SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau V    

ID / Description / Sequence
1 >lcl|NP_001029431.1|Plus1complement(879753..880319) NW_001493544 dual specificity phosphatase 18 DUSP18 __SEG__ Chr17 {Bos taurus} MTASPCAFPVQFRQPSVSGLSQITSSLYISSGVAANNRLMLSSNRISTVINVSVEVVNALYEDIHYVQVPVADTPTSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSR
SAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGRNTVHMVSSPVGMIPDIYEKEVRQMIPL*
2 >lcl|NP_001068720.1|Plus1768779..769747 NW_001493632 myeloid-associated differentiation marker MYADM __SEG__ Chr18 {Bos taurus} MPVTVTRTTVTTTMSSSSGLGSPTIVGSPRLLTQPLGLLRLLQLVSTCVAFSLVASVGAWTGPMGNWSMFTWCFCFSVTLIILIVELCGLQVRFPLSWRNFPITYACYAA
LFCLSSSIIYPTTYVQFLSHGRSRDHAIAATAFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPGLYQHQSALEWCVAVYSICFILAAVA
ILLNLGDCTNVLPIAFPTFLSGLALISVLLYATALVLWPLYQFDQKHGGEPRRQMDPGCSRRHVHYVCSWDRRLAVAILTGINLLAYLADLVYSARLVFVRV*
3 >lcl|NP_001070416.1|Plus180448..81371 NW_001493693 myeloid-associated differentiation marker-like protein 2 MYADML2 __SEG__ Chr19 {Bos taurus} MGSTMEPPGGGYLHLGAVTSPVGTARVLQLVFGCTTFSLVAHRGGFSGVQGTFCVAAWGFCFALSVLVVACEFTRLHGCLRLSWGNFTAAFAMLATLLSATAAVIYPLYF
TRLECPPEPEGCTARNFRLAASVFAGLLFLAYATEVALTRARPGQVASYMATVSGLLKIVQAFVACIIFGALVHDSRYGRYVATQWCVAVYSLCFLATVVVVILSVLGHT
GGLGCPFDRMVVVYTFLAVLLYLSAAVIWPVFCFDPKYGEPGRPPDCPRGSCPWDSQLVVATFTYVNLLLYVADLAYSQRIRFVPTF*
4 >lcl|NP_001093792.1|Plus1979684..980583 NW_001494027 hypothetical protein LOC508153 LOC508153 __SEG__ Chr21 {Bos taurus} MSTRATLPYWLYMNRVFWLLRVPQLFSTCVAFSLVADMGIWRGDIGNWFMSFWCICFIVTLFIVIIELNDLQPRFPFYWYNFPVTFACYAALICLSASIIYSIAYVQFLP
DGPEWDRAVAATAFSCIASVLYAIEMAGVWNFYKLKEIPCYVHTVPGLLNVLETFVAGVIFAFLSNTSLYLHQPALECCVAVYSICFIPAAVTILLNLGEWENRLPIPFP
IFQLVLTVFSVLLYISALVLWLLYQFYEELGGLPQRSSDVSCIDDLMCAWDQRLAVAVLTAINLLIYVAELGYWARRSL*
5 >lcl|NP_001094732.1|Plus1complement(1762545..1763066) NW_001494356 MARVEL domain containing 1 MARVELD1 __SEG__ Chr26 {Bos taurus} MLPPPPRQPPPQARAARGAVSLQRAFLRGPLGVLRLLQLLAGAAFWITIATSRYQGPVHFALFVSVLFWLLTLALYFLTLLGKQELVPVLGSRWLVVNVAHDLLAAALYG
AAMGIMIGQTQSHSYCNLKDYQMSCAYHAFLAAAVCGGLCLGLYLLSALYGGCRHCQGEREVA*
