13714) NW_001494429 leucine rich repeat containing 3B LRRC3B __SEG__ Chr27 {Bos taurus} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMVSNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
16 >lcl|XP_883783.1|Plus1complement(6773927..6775849) NW_001493344 leucine rich repeat containing 4 isoform 4 LRRC4C __SEG__ Chr15 {Bos taurus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLRDVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*