SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam V    

ID / Description / Sequence
1 >lcl|XP_003433450.1|Plus1complement(23765131..23765697) NW_876282 dual specificity protein phosphatase 18 DUSP18 __SEG__ Chr26 {Canis lupus familiaris} MTAPPCTFPVQFRQPVVSGLSQITSSLYISNGVAANNKLMLSSNQITTVINVSVEVVNTLYEDIQYVQVPVADTPISRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSR
SAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPMGVIPDIYEKEVHLMIPL*
2 >lcl|XP_003434190.1|Plus1complement(15981090..15981353) NW_876301 bax inhibitor 1-like LOC100683971 __SEG__ Chr34 {Canis lupus familiaris} MSLMLLSSLGNLFIGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTLFRKLMMILAMNEKDKKKEKK*
3 >lcl|XP_533325.1|Plus1complement(31345389..31346102) NW_876267 bax inhibitor 1-like LOC476118 __SEG__ Chr19 {Canis lupus familiaris} MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTHFLQAGLLSALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAIN
PSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGVLMSAMSLMLLSSLGNLFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTLFRK
LMMILAMNEKDKKKEKK*
4 >lcl|XP_540492.2|Plus1355878..356801 NW_876329 myeloid-associated differentiation marker-like protein 2-like MYADML2 __SEG__ Chr9 {Canis lupus familiaris} MGSAMEPPGGGYLHLGAVASPVGTARALQLAFGCTTFSLVAHRGGFAGVQGTFCMAAWGFCFALSGLVVACEFTRLHSCLHLSWGNFTAAFAMLATLLSATAAVIYPLYF
TRLECPPEPAGCTARDFGLAASVFAGLLFLAYAAEVALTRARPGQVTSYMATVSGLLKIVQAFVACIIFGALVYDSRYGRYVATQWCVAVYSLCFLATVAVVALSVTGHT
GGLGCPFDRLVVVYTFLAVLLYLSAAVIWPVFCFDPKYGEPGRPPDCPRGSCSWDSQLVVATFTYVNLLLYIADLAYSQRIRFVPTL*
5 >lcl|XP_548251.1|Plus119091304..19091900 NW_876332 dual specificity protein phosphatase 14 DUSP14 __SEG__ Chr9 {Canis lupus familiaris} MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVH
CAAGVSRSATLCIAYLMKCHSVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGL*
6 >lcl|XP_548963.3|Plus138574319..38574888 NW_879562 dual specificity protein phosphatase 18-like LOC491844 __SEG__ ChrX {Canis lupus familiaris} MTTPPCLLPAQAVRQPSIHGLSQITSSLYISNGVAANNKLMLSSNHITTVINVSVEVVNTFYEDIQYVQVPVADAPSSRLYDFFDPIADHIHSVEMQQGRTLLHCAAGVS
RSAALCLAYLMKYHALSLLDAHAWAKSCRPIIRPNNGFWEQLIQYEFKLFSKNTVHMINSPVGVIPDVYEKEIRLMMPM*
7 >lcl|XP_854291.1|Plus1complement(33786751..33787719) NW_876270 myeloid-associated differentiation marker MYADM __SEG__ Chr1 {Canis lupus familiaris} MPVTVTRTTITTTTSSSSGLGSPTIVGSPRALTQPLGLLRLLQLLSTCVAFSLVASVGAWTGAMGNWSMFTWCFCFAVTLIILIVELGGLQSRFPLSWRNFPITYACYAA
LFCLSASIIYPTTYVQFLSHGRSRDHAIAATAFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISNPSLYQHQPALEWCVAVYSICFILAAVA
ILLNLGDCTNMLPISFPSFLSGLALLSVLLYATALVLWPLYQFNEKYGGQPRRSRDVSCADRHTYYVCTWDRRLAVAILTAINLLAYVADLVYSARLVFVRV*