SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab V    

ID / Description / Sequence
1 >lcl|XP_001489394.1|Plus192573..93496 NW_001867366 myeloid-associated differentiation marker-like protein 2-like LOC100054919 __SEG__ Chr11 {Equus caballus} MGSTMEPPGGGYLHLGAVTSPVGTARVLQLAFGCTTFSLVAHRGGFAGVQGTFCMAAWGFCFALSGLVVACEFTRLHSCLRFSWGNFTAAFAMLATLLSATAAVIYPLYF
TRLECPPEPEGCAVRDFRLAASVFAGLLFLAYAAEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFGALVHDSRYGRYVATQWCVAVYSLCFLATVAIVALSVMGYT
GGLGCPFDRLVVVYTFLAVLLYLSAAVIWPVFCFDPKYGEPRRPPNCPRGSCPWDSQLVVATFTYVNLLLYIADLAYSQRIRFVPTL*
2 >lcl|XP_001492256.1|Plus136357596..36358162 NW_001877040 dual specificity protein phosphatase 18-like LOC100059701 __SEG__ ChrX {Equus caballus} MTSPSPLPAGAVQQPSIHGLSQITSSLFISNGAAANNKLLLSSNHITTVINVSVEVVNTFYEDIQYVQVPVADTPSSCLYNFFDSIADHIHSVEMKQGRTLLHCAAGVSR
SAALCLAYLMKYHSMSLLEAHTWTKSCRPIIRPNSGFWEQLIHYEFKLFSKNTVQMINSPVGVIPDIYEKEVRLMMPM*
3 >lcl|XP_001493869.1|Plus122930236..22931204 NW_001867363 myeloid-associated differentiation marker-like LOC100062591 __SEG__ Chr10 {Equus caballus} MPVTVTRTTITTTTTSSSALGSSTIVGSPRALTQPLGLLRLLQLISTCVAFSLVASVGAWTGPMGNWSMFTWCFCFAVTLIILIVELAGLQARFPLSWRNFPITFACYAA
LFCLSSSIIYPTTYVQFLPHGRSRDHAIAATAFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISSTQLYQHKPALEWCVAVYAICFILAAVA
ILLNLGDCTNMLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSREHNCSTSHAHYVCDWDRRLAVAILTAINLLAYVADLVYSARLVFVRV*
4 >lcl|XP_001497783.1|Plus16266792..6267358 NW_001867428 dual specificity protein phosphatase 18-like LOC100063545 __SEG__ Chr8 {Equus caballus} MTAPPCTFPVQFRQPSISGLSQITSSLYISNGVAANNKLMLSSNHITTVINVSVEVMNTVYEDIQYVQVPVADTPVSRLFDFFDPIADHIHSVEVKQGRTLLHCAAGVSR
SAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGKNTVHMVNSPMGVIPDIYEKDVRLMIPL*
5 >lcl|XP_001503900.1|Plus135455008..35455604 NW_001867366 dual specificity protein phosphatase 14-like LOC100057681 __SEG__ Chr11 {Equus caballus} MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVH
CAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGVVPDVYEKESRHLMPYWGI*
6 >lcl|XP_001915710.1|Plus110386163..10386576 NW_001867430 proteolipid protein 2-like LOC100060610 __SEG__ Chr8 {Equus caballus} MADSELRSAPGCCVHCTNFLRSRKGILLFAEIIFCLMIVICFSVSAPKYSSLSVVELILAVFFFVIYMCDLHPKIRFINWPWSDFFRTFIAAILYLTTSIIVLVQRGHRS
KITAGALGLVATCLFGYDAYVTLPWEK*