SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom V    

ID / Description / Sequence
1 >lcl|XP_001368915.1|Plus1complement(10567366..10568070) NW_001581996 bax inhibitor 1-like LOC100014642 __SEG__ Chr7 {Monodelphis domestica} MLIWETNLKALSRIPHISPVSQKHLKNVYASLTLCMLVAATGAHLNVVAHFFQAGFISILCSLGVLIWLLNIPHRKETEPKRLFLLAGFAFLIGIDLGPDLDTCIDIDPS
IIPSSFLGTTATFSSFTLSSIFGHCLSYIYLSAILGAALILILISYLGNLFFISTWLYQANLYFGLAFMCGLVLFDTQLIIVKAEKKDEDYIGHSMDLFLDFVTLFRKFM
VILEMNEKNKLKNQ*
2 >lcl|XP_001373801.1|Plus1complement(24753017..24753526) NW_001581859 putative MARVEL domain-containing protein 1-like LOC100021742 __SEG__ Chr1 {Monodelphis domestica} MRPPPPRQPPPPAAGARSSVSLQRSFLRSPLGVLRLLQLLAGAAFWITIASSKYQGPVHFALFVSVFFWLLTAGLYFTTLLGKHELVPLLGPRWLLTNMVHDLLAAGLYV
AASGIMIDQTQQHNYCNLKDYQLPCAYHSFLAASVCGCFCLSLYLLSALYCSCRCCRGH*
3 >lcl|XP_001374821.2|Plus1complement(18052043..18052696) NW_001581871 serine/threonine/tyrosine-interacting protein-like LOC100023207 __SEG__ Chr2 {Monodelphis domestica} MELPCLPLCRDKDVKFWTYFKRREMQEIVPRLFLGPYSSASKNKLPELQKLGTTHVICIRQSLEAKFIQPNFPQFLKYLVLDVEDNPAENIMDFLPASKEFTDGSLQAGG
KVLVHRNAGLSRSAALVIAYRMETFRMTFNDAFLHVKGRRYCICPNDGFIHQLREYEAINLAKLTAQISPPEQGRSLSFLSGNSGNLKRRHEEEEEEEFGNKRMTVE*
4 >lcl|XP_001375357.1|Plus166358200..66358922 NW_001581961 b-cell receptor-associated protein 31-like LOC100023952 __SEG__ Chr4 {Monodelphis domestica} MSLQWAAVATFFYAEILAAVLLCSPFISPQKWLKIFRSRLVRQVVNRGKPYFSVLLLILVLLFMDALWEMRKFDSSEKKGLRNNTVALEQYHMKLYRAQWNLHLTSFSLL
MSLLLRRLVTLQSQQALLQASREALRRQALGALEAAQRFLDENERLRAEVGSDSAAQLSAAPVSDENQCLREELKKLTEELENSRRNLESAQDEALALRKRCEGVPQEHD
HLAEQHHEAGEGLPEDQKNK*
5 >lcl|XP_001379627.1|Plus139318959..39319882 NW_001581875 myeloid-associated differentiation marker-like protein 2-like LOC100030010 __SEG__ Chr2 {Monodelphis domestica} MGSTMDPPGGPYLNLGAVTSPVGTTRLLQLAFGCATFSLVAHRGGFDAAYGTFCMSAWCFCFALTGLVVAFEFTRLHGCLRLSWGNFTAAFAMLATLLSATAAIVYPLYF
TRLECPPEPEGCTARDFRLAASVFAALVFVTYATEVVLTRARPGQVTSYMATVSGLLKIVQAFVACIIFGALVQESRYGRFVATQWCVAVYSVCFIGTVVVVGMSVTGRA
GTLGFPFDRVVVVYTFLAVMLYLSAAVVWPVFCFDPKYGSPSRPSGCPQGSCPWDSQLVVAIFTYVNFLFYVADLAYSQRIRFVPTL*
6 >lcl|XP_003340251.1|Plus11600886..1601482 NW_001581873 dual specificity protein phosphatase 14-like LOC100013795 __SEG__ Chr2 {Monodelphis domestica} MSSRGHSTLPRTLMAPRMISEGELGGIAQITSSLYLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDSVADKIHSVSRKHGATLVH
CAAGVSRSATLCLAYLMKYHSVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI*
7 >lcl|XP_003340912.1|Plus1complement(5102821..5103387) NW_001581924 dual specificity protein phosphatase 18-like LOC100031156 __SEG__ Chr3 {Monodelphis domestica} MNTSLNTIPILFRQPAVCGLSQITSSLYLGNGLAANNKVILSSNKITTVINVSVEVVNTFYADIQYVQVPVADTPLSRLYDFFDPIADKIHTVEMQQGRTLLHCAAGVSR
SAALCLAYLMKYHSMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFKLYGKNTVRMVNSPFGVIPDVYEKEVRVMIPL*