SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul V    

ID / Description / Sequence
1 >lcl|XP_001083391.2|Plus11507955..1509409 NW_001114271 dual specificity protein phosphatase CDC14C-like LOC694968 __SEG__ Chr3 {Macaca mulatta} MKRKSEGRSSSAAESPCSPCCLSTSPVVKKIRSSTQQDPRRRGPQVDLYLDITDRLRFAILNSRPKSASNVHYFSVDNELEYENFSEDFGPLNLAMVYRYCCKINKKLKS
ITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGDTSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWII
PDRFIAFCGPHSRTRLESGYPQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFMDAGFDHHDLFFADGSTPTDAIVKKFLDICENAEGAIAVHCKAGLGRTGTLIACYIM
KHFRMTAAETIAWVRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDNINGGTQGDRLRALKSRRQP
KTNAIPLTCPLAVLTSALCSIVIWWIVCDYILPILLFCLDGFRT*
2 >lcl|XP_001088878.1|Plus165099..65668 NW_001218115 dual specificity protein phosphatase 21 DUSP21 __SEG__ ChrX {Macaca mulatta} MTASASFSSSQGLQQPSIYSFSQITSSLFLSNGVAANNKILLSSNRITAIVNASVEVVNVFFEGIQYVKVPVTDARDSRLCDFFDPIADLIHSVDMRQGRTLLHCVAGVS
RSASLCLAYLMKYHSMSLLDAHAWTKSRRPIIRPNNGFWEQLINYEFKLFSNNTVRMINSPVGDIPDIYEKDILAVISM*
3 >lcl|XP_001089604.1|Plus1complement(1581050..1581406) NW_001096631 d-dopachrome decarboxylase DDT __SEG__ Chr11 {Macaca mulatta} MPFVELDTNLPANRVPAGLEKRLCAAAASILGKPAHRVNVTVRPGLTMALSGSTEPCAQLSVSSIGVVGTAEDNRSYSAHFFEFLTKELALGQDQILIRFFPLESWQIGK
IGTVVTFL*
4 >lcl|XP_001091025.1|Plus14911709..4912404 NW_001112558 platelet-activating factor acetylhydrolase IB subunit gamma PAFAH1B3 __SEG__ Chr2 {Macaca mulatta} MSREENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTA
EQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLGEKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQ
GQGAPLLEPAP*
5 >lcl|XP_001095041.1|Plus1184..705 NW_001125129 putative MARVEL domain-containing protein 1-like LOC708237 __SEG__ Chr9 {Macaca mulatta} MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLVVNVAHDVLAAALYG
AATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA*
6 >lcl|XP_001107138.1|Plus1complement(4492670..4493620) NW_001098997 myeloid-associated differentiation marker-like isoform 1 LOC707552 __SEG__ Chr13 {Macaca mulatta} MPVTVTHPTVTTTVGSPTVIGSPRALTQPLGLLRLLQLVSTCMAFSLVASAGAWRGYMGNWSMFTWCFCFAVTLVILLVELGGFQARFPFFWRTFPITIACDAALLCLSA
SIIYPITYVQFLSHGPSRDHAVAATVFSGIACLAYATEVAWTRARPGEITGYMASEPGLLKVLETFVACLIFVFISSPYLYHNWLALEWCVAVYALCFVLAALTILLNLG
HCTNMLPIPFHSFLLGLALLSVLLYATALVLWPLYQFNENYGVQSWQARDVSCSDRNPYLVCIWDRRLAVTILTAVNLLAYVGDLVYSAHLVFVKV*
7 >lcl|XP_001110151.1|Plus1complement(939232..939693) NW_001106424 growth arrest and DNA damage-inducible proteins-interacting protein 1-like LOC717998 __SEG__ Chr19 {Macaca mulatta} MAASVRQARSLLGLTATLAPGSRGYRARPPPRREPGPWWPDPEDLLTQRWQLGPRYAAKQFARYGAASGVAPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKHLAE
EQKRQERCVRAGRCAGLPSVPRGRTGPQAVPTPSGSRRSICML*
8 >lcl|XP_001110413.1|Plus1complement(2331475..2332041) NW_001095169 dual specificity protein phosphatase 18 DUSP18 __SEG__ Chr10 {Macaca mulatta} MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADAPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSR
SAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPMGMIPDIYEKEVRLMIPL*
9 >lcl|XP_001112007.1|Plus16503173..6503769 NW_001102965 dual specificity protein phosphatase 14 isoform 4 DUSP14 __SEG__ Chr16 {Macaca mulatta} MSSRGHSTLPRTLMAPRMISEGDLGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVH
CAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI*
10 >lcl|XP_001112772.2|Plus1complement(712115..713038) NW_001102992 myeloid-associated differentiation marker-like protein 2-like isoform 1 LOC715224 __SEG__ Chr16 {Macaca mulatta} MGSAMEPPGSAYLHLGAVTSPVGTARVLQLAFGCTTFSLVAHRGGFTGVQGTFCMAAWGFCFAVSALVVACEFTRLHGCLRLSWGNFTAAFAMLATLLCATAAVLYPLYF
ARRECPPEPAGCAARDFRLAASVFAGLLFLAYAVEVALTRARPGQVTSYMATVSGLLKIVQAFVACIIFGALAHDSRYGRYVATQWCVAVYSLCFLATVAVVALSVMGHT
GGLGCPFDRLVVVYTFLAVLLYLSAAVIWPVFCFDPKYGEPKRPPDCVRGSCPWDSQLVVAIFTYVNLLLYVADLAYSQRIRFVPSL*
11 >lcl|XP_001115212.1|Plus1complement(4995856..4996881) NW_001121200 etoposide-induced protein 2.4 homolog LOC717601 __SEG__ Chr7 {Macaca mulatta} MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQPRRRASSVLAQRRAQSIEQKQQSEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIDDPSL
HGDVWSWLEFFLTSIFSALSVLPLFVLSKVANAIWFQDIADLAFEVSGRKPHPFPSVSKIIADVLFSLLLQALFLIQGMFVSLFPIHLVSQLVSSLLHMSLLYSLYCLEY
RWFNKGTEMHQRLPNIERNWLYYFGFGLPLAFLTAVQSSYIISGCLFSILFPLLIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVCLQSAPSSSTSAEKFPSPHL
SPAKLKAAVGH*
12 >lcl|XP_001116230.1|Plus1619..1200 NW_001121862 putative serpin A13-like LOC720619 __SEG__ Chr7 {Macaca mulatta} MEAPWWWPLVTVLMAGAHCVALVDQEASDLIHSGPQDSSPGPALPCHKISVSNIDFAFKLYRQLAVSAPGENILFSPVSLSLALAMLSRGAPGASRTKLLEGLGFNLTVV
PEAEIQEGFWDLMLRLPGQGPRLLLTMAQHRFSGLGTRANQSLEEAQKHIDEYIEKQTQGKLGAWEKDLSSETTAVLVNHMLLR