SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor V    

ID / Description / Sequence
1 >lcl|NP_001100441.1|Plus1complement(3561131..3561700) NW_048034 dual specificity phosphatase 21 Dusp21 __SEG__ ChrX {Rattus norvegicus} MTTASCILPSQAIQQDNIYGLSQITTSLFISNSAVANDKLTLSNNHITTIINASVEVVNTFFEDIQYVHVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVS
RSAALCLAYLMKYHTMTLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFKLFSRNTVHMIYSPMGLIPNIYEKDAYLMELM*
2 >lcl|NP_899161.1|Plus1complement(9497570..9498526) NW_047555 myeloid-associated differentiation marker Myadm __SEG__ Chr1 {Rattus norvegicus} MPVTVTRTTITTTSSSSTTVGSARALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGPMGNWAMFTWCFCFAVTLIILIVELGGFQARFPLSWRNFPITFACYAALFCLSS
SIIYPTTYVQFLPHGRSRDHAIAATTFSCVACLAYATEVAWTRARPGEITGYMATVPGLLKVFETFVACIIFAFISEPSLYQQRPALEWCVAVYAICFILAAVTVLLNLG
DCTNMLPIPFPTFLSGLALLSVLLYATAIVLWPLYQFDQRYNSQPRRSMDPSCSRSYVQPNEVCNWDRRLAVSILTGINLLAYVSDLVYSTRLVFVKV*
3 >lcl|XP_001054317.1|Plus1complement(502738..503085) NW_047556 macrophage migration inhibitory factor LOC679748 __SEG__ Chr1 {Rattus norvegicus} MPMFIVNTNVPRASVPEGFLSQLTQQLTQATGKPAQYIAVHVVPDQLMTFSSTNDPCALCSLHSIGKIGGIQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWN
GSTFA*
4 >lcl|XP_001062327.1|Plus11479233..1479685 NW_047815 proteolipid protein 2 LOC685108 __SEG__ Chr9 {Rattus norvegicus} MADSERLSAPGCWLACTSFSRSKKGILLFAEIILCLVILICFSASTSAYSSLLAIEMIFVAVLFVFYVCHLHSKISFISWPWTDFFRSLIAILYLITSIVVLVEGRGSSI
FVAGVLGLLATLLFGYDAYITFPLKQQRHTASPTDPTNGP*
5 >lcl|XP_345695.4|Plus1complement(4809169..4809501) NW_047761 macrophage migration inhibitory factor-like RGD1559921 __SEG__ Chr6 {Rattus norvegicus} MFIRNTNVLHASEPEEFHSELTQQLAQGTGKPARFIAVHVVPDQLTTFSDMNDPCTLCSLHSISKIGGTQNRNYSKLLCGLLSDRLHISLDPVYINMNAANLGWNSSTLA
*
6 >lcl|XP_345901.3|Plus110929062..10930393 NW_047798 rCG20225-like LOC690209 __SEG__ Chr8 {Rattus norvegicus} MPSRVEDYEVLHSIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEVEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKDRQYLEE
EFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDSKHNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQISRLSYNEKSDIWSLGCLLYELCALMPPFTAFN
QKELAGKIREGRFRRIPYRYSDGLNDLITRMLNLKDYHRPSVEEILESPLIADLVAEEQRRNLERRGRRSGEPSKLQDSSPVLSELKLKERQLQDRERALRAREDSLEQK
ERELCIRERLAEDKLARAESLLKNYSLLKEHRLLCLAGGSELDLPSSALKKKVHFHGESKENTTRSENSESQLAKSKCRDLKKRLHAAQLCAQALSDIEKNYQLKSRQIL
GMR*
7 >lcl|XP_575621.1|Plus1complement(9806440..9806787) NW_047695 macrophage migration inhibitory factor RGD1560513 __SEG__ Chr4 {Rattus norvegicus} MPMFIMNTNVPRASVPEGLLSELTQQLVQATGKPAQYIAVHVVPDQLMTFSNTNDPCTLCSLHSIGKIGGTQNHNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWN
SSTFA*