SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr V    

ID / Description / Sequence
1 >lcl|XP_001925042.1|Plus1complement(413421..414284) NW_003300253 myeloid-associated differentiation marker-like LOC100153863 __SEG__ Chr7 {Sus scrofa} MRCCLRRLQLLCTCVAFLLGASVGTWSGALGSWPMFIWCFCFVLTFIILIIELCELEDRFSFSWDNFLTTYNCYSALLCLSASITYPITYIQFLPDSRSRDHAITSTAFS
CIAFAAYAMEVAWNRAQPNAITSYMATVPGLLKGLETTVACVIFAFISSPHLYEHQPALGWCVVAYAICFLLAAVVLMLNLGKCENRLPIPFHIFQLGLTLLSVLLYASA
LVLWSLYQFDEKVGGQPPRSSNVSCSHEPIYSMCAWDQRLAVTILTAINLLIYVTDLVFLALNFVKD*
2 >lcl|XP_001929372.1|Plus1complement(61216..61782) NW_003536226 dual specificity protein phosphatase 18-like isoform 1 LOC100156909 __SEG__ Chr14 {Sus scrofa} MTASPCAFPVQFRQPSVSGLSQITSSLYISNGVAANNKLMLSSNHITTVINVSVEVANTVYEDIHYMQVPVADTPTSHLCDFFDPIADHIHSVELKQGRTLLHCAAGVSR
SAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGKNTVHMVSSPMGVIPDIYEKEVRLMIPL*
3 >lcl|XP_003127452.1|Plus1504476..505444 NW_003300106 myeloid-associated differentiation marker-like isoform 1 LOC100519316 __SEG__ Chr6 {Sus scrofa} MPVTVTRTTITTTTSSSSGLGSSTIVGSPRALTQPLGLLRLLQLISTCVAFSLVASVGAWTGAMGNWSMFTWCFCFAVTLIILIVELAGLQARFPLSWRNFPITYACYAA
LFCLSASIIYPTTYVQFLSHGRSRDHAIAATAFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACVIFAFISNPNLYQHQPALEWCVAVYSICFILAAVA
ILLNLGDCTNVLPIAFPTFLSGLALISVLFYATALVLWPLYQFDQKYGGHPRRSMDPGCGDRHTYYVCPWDRRLAVAILTAINLLAYVADLVHSARLVFVRV*
4 >lcl|XP_003128519.1|Plus1complement(304004..304990) NW_003300253 myeloid-associated differentiation marker-like LOC100520032 __SEG__ Chr7 {Sus scrofa} MQETETQTTFWTTSPTTSLSSGLDSPNILVLIQILRLFRVLQLLSTCVAFSMEASTGTWIGGIGSWSLFIWCFCFVVTLIILIVEFCELQSRIPFYWYNFPINYACHAAL
FCLLASIIYSTTYVHLLPPGPTRDQAITASAFSCIAAVAYVTEVVWIWACYLPGEFTGFTTVPMLLKGLENLVACVIFAFISSPYLYQHQPALVWCVAVYAICFLLDIVA
LLQGLVDCDNRLPFFSILLLVMNLLSVLLYASALVLWPLYQFEEKLGGQPQRSSDAGCRDEVTYLMCTWDQRLAVAVLTAINLLIYVADLVYWSRMVFVIIKDLPQGS*
5 >lcl|XP_003135089.2|Plus1723664..724233 NW_003536776 dual specificity protein phosphatase 18-like LOC100518886 __SEG__ ChrX {Sus scrofa} MTTPPCPISAQAVQQPTVHSLSQITGSLYLGNGAAANSRLMLSAHHITTVVSVSMEVADVFFEDIQYVHVPVADAPTSRLYDFFDPIADQIHSVEIRQGRTLLHCASGVS
RSAALCLAYLMKYRSMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFKLFSKNTVRMVDSPVGLIPDIYEKEVCLTMPM*
6 >lcl|XP_003356709.1|Plus1complement(360449..361384) NW_003300253 myeloid-associated differentiation marker-like LOC100156674 __SEG__ Chr7 {Sus scrofa} MSTLSIGGADCLSDCCLQVCQLFSTCVAFSLVADMGIGRGALGNWTLSIWCFCFAVTLIILMLQIWKLMSDFPSIRYKYSVTYACYAALLCLSVSVIYSTTYVQFLPYGP
YRDRAIAAIVFSCIAFLLYAVEVGVIWRVFWFSDVTCYVLTVPGLLKVLETFTACVIFAFISNTSLYHDQPALRWCVAVYTICFLQAAVVLVLNLGDCEYRLPIPFPIFQ
LGLTLLSVLLYASAVVLWPLYQFDEKVGGQPQRSSDVNCSIMGDPNYYVCPWDQRLAVTVLTAINLLLYVADLVFWSCRVSVGTEDPPRGS*
7 >lcl|XP_003359366.1|Plus1478135..>478515 NW_003536289 putative MARVEL domain-containing protein 1-like LOC100157606 __SEG__ Chr14 {Sus scrofa} MLPPPPRQPPPQARTARGAVSLQRAFLRGPLGVLRLLQLLAGAAFWITIATSRYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLVVNVAHDLLAAALYG
AATGIMISQTQSHSYCN