6 >lcl|NP_001094749.1|Plus1600142..601050 NW_001494027 hypothetical protein LOC781494 LOC781494 __SEG__ Chr21 {Bos taurus} MSTRRIIPEEDDVDTLCCFLRLPQVISMCLAFSLVASMGNERGAVGNWCLAIWCLCFTVTVFISMYDCFYYDRILPFFWYKLPITYACYATLFCLLTSIMYPIFYVQYLP
YGPSRDRAIAASAFSCIACVLYAIDVAYTWKHYKFKNIPCYVHTLPGLLKILESAVACVIFVFISNTSLYLHQPALKWCVVVYSICFVQVAVAMLLKLSGWENRLPLRLP
IFHLGQTMLSFLLYVSAMVLWPLYQFDEKLGGQPHWYTDMSCVDELTDYGCVWDQRLAVAILTAINLLMYVADLVYWTRQVL*
7 >lcl|NP_001095426.1|Plus1complement(620499..621443) NW_001494027 hypothetical protein LOC512440 MGC152278 __SEG__ Chr21 {Bos taurus} MCSCLFRLLQLFSTCVAFSLVADMGIRRGAIGNWSMSFWCVCFVVTLIISIIDVCELWSRFRYFWCNFSITYACYATLICLSASIIYSVTYVQFLPYGPYRDRAIAATAF
SCIASVFYALDVALMRNCYDFDDVTCYAHTMPGLLKVLETFMAGVIFTFLSYTSLYLDRPALEWCVAVYSICFVPAALAIVLNLGKWQRRLPGPFPLFQLVLSLLSVLLY
VSALVLWALYQFNEEFGGQLQRSSDMGCISGLTYNLCFWDRKLTVAILTAANLLVYMADMVYWARQVSVGTRGQSNAPDPFHSQEVSLQSSVSP*
8 >lcl|NP_001095539.1|Plus1complement(566909..567895) NW_001494027 hypothetical protein LOC522763 MGC148762 __SEG__ Chr21 {Bos taurus} MPTRWIHPGSDSILCVFWFLRLPQLFSTCVAFSLVADMGTLRGAIGNWSMSFWCVCFAMTLIISIVDLRNLYYDFPFYWHNICVTYACYAALICLSASIIYSITYVQFLP
DHPYRDQAIAATAFSCIASVLYVIEVAGMRAWYDLEEIFFYEHTMSALLKVLETFVAGVIFAFLSNTSLYLHQPALEWCVAVYSICFILAAVVLLLNLGEWEYMQPRPFS
IFQLLLTLLSVLLYVSSMVLWPLYQFSEEFGGMPQRFMDMSCVDELSYNVCDWDQCLAVAILTAINLLMYMVDLVYWARQVSIGTKDVSSAPDSVWSYPVSSQSEDIL*
9 >lcl|NP_001096772.1|Plus1complement(648394..649269) NW_001494027 hypothetical protein LOC618633 LOC618633 __SEG__ Chr21 {Bos taurus} MDNERGAVSNCCLTIWCVCFSLTAFISMLECYYYDWILPFFWYKLPITYACYVAIFCLLTSIINPIFYVQYLHYGPSRDQAIAASAFSCIMSVLYATDVACTWKYYKLKN
IPCYEHTLPGLLKILESVVACVIFSFISNTSLYRPQPALKCCLAVYFTCFVRVAVAMLLKLSGWENRLPLQLTIFHLGQTMLSFLLYVSAMVLWPLYQFDEKLGGQPHWY
SDMSCVDELTDYGCVWDQRLAVAILTAINLLMYVVDLVYWTCQFSVGTEHQPSTPYPLHSQGVSLQRSVEP*
10 >lcl|XP_002702668.1|Plus1complement(1028787..1029740) NW_001494027 myeloid-associated differentiation marker-like LOC526149 __SEG__ Chr21 {Bos taurus} MITMCSSSGLLSAILLGYFLRLLQLLSTCLAFSLVASVGTWMGAVSNWSVFIWCFCFLVTLIILIIEFCGLQSRFPFSWYNFLITYACYAALLCISASIVYPITYIWFFP
HGRSQDHAIAATAFSCIASVAYASEVAWARTWVWLGVITGYMVTVPGLLKGLETFVAGVIFAFIIDSHLYMHQPALVWCVAVYSICFLLAASALLLNWCDCDNRLPIAFP
TFLLGLTLLSVLLYTSALVLWPLYQFDEQFGGQPKRSSCNDGLIYSLCTWDQQLAVAILTAINLLIYVVDLVFLAHMVFSRTEDQLRGSQFPLLYKS*
11 >lcl|XP_002702742.1|Plus1209..466 NW_001494063 Serpin A3-1-like LOC100335443 __SEG__ Chr21 {Bos taurus} GASDCSPPPTPSPVGTALVSPQVVHGAALDVDEEGTEGAAATGISMERTILRIIVRVNRPFLIAIVLKDTQSIIFLGKVTNPSEA*
12 >lcl|XP_002703049.1|Plus1complement(61923..62315) NW_001494242 proteolipid protein 2 LOC100336197 __SEG__ Chr24 {Bos taurus} MEDFQRSSCTTFLCTQKGMLLFAEIILCLVILTLYGVSTSGYISLSLIELILAIIFFIIYTCDLHTKIQFIHWPWTDFFRSLIAAIIYLITSIIVLVERGYRSRIVAGVL
GLIATALFGYDASITCPMRQ*
13 >lcl|XP_589404.2|Plus1complement(1599015..1599545) NW_001495428 low density lipoprotein receptor-related protein associated protein 1-like LOC511975 __SEG__ Chr8 {Bos taurus} MKEESVEKGRVGKALEESHENAIRPVDLSGVQTEALASRHAELKDRLRSIGQGFDWLRRVSHQGYGAETEFTEPRVLDPWDMAKSANFTEKELESFREELKHFEVKIEKH
NHYQKQLEISHRKLKHVESFGDQEHVTRNKERYAMLEEKTKELGYKVKKHMQDLSSRISRARHNEL*
14 >lcl|XP_589598.2|Plus1complement(15108..15974) NW_001494024 myeloid-associated differentiation marker-like LOC512148 __SEG__ Chr21 {Bos taurus} MGCCLRQLQLFSTCMAFSLGASVGTWKGAIGNWSMFIWCFCFVLTLLILIVELCGLEGHFPFSWDNFLITCNCYSALLCLSASIIYPIIYIQFFSNSHDWDRTIISTAFS
CIAFVAYAMDVTWTRAQPNMITGYMATVPGLLKGLETVVACVIFVFLSNTSLYLHQPALEWCVAVYSICFVLSSVAILLNLGKCDSRPSIPFSVFQVVLTLLSVLLYTTA
LLLWPLYQFNEELGRQLQRSSDVNCSSRIPTSVCIWDQQLAVVSLTAINLLIYVTDLVFSARLNFNSG*
15 >lcl|XP_589599.2|Plus1complement(9696..10667) NW_001494024 myeloid-associated differentiation marker-like LOC512149 __SEG__ Chr21 {Bos taurus} MSTWRTSPSSEGILWVSWLLRLPQLCSTCVAFSLVANMGTLRRAIGNWSMSFWCVCFTMTFIFTIVECCRHPSSFPFFWYNISVTYTCYAALICLSASIIYSITYVQFVP
YGPYRDRAITATAFSCIASVLYVIEVAGIWDCYELKEIFFYVHTRRSLLKVLETFVAGVIFAFLSNTSLYLHQLALEWCVAVYSICFIPAAVVLLLDLAEWKYMLPGPFS
IFQLVLSLLSVLFYISALVLWPLYQFSEELGGQPQRPSDGDCRDKLTYNMCAWDQRLAVAVLTAANLLVYVADLGYWARQVSVGTEDQPRDSQEVYSPNSDIL*
16 >lcl|XP_870366.1|Plus1complement(1045740..1046633) NW_001494027 myeloid-associated differentiation marker-like LOC613992 __SEG__ Chr21 {Bos taurus} MGYFLRTLQLLSTCVAISLVGSLDSWTVPTSTWSFVILCFCCLMTLIILIIESLALQYRFSFSWGDFLLCHACYLALFCLLVSIIYPDTYVQFLPCNPSRDRAIAATAFC
FISTVSYATEAIWILGWPQTGDFTGYTGSLPFLLKMLETLVACVILPFISNPYLYMDHPLLVSCVAVYSICFILGIVTILLNLANYENWLPISSSMFHLVLSLLSVLLYI
GALVLWPLYQFDEKFGGQPERSRDVSCQHRLTNYVCVWDQRLAVAILTAINLLIYVADLVYWAHHVSVGTEDQPGDS*