SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor U    

ID / Description / Sequence
1 >lcl|NP_001002290.1|Plus1complement(12261102..12263201) NW_047626 keratinocytes proline-rich protein Kprp __SEG__ Chr2 {Rattus norvegicus} MCDQQEIQCCGPIPQCCVKGSSFGPSQFPHANNQVLVEAPCEMQFLECAAPCPIQVSQTPCQSSTTEVKGQAPCKTTNVKCQTKTTQVKCQPKTTEIKCQAPCQAQVSCV
QCQAPCQSQVSYVQVPQPPQTYYVECAPVYYTETRFVEYPVSNYVPVPAPQPGYTYVECPSLGQGQGQGSFSTRYQYQGSYGSCTSQSQSRGSYSSCGPQHQSQASYSYC
EPQFQSRPSYTNCGTQRQSQASFGSCTSQLQSRASYSNCSSQRRSGTSFSTCAPQCQGQGTYGSFTAQRRSQSASRCLPSRRLQPSYRSCSPPRHSEPCYSSCLPSRCSS
GSYNYCTPPRRSEPIYGSHCSPRGRPSGCSQRCGPKCRIEISSPCCPRQVPPQRCPVQIPPIRGRSRSCPRQPSWGVSCPDLRPCAEPHAFPRPCRPQRLDRSPESSWRR
CPVPAPRPYPRPEPCPSPEPRPRPRPRPRPEPCPSPEPRPRPRPDPCPSPELRPRPRPEPCPSPEPRPRPRPDPCPSPEPRPRPCPEPCPSPEPRPCPPLRRFSEPCLYP
EPCSVSKPVPCPVPCPAPHPRPVHCETPGRRPQPSPRSQPCPHPEPMPRPVPCSSPVPCGDPIHCPSPCSGHNPVPYSQELGCHESNPCRLDTEGPSSYSFSQGQESNGC
CVSGGVFSGSRGLSGCGDQGNTYRGMNCGACGGTQGAYF*
2 >lcl|NP_001013451.1|Plus112321658..12322179 NW_047454 ADP-ribosylation factor-like 11 Arl11 __SEG__ Chr15 {Rattus norvegicus} MGSVNSRGHKAQVVMLGLDCAGKTTILYKLKGNRLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATWKDYLEGIDLLVYVLDSTDEARLPEAVAELEEVLEDPNM
AGVPFLVLANKQEAPDALPLLEIRNRLDLERFQDHCWELRACSALTGQGLQEARQSLLHLLRS*
3 >lcl|NP_001014084.1|Plus131018511..31019161 NW_047711 hypothetical protein LOC313163 RGD1306195 __SEG__ Chr5 {Rattus norvegicus} MAAEGEPPVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWDTAGQEKFGGLRDGYYIQAQGAIIMFDVTSRVTYKNVPNWHRDLVR
VCENIPIVLCGNKVDVKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVIMDPALAKKYERDLEVAQTTALPDEDDDL*
4 >lcl|NP_001019438.1|Plus1280202..280744 NW_048045 signal peptidase complex subunit 3 MGC109340 __SEG__ ChrX {Rattus norvegicus} MNTLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKIL
LRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF*
5 >lcl|NP_001019535.1|Plus11298934..1300244 NW_047817 hypothetical protein LOC501180 LOC501180 __SEG__ Chr9 {Rattus norvegicus} MTTEPLEDPEANSNFVHGLPEASLGNKADENSEDLPGPSEGLDPLPDEVPPEDIVEARAEEDVDQASEANIIATEQDEEQASMQIATSMGQNKDRASMQTDTSTGRDAEP
ATSMTTSTSGVKEEIPGTPNPSQENLEELTSLLPQDPGILQMFVGFQNPVWDRLAENNRTSRSRTVSPSDSQTQEKTSGKSTVSEGQLEIASNADVPSVLPEDVQTSAGA
TDPPPSDTTGPEPEPTKSADQEAEDFKALNPESKVRSPKSTSEDLAADSGTPQAPPSPNSPADSPPPSPDSYQVSLGRSRLDPSLYGPEVENDYMRSMTSLLCGGEGSIS
SLTDILVWSDTATRMGVAMGILASGRSSPADRLQDEGPRLRTVASLFRSARSAFSSGVMAGTSSVLRSVTHLLESVERHTMEGIRSTMRYLNHFTLRWARTGSNSD*
6 >lcl|NP_001019538.1|Plus1607103..608488 NW_048044 armadillo repeat containing, X-linked 1 Armcx1 __SEG__ ChrX {Rattus norvegicus} MGRTREAGCVAAGMVIGAGACYCVYRLTWGKDENEKLWDDEDEEEEEEEESCSGKPEIGGKTVKERKTHVGVGAGAKPQDDSKSKAEANVGPENGPDVKKEVYPESHSEG
GLEAKAKALFKSLKEQASAKAGRGIRFPNISRIRTLTSSLPCPGGRGGGCHPGRTGSRARNRTSGKVKRKNRSKSNKAPATAWPVRRGKFSFPYKIDDILSAPDLQKVLN
ILERTNDPFTQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTRDPIIREKTYNALNNLSVNSENQGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQ
HLLSYSFPDFFALLFLGNHFTKIQTMKLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKSEGLASSRKEFSRSSLFFLFKESGVCVKKIK
ALASHKDLVVKVKVLKVLTKL*
7 >lcl|NP_001099795.1|Plus116217244..16219538 NW_047563 CD248 molecule, endosialin Cd248 __SEG__ Chr1 {Rattus norvegicus} MLLRLLLAWAAAVPALGQAPWTPEPRAACGPSSCYALFPRRRTFLEAWRSCRELGGNLATPRTPEEARRVDSLVGVGPANGLLWIGLQRQARQCQPQRPLRGFIWTTGDQ
DTAFTNWAQPATEGPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALPLEVGQAGPAIYTTPFNLVSSEFEWLPFGSVAAVQCQAGRGTSLLCVKQPSGG
VGWSQTGPLCPGTGCGPDNGGCEHECVEELDGGMSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDEPHRCVDTDECQIAGVCQQMCVNYV
GGFECYCREGHELEADGISCSPAGAMGAQASQDLRDELLDDGEEGEDEEEPWEDFDGTWTEEQGTLWMAPTHPPDFGLPYRPNFPQDGEPQRLHLEPTWPPPLSAPRGPY
HSSVVSATRPMVISATRPTQPSARKTSVISATHLPLNPVHPPALAPTTPPAVLPEHQIPKIKASYPDLPFGHKPGITSATHPAQPPPHQPPIISTKYPQVFPPQQAPMSP
DTHTITNLPLIPSHLDPGDTTSQAGHHPLLPDVPGIRTQAPQVSVSALQPSLPTNSRSSVHEPPVPTANQPPAFPSPLPPQSPINQTSSISPTHSYSRAPQVPREGAPSP
KSVPRLHSVAPTAAPTALAELGLAGQSQRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGSHTPNKRITDCYRWVTHAGNKSSTEPMPPRGSLTGVQTCRTSV*
8 >lcl|NP_001100522.1|Plus13491318..3491923 NW_047339 ADP-ribosylation factor 4-like Arf4l __SEG__ Chr10 {Rattus norvegicus} MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSAETERLE
EARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQPGLEHLYEMILKRKKAPRSSKKRR*
9 >lcl|NP_001100799.1|Plus1complement(3467116..3469521) NW_047476 zinc finger protein 828 Zfp828 __SEG__ Chr16 {Rattus norvegicus} MEVCQELRKPAISLECGHCSFRGTDYENVQIHMGTIHPEFCDDMDAGGLGKLIFYQKSAKLFHCHKCFFTSKMYSNVYHHITAKHAASDKWSEPPKEQLSKETESGKSPS
LPEQQNTAFDPAEVRPAPTLPIETQKTSPSLSPESQASVPPVLEPQSSAPVISPEPQAPCLPAEASKTAPVSSPECLDPPCELPELEKPEPVPSPESVKSALVSCKPQRH
SPFADTGAPPSALSPESPVLATSPEPWGSSLTASPESRKPVRTASPEPRKPSPSESPELWKPFPAVTSEPRRPTPAVSPGSWKPGPPGSPRPWKSSPSAASGAWKSSKPA
PPMSPGPWKPIPSVSPGPWKPAPSMSTASWKSSVSSGSWKTPPTSPESWKSGPPELRKTALPLSPEHWKAVPPVSPELRRPGPPLSPEIRSPAGSPELRKPSGSPDLWKL
SPEQRKTSPASLDFPEPQKSSCGSSPDLWKSSFIMDSQKPNIFSETRKHAASGSSESPKVASDIWKPVLSIDAEPRKSTLFPEPTKAVLPASPEPRKRALFPESRKHVLL
PELPKSAVFSEAQKATELSEEAQLEAVGDAKCESLVQEGLLATPKRLLDDALFPSTKKLKKDSQESSDAELSSSEFRADLDPLDMKGQESSSDQEQVDVESIDFSKENKM
EMGSAEQAKNVLQFTEEKEAFISEEEIAKYMKRGKGKYFCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRGFK
KHLTHCQSRHSEEANKKLVEALESPLEEPQM*
10 >lcl|NP_001101054.1|Plus1complement(1702765..1706082) NW_047565 RAN binding protein 6 Ranbp6 __SEG__ Chr1 {Rattus norvegicus} MAAAGSAGLPATISDKQEFYQLLKNLINPSCMVRRQAEEVYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSEVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDENGTNHWPEGLKFLIDSIHSKNVVLWEVALHVFWHFPGIFGNQDRHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDDDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKVVLPMTKEHIMQMLQSHDWKCRHAGLMALSAIGEGCHQQMEPILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
SFQKKFHEIVITALLRTMENQGNQRVQSQAASALVIFIEDCPKSLLILYLENMVKSLQSILVIKLQELIRNGTKLALEQLVTTIASVADVIEENFIPYYDIFMPSLKHVV
ELAVQKELKLLRGKTIECISHVGLAVGKEKFMQDASNVMQILLKTQSDLNNMEEDDPQTSYMVSAWARMCKILGKDFEQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDEGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKMMVPLLKFYFHDNVRMAAAEAMPFLLECARIRGSEYLSQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGGILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAIGKIMKF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLNFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETISLEDPCAKRLANVVRQIQTSEELWLECTSQLDDEQQEALQE
LLSSA*
11 >lcl|NP_001101194.1|Plus129338958..29340049 NW_047627 translocation associated membrane protein 1-like 1 Tram1l1 __SEG__ Chr2 {Rattus norvegicus} MGLRKKNARNPPVLSHEFMVQNHADMVSCVGMFFVLGLMFEGTAEMSIVFLTLQHGVVVPAEGLPSGSRTLYHYGVKDLATVFFYMLVAIIIHATIQEYVLDKLSRRLQL
TKGKQNKLNEAGQLSVFYIVSGIWGMIILASENCLSDPTLLWKSQPHNMMTFQMKFFYISQLAYWFHSFPELYFQKVRKQDIPGQLIYIGLHLFHIGGAYLLYLNHLGLL
LLMLHYAVELLSSVCSLLYFGDERYQKGLSLWPIVFISGRLVTLIVSVVTVGLHLAGTNRNGNALSGNVNVLAAKIAVLSSSCSIQVYITWTLTTVWLQRWLEDANLHVC
GRKRRSRSRKGTENGVENPNRIDSPPKKKEKAP*
12 >lcl|NP_001101711.1|Plus1complement(265728..266303) NW_047513 motile sperm domain containing 4 Mospd4 __SEG__ Chr18 {Rattus norvegicus} MASVSRAPAKPPQILVLDPPTDLKFKGPFTAVATAHLKLRNPSTRKVCFKVKSTSPRRYCVRPNSGVIEPGCTVTVAAMLQPSCCGPSQEVKHKFMVQTVFAPPDTSDLE
AVWRGVNPGELMDSKLRCVFEAPTESDKLEDGLRLRKVAHPDKPGPSSCTSLKKGYTTPLPVVLLVIGAVFFGFFLGKLVL*
13 >lcl|NP_001102320.1|Plus1complement(2471798..2472364) NW_047365 trafficking protein particle complex 5 Trappc5 __SEG__ Chr12 {Rattus norvegicus} MEARFTRGKSALLERALVRPRTEVSLSAFALLFSELVQHCQSRVFSVAELQARLAALGRQVGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQAND
DARTFYIIEREPLINTYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHWHKGTTLMIKFEEAVIARDRALEGR*
14 >lcl|NP_001102357.1|Plus1complement(1210115..1210768) NW_047510 SFT2 domain containing 3 Sft2d3 __SEG__ Chr18 {Rattus norvegicus} MADLHRQLQDYLMQGKASRPAAAEPLLGARAAEEPTSGDRPAGAWLGSTALRWPWARSPAEPPPAGSRCIPNVTRGQRLAAGGLCLLLAALCFGLAALYAPVLLLRARKF
ALLWSLGSVLALASAALLRGGPACGRLLRGEETPSRSALCYAAALGATLYAALVLRSTVLTALGACAQVAALLYALIGLLPWGGVTALRLALGRLNRGTGLANALPV*
15 >lcl|NP_001102620.1|Plus18841846..8843105 NW_047561 hypothetical protein LOC499205 Fam181b __SEG__ Chr1 {Rattus norvegicus} MAVQAALLSSHPFIPFGFGGSADGLVSAFGSLDKGCCFEDDESAVSAGALLSGSDGGDVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGT
APPRPPSPSSTDTSAKRPPGAPGASTVATPAHCKAAPRREATQAAAAASLQSRSLAALFDSLRHIPGGAETAGGAVAASVPGLGAASSAGDRAGTSASSVAPGTRKVPLR
ARNLPPSFFTEPSRVGCCGGGGPSGQGVSLGDLEKGAEAVEFFELLAPDFSTGNDSGVLLAADPLDPFPAGATVLRGPLELESVPFEQPAMVGNLLYPEPWNTPSCPQSK
KPPLPGVRGNMTLNEPVRLLYPTALDSPGGEDAPALASFTPFFPDCALPPPHQVSYDYSAGYSRAVYPSLWRPDGVWEGASGEEGAHPD*
16 >lcl|NP_001102970.1|Plus1complement(12474347..12474856) NW_047626 late cornified envelope 1M Lce1m __SEG__ Chr2 {Rattus norvegicus} MSCQQSQQQCQPPPKCKIPKCPPSSCCSLGSGGCCGSSSGGCCSSGGGSCCLSHHKPRFSLRRRRHSSGCCSSGGSSCCGSSGGSSGGSSCCGSSGGSSSGSSCCGSSGG
SSCCGSSGGSSGGSSCCGSSGGSSGGSSSGCCGSSGGSSGGSSSHQQSGGSSCCSGGCC*
17 >lcl|NP_001102994.1|Plus1complement(8710457..8712322) NW_047399 choroideremia-like (Rab escort protein 2) Chml __SEG__ Chr13 {Rattus norvegicus} MADKLPTEFDVVIIGTGLPESILAAACSRSGQRVLHVDSRSYYGGNWASFSFTGLLSWLKDYQQNHDSEGDVTGTWQDLIDETEEAIALCKKDETIQHTEVFCYASQDVE
DSMQETDPLQKSPSPEASATPADSLDTASLPKERHSEDCTSYEAPSRRTEGSDGAVSLSSADAQDSLEKEKFCGDETGMHTVSDGEEGEHKLAAEDNVGQPKRNTITYSQ
MVKESRTFNIDLVSKLLYSQGSLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKFLTFCLDYEQHSDEYQDFKQCSFSDYLKTKKL
TPNLQHFILHSIAMSSDSSCTTLDGLQATKNFLRCLGRFGNTPFIFPLYGQGEIPQCFCRMCAVFGGVYCLRHKVQCLVVDRDSGRCKGIIDGFGQRISANYFIVEDSYL
SKEMCSNIQYKQISRAVLITDQSILKTDSDQQISILVVPPLEPGTASVRVMELCSSTMTCMKDSYLVHLTCFSSKTAREDLEPVVKQLFIPFAEAEADKEELRKPRLLWA
LYFNMRDSSGVSRSSYCSLPSNVYICSGPDCGLGNEHAVKQAETLFQEIFPSEEFCPPPPNPEDIIFEAEG*
18 >lcl|NP_001103003.1|Plus19748732..9749322 NW_047514 chromatin modifying protein 1B Chmp1b __SEG__ Chr18 {Rattus norvegicus} MEKHLFNLKFAAKELNRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISA
LMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV*
19 >lcl|NP_001116254.1|Plus1complement(7156844..7157635) NW_047563 mitogen-activated protein kinase 1 interacting protein 1 Mapk1ip1 __SEG__ Chr1 {Rattus norvegicus} MYPFLPPARLLPGSPAPFLPSGPSCPQPSGPYPGPAVRVPGHTKPYVTTNMPFPELPRPNSAHTDPAGPLGTQGSMSSGPWAPGMGGQHPNVPYLFPEPSPTPPLPVSGA
PPVAWVTVPPGAWKPPASYPSPEASYPTPGLQPSPNNSYQLPPGPSGASPMPGNLHKVNEMPGGSHSDSSNPESTLMTTGQKKQLKGDNKAIKRRRYKKKSKRVTWGDIK
TLTHKAETLGKQQGHNTTDPKMMLLCLMTMLHVNSQQEHEGSK*
20 >lcl|NP_001119967.1|Plus1complement(8298812..8300413) NW_047535 chromosome transmission fidelity protein 8 homolog Chtf8 __SEG__ Chr19 {Rattus norvegicus} MKEPRIFPRERPTPWTRAPLPPRGRLDGGPGVNAGHPMGVNTDPFLMAAGSLGGNLAPFARNPAPFPTPSGSLASNPAHFPAGARDPSMTSFPRGMNPTGTGAASFPRPG
GLLGPGPGPGLNPRTGALPGSGPMSNPRLGGLPGPGPMANPRAGGLLGASPDPRSGGPMGPGCGPNMRAGVLSSGTGPPNPRPMGLGPGPSPNLRSSFLGTNPAPRPGMF
PGPGLGPNPRACGLGPGLGPNPRAGGLGPGPNLDNRAGGLLGTGSGLNLRMAGPQGLDLAPILRAAGLLGTNSVSFSQASGNMGTNPPTMTRVPGPIGPNTGPSSRGIGL
SGPNPSAMSRAPGPMGPNSAHFSRPGGPMGVNAGVFPRGTGSGGLNPAAFSQSSGTLSSNPGTFQRSAGLQGSNQAVFPRASGPLGPNPANFPRATGLQGPSPAAFPRSA
GPLGPGQVAFPRSAAGHLGSSPAGPVGINPAPFARPTGTLGLNPASFPRMNGPVGKTLVPFPRVGSLPGSNPAAFPRPGGPMAAMYPNGMLPP*
21 >lcl|NP_001128305.1|Plus15977830..5978942 NW_047561 coiled-coil domain containing 89 Ccdc89 __SEG__ Chr1 {Rattus norvegicus} MPQKEKTLRMDTPPPDEILGRQNENLENEDDELGFKEMDGLREALANLRGLSEEEKGEKAMLRSRIQEQSQLICILKRRSDEALERCQILELLNSELEEKRMQEMEKMKV
QNEQVQKLESRFMTLAANHELMIRFKDEHKSENIKLKEENEKLRQENNSLFSQALKDQENKVLQLTAHNKALVEELEVLKQRCAHEAGQARAREEELLALQNQQACEHAK
ETEQLRSQLQSIKQQHRQATEQMGKDQEANINMNQELQARLHTVMREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSNLRVRELQRKV
DGIQKAYDDLRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
22 >lcl|NP_001128428.1|Plus1complement(1947504..1952282) NW_047724 AT hook, DNA binding motif, containing 1 Ahdc1 __SEG__ Chr5 {Rattus norvegicus} MRVKPQGLVVTSSAVCSSPDYLREPKYYPGGPPTPRPLLPTRPPASPPDKAFSTHTFSENPRPPPRRDPSSRRPPVLAKGDDLLPPRAARPVSQAHCPTPAPDNNSLRHW
DNGRVNLHPVVQLIDIMKDLTRLSQDLQHSGVHLDCGGLRLSRPPAPPPGDLQYSFFSSPSLANSIRSPEERATPHAKPERPNHPLYEPEPEPRDSPQPGQGHGPGATAT
ATGLPPEPEPDGPDYPELADADILSELASLTCPEAQLLEAQALEPPSPQPEPQLLDPQPRFLDPQALEPLGEGLELPPLQPLADPLGLPSLTLQALDTLPDSLESQLLDP
QALDPLPKLLDVPGRRLEPQQSLGHCQLAEPLRLDLCSPHGPPGPEGHPKYALRRTDRPKILCRRRKAGRGRKVDSGPEGRLLPLPMPTGLAAALAEPPPLPPPPPPPAL
SGPVPELEPESSQTPMVPTRKGKCRGVRRMVVKMAKIPVSLGRRNKTTYKVSSLSSSLSVEGKELGLRVSSEPTPLLKMKNNGRNVVVVFPPGEMPIILKRKRGRPPKNL
LLGPGKPKEPTVVAAEAAAVTAATMAMPEVKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPSEPESVHQAPDTQSISQFLHRVQG
FRRRGGKTGGFGGRGGGHAAKAARCSFSDFFEGIGKKKKVVAVAATGVVGPGLTELGHPRKRGRGEVDAVTGKPKRKRRSRKNGTLFPEQVPSGPGFGEAGAEWAGDKGG
GWAPHHGHPGGQAGRNCGFQGTEARAFASTGLESGASGRGSYYAGAPSGQTELSQERQNLFTGYFRSLLDSDDSSDLLDFALSASRPESRKASGNYAGPPSSALPAQRGL
ATFPSRGAKGSPVAVGNSGAGTDPSFQPVLPSRQTFPPGRATSYGITPATSDCRAAETFPKLAPPPSAVARSPTTHPPANTYPPQYGGYGAGQSVFAPAKPFSGQDCANS
KDCSFAYGSGNSLPASPSSAHSAGYAPPPTGGPCLPPSKASFFNSSEGGPFSGSAPTPLRCDSRASTVSPGGYMVPKGTTASAASAASSSSSSFQPSPENCRQFVGASQW
PFRQGYGGLDWASEAFSQLYNPNFDCHVSEPNVILDISNYTPQKVKQQTAVSETFSESSSDSTQFNQPVGGGFRRANSEASSSEGQSSLSSLEKLMMDWNEASSAPGYNW
NQSVLFQSSSKPGRGRRKKVDLFEASHLGFSTSTSATASGYPSKRSTGPRQPRGGRGSGACSAKKERGGTAAKAKFIPKPQPVNPLFQDSPDLGLDYYSGDSSMSPLPSQ
SRAFGVGERDPCDFMGPYSMNPSTPSDGTFGQGFHCDSPSLGAPDLDSKHFPPLAHPPTVFDAGLQKAYSPTCSPTLGFKEELRPPPSKLTACEPLKHGLQGASLSHAAQ
AHLSCRDLPLGQPHYESPSCKGTAYWYPPGSAARSPPYEGKVGSGLLADFLGRTEAVCLSAPHLASPPATPKADKEPLEMTRPPGPPRGPAAATAGYGCPLLSDLTLSPV
PRDSLLPLQDTAYRYPGFMPQTHPGLGGGPKSGFLGPMAEPHPEDTFTVTSL*
23 >lcl|NP_001160147.1|Plus112775415..12776065 NW_047555 RAS-like, family 2, locus 9 Rasl2-9 __SEG__ Chr1 {Rattus norvegicus} MAGQGKPQIQFKLVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVR
VCENIPIVLCGNKVDIKDMKVKAKPILFHRKKNLQYYDISAKSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEEDDL*
24 >lcl|NP_001163899.1|Plus1complement(3651513..3653378) NW_047400 hypothetical protein LOC289334 LOC289334 __SEG__ Chr13 {Rattus norvegicus} MAGFHLFSPKPYGELGEPLAAGEQEFADQLGWHELSRNSWAQTAGAEIETEVPWVHPKCSPAGRSRRRGYIASPRESHSLTHVARRPSDRARKHRSGNLRLEEACGMGEA
PTKSSRTWQQKRQQQPPDQPSPRHPAAPGVSSPQYPGEAFSPPSAGALLVEKTHNGDRWAVPVCRHVGPGSPALDLTDKSSVHSLELWRQSTCVCTQNRKNRDRTKYYPP
SASCKEKSSQHARVLKSKLDEAVISFRDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERRLLLLQSQEQWQGQREQHKPRRGHSHEQPRQGHEQQ
GQRRDRQAKSTVQPENQSGWTMQPDKPENQGLDKMDRVQVQAEHLKHCQAQSLREQERVLQSVRDLNRLQLQKRLETAGHKREQHAMESPKKVQGSNLSTVVNVQARKVL
MDCQAKAEELLRKLSLEQSFQSSQNMQEGLVKERHRGQQGKAQTEAEQFQRVKWREEEAEELLQESKRVLAELAEEKMGQARSHAHKTSKDRAQHLQELNILRERNRHIL
KLKAEKEEKCHIEGIKEAIKKKEQKLEQMTLGKDPIFQEYQKVPLASKINRCYDKGAAETQLPLHQQGGVY*
25 >lcl|NP_062059.1|Plus1complement(6154296..6154898) NW_047760 ADP-ribosylation factor-like 4A Arl4a __SEG__ Chr6 {Rattus norvegicus} MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEE
AKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR*
26 >lcl|NP_077066.1|Plus138279023..38279550 NW_047760 ADP-ribosylation factor 6 Arf6 __SEG__ Chr6 {Rattus norvegicus} MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDR
EMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS*
27 >lcl|NP_113851.1|Plus1complement(7970149..7971741) NW_047469 vesicular acetylcholine transporter Slc18a3 __SEG__ Chr16 {Rattus norvegicus} MEPTAPTGQARAAATKLSEAVGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGSEGPTLVSEVWEPTLPPPTLANASAYLANTSASPTAAGSARSI
LRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAF
ISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMV
WLPAFVPHVLGVYLTVRLAARYPHLHWLYGALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAG
HIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLREVQGKDGGEPCSPPGPFDGCEDDYNYYSRS*
28 >lcl|NP_446150.1|Plus112722209..12723018 NW_047544 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 Cited2 __SEG__ Chr1 {Rattus norvegicus} MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSL
PASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGAGGSGTPGGSGGTSGGAGGSSAGGSGGGSTMPASVAHVPAAMLPPNVIDTD
FIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC*
29 >lcl|NP_604461.2|Plus1306874..307188 NW_047710 double-stranded RNA-binding protein Staufen homolog 2 isoform LS (B) Stau2 __SEG__ Chr5 {Rattus norvegicus} PKGILHLSPDVYQEMEASRHRVTSGTTLGYLSPKDMNQPSSSFFSVESPSPTSSAPAARELLMNGTSPAAEAIGLKGSSPTPPCSSVQPSKQLEYLARIQGFQV*
30 >lcl|NP_620612.1|Plus1complement(17502365..17504515) NW_047536 exocyst complex component 8 Exoc8 __SEG__ Chr19 {Rattus norvegicus} MSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRVQALAEETAQNLKRNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLALLPAAAAGAS
TGEDTAGAGPRERGAAQAGFLPGPAGVPREGPGTGEEGKQRTLTTLLEKVEGCRDLLETPGQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNA
LYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKRRREQEEAAALRAPPPVTSKGSNPFEDEAEEELATPEAEEEKVDLSMEWIQE
LPEDLDVCIAQRDFEGAVDLLDKLNHYLEDKPSPPSVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAAAVHTAIRQLRIE
GATLLYIHKLCHVFFTSLLETAREFETDFAGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGEIGLDLTFIIHALLVKDIQGALLSYK
EIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMRSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEVILVAVQHVDYSLRCEQDPE
KKTFIRQNASFLYDTVLPVVERRFEEGVGKPAKQLQDLRNASRLLRVNPESTTSVV*
31 >lcl|XP_001060988.2|Plus14615399..4615779 NW_047565 rCG48592-like LOC681264 __SEG__ Chr1 {Rattus norvegicus} MGDKPIWEQLGSSFIQHYYQLFDNNRTQLCVIYIDSPCLTWEGQLFQGEAATVEKLSSLPFHKIQHSIMAQDHQPSPDSCIFSMVVGQPKADEDPITGFHWKQTKIINEA
WVPTNNTFRLALHNFV*
32 >lcl|XP_001064406.1|Plus1complement(11265477..11266796) NW_047563 mCG145277-like LOC685580 __SEG__ Chr1 {Rattus norvegicus} MLISVVSIPPAAGGPRPEPSPGPPPPLLPKPGKDNQRLQKLLRKAARKKMVGTVPTPPGAFRTSLSPVSEASHDLETPVLCPAEAPHTVAPLPRSPHTPIIHHVASPLQK
STFSFSLPQQRSLATHFKASPNLEAPAPETACPRGGFAHVSAPTVGGTHITQVHIRLSPSSHIGTSESPRMALDGDKSLCTSGTQSLIPVAHIRPLPTGVQSVSPGPEEP
PITRPPSSFQASINRESGARVVVPIAPTYRSPGPSPYSPASAAPETKYPEELPTARPAMEPNHVSSLPGASGPSGPQPRPAPKVAPKPSLSGWTRLKKQLMEDAKEPAFP
EPELNLESTQPEVPAPMGPQPPVSRASRMWDAVLYRMSLSESHRGQPVGSGDRGHPPTCLSRLPFLCRPRFNARKLQEVVRPPPTFHPILELHSQPKNFNRTAAGWRLQ*
33 >lcl|XP_001065728.1|Plus1complement(11839164..11839601) NW_047626 small proline-rich protein 1B (cornifin) Sprr1b __SEG__ Chr2 {Rattus norvegicus} MSSHQQKQPCTAPPQLHEQQVKQPCQPPPQEPCVSQIKSPCDTKVPEPCDTKTPEPCHPKVPEPCHPKAPEPCHPKAPEPCHPKAPEPCHPKAPEPCHSKVPEPCHPKAP
EPCHPKAPEPCHPKVPEPCPSTVAPILAQQKTKQK*
34 >lcl|XP_001071871.2|Plus110650989..10651300 NW_047779 hypothetical protein LOC689749 __SEG__ Chr7 {Rattus norvegicus} MQRCRDTEKQRCRDDAEMQRCRDDAEMQRSRDAEIQRSRDAEMQRCRDVEMMQRCREAGMQRCRDDAEMQRSRDAEKQRYREAEMQRCRDAEKQRCRDAEMQR*
35 >lcl|XP_001073409.1|Plus135355736..35356410 NW_047658 charged multivesicular body protein 4b Chmp4b __SEG__ Chr3 {Rattus norvegicus} MSVFGKLFGAGWGKAGKGDPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMG
YAAKAMKAAHDNMDIDKVDELMQDIADQQELAEQTSTAISKPVGFGEEFDKDELMAELEELEQEELDKNLLEISGPETVPLPNVPSVALPSKPAKKKEEEDDDMKELENW
AGSM*
36 >lcl|XP_002727772.1|Plus1complement(43740406..43740612) NW_047334 Sec61 gamma subunit-like LOC100361694 __SEG__ Chr10 {Rattus norvegicus} MDQVMQLVEPSGQFVKDSIWQVKRCTKPDRKEFQEIAMATAIGFAIMGFTGFFVKLIHTPINNIIVGG*
37 >lcl|XP_002728013.1|Plus1complement(7351728..7352432) NW_047375 rCG21340-like RGD1310656 __SEG__ Chr12 {Rattus norvegicus} MKLNERSLAFYATCDAPVDNAGFLYKRGGRGAGSHRRWFVLRGNILFYFESESSREPLGVILLEGCTVELVDAREEFAFAVRFAGGRSRPYVLAADSQAALEGWVKALSR
ASFHYLRLVVRELEQQLAAMREGSPANALPDANPSTVLNPKPKENGRAVWSALPEQPAVAPRRPPLPPRRRASAANGPSVSFAQLHERYGLEVRALRNQWRGGLTSLEVP
CHPGSGETQTQDQP*
38 >lcl|XP_002728017.1|Plus1complement(5478108..5478611) NW_047375 protein S100-A11-like LOC100359550 __SEG__ Chr12 {Rattus norvegicus} MAALLIRAQTEAPVPDTVSRSRSPASLLNLAKMPTETERCIEFLLAVFQMHCGKGRNSRQLSKTEFLPFMNTEMAPFTKNPKDPGVLDRGMKQLDRNSDGRLDFQEFLNL
IGGLAMACHESFLGSSGSVSNPLHSLPATKSSSPPPTSSIHTCTEPTTPTTHEAHAC*
39 >lcl|XP_002728164.1|Plus11049189..1049836 NW_047428 RAB5A, member RAS oncogene family-like isoform 1 LOC100361891 __SEG__ Chr14 {Rattus norvegicus} MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFSR
AKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTPMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN*
40 >lcl|XP_002728355.1|Plus1complement(69642857..69643063) NW_047454 Sec61 gamma subunit-like LOC100361894 __SEG__ Chr15 {Rattus norvegicus} MDQVMQFVQPSWQFVKDSIHLVKRCTKPDRKDFQKIAMATATGLAIMGFIGFFVKLTHTPINKIIVGG*
41 >lcl|XP_002728559.1|Plus1complement(2216992..2217198) NW_047496 Sec61 gamma subunit-like LOC100360207 __SEG__ Chr17 {Rattus norvegicus} MDQVMLFVEPSRQFVKASILLVKGCSKPDRKKFQKIAVATAIGFAIMGFIGFFVKLIHIPINNIIVGG*
42 >lcl|XP_002729125.1|Plus115756866..15757891 NW_047626 C2 calcium-dependent domain containing 4D LOC100363111 __SEG__ Chr2 {Rattus norvegicus} MWLLEKAGYRVRTAEARALQAHASLVPKRQAPGSPLRCNPNVLTPDRIPQFFIPPRLQDPSGAEARVDRYPGGRNLPVACSLPHLAGREGWAFLPESPHTRRRESLFHRP
RGLAAGLPPAQSRLHVSAPDLRLCRAPDSDTASSPDSSPCGSPRTPRPQSLSPEEASSADTSPYAPRRAPPLFHLDFLCCQLRPTKDSVLRLGPRGGQLRLSTEYQAGPG
RLRLRLVSAEGLPRPRTRPGSGGGGCCVVLRLQPRVRPGAQRSRVVQSSCNPIFNEDFFFEGLRPPDLAARSLRAKVLDRGAGLRRDVLLGECETPLIALLPPLAGGLGP
GSSLAPAHLSL*
43 >lcl|XP_002729245.1|Plus119883671..19884300 NW_047657 mitochondrial import inner membrane translocase subunit Tim23-like LOC100362432 __SEG__ Chr3 {Rattus norvegicus} MEGGGGSSNKSTGGLAGFFGAGGAGYSNADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGALNGLRLGLKETQSMPWSK
PRