SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus V    

ID / Description / Sequence
1 >lcl|NP_001087234.1|Plus1296725..297687 NT_039413 myeloid-associated differentiation marker Myadm __SEG__ Chr7 {Mus musculus} MPVTVTRTTITTTTSSSTTVGSARALTQPLGLLRLLQLISTCVAFSLVASVGAWTGPMGNWAMFTWCFCFAVTLIILIVELGGLQAHFPLSWRNFPITFACYAALFCLSS
SIIYPTTYVQFLAHGRTRDHAIAATTFSCVACLAYATEVAWTRARPGEITGYMATVPGLLKVFETFVACIIFAFISEPLLYNQKPALEWCVAVYAICFILAGVTILLNLG
DCTNVLPIPFPTFLSGLALLSVLFYATAIVLWPLYQFDQRYQGQPRRSMDPSCTRSISYIQPNTVCFWDRRLAVSILTGINLLAYVSDLVYSTRLVFVKV*
2 >lcl|NP_001104800.1|Plus1complement(1432286..1432633) NT_039472 hypothetical protein LOC100040259 Gm16379 __SEG__ Chr9 {Mus musculus} MPMSIVNTNVPHASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCTLCSLHSIGKIGGAQNRNYSKLLCGLLSGRLHISPDRVYINYYDMNAANVGWN
SSTFA*
3 >lcl|NP_001171005.1|Plus1complement(3269578..3270528) NT_039461 hypothetical protein LOC100271928 LOC100271928 __SEG__ Chr8 {Mus musculus} MADMPATVTHTTFTKSVSPGLDSLIMVATPRALLRPLGLLRLLQLCSTGMAFPLVLYMGAWMGPMGSWCVFSWSFSFAMTLIVLAVELTGLQSRLLLSWRDFPITCACYA
VLFCLSSSIIYPMTYVRFMSYDYIRKYAVCAIIFSCISCVAYATEVTWTHSRPGYITGYMASKTGMLKVFESFIACVIFLFLSKPQLYGKEPALIWCLVVYIICFILTMV
VILLCLGKCTNILPIPFTTYLTGMTFMCVLLYTTAIVLWPLYQFNEEFHGFPHRVMDSSCSYKSAHSVCVWDRQLTVTFLTGVNLMAYIADFMNSS*
4 >lcl|NP_062793.2|Plus1complement(49366997..49367593) NT_096135 dual specificity protein phosphatase 14 Dusp14 __SEG__ Chr11 {Mus musculus} MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNWHLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVH
CAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI*
5 >lcl|NP_081027.1|Plus1complement(32049473..32050396) NT_165773 myeloid-associated differentiation marker-like protein 2 Myadml2 __SEG__ Chr11 {Mus musculus} MGSTMEPPGGAYLHLGAVTSPVGTARMLQLAFGCTTFSLVAHRGGFGGVQGTFCMAAWGFCFAFSVLVVACEFTKLHSCLRLSWGNFTAAFAMLATLLCATAAVIYPLYF
TRLECPPEPAGCMVRNFRLAASVFAGLLFLAYAAEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFGALVHESRYGRYVATQWCVAVYSLCFMATVAVVVLSVMGHT
AGLGCPFDRLVIVYTFLAVLLYLSAAVIWPVFCFDPKYGEPGRPADCLRGSCPWDSQLVVAIFTYVNLLLYIVDLAYSQRIRFVPTL*
6 >lcl|NP_082844.1|Plus111313981..11314550 NT_039700 dual specificity phosphatase 21 Dusp21 __SEG__ ChrX {Mus musculus} MTTASCIFPSQATQQDNIYGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNTFFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVS
RSATLCLAYLMKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYEKEAYLMELM*
7 >lcl|NP_776106.1|Plus1797015..797581 NT_039515 dual specificity protein phosphatase 18 Dusp18 __SEG__ Chr11 {Mus musculus} MTSPWSAFPVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSR
SAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQLFGKNTMQMMDSPMGRIPDIYEKETRLMIPL*
8 >lcl|NP_899018.1|Plus135334034..35334555 NT_039687 putative MARVEL domain-containing protein 1 Marveld1 __SEG__ Chr19 {Mus musculus} MLPPPPRQPPPQARTARGSLRLQRAFLRGPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFITLLGKQELVPVLGSRWLVVNVAHDLLAAALYG
AATGIMIDQTQRHSYCNLKNYRLPCAYHAFLAASVCGGLCLGLYLLSALYGCCRRYQGKEEVV*
9 >lcl|XP_001473777.1|Plus113658629..13659300 NT_039706 serine/threonine/tyrosine-interacting protein-like Gm14698 __SEG__ ChrX {Mus musculus} MEDVKLEFPSLPQCKDDAEEWTYPMRREMQEVLPGLFLGPYSSAMKSKLPILQKHGITHIICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSL
QNGGKVLVHGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLAVHSGTTGSVKRTHEEDDDFGNMQVATA
QNG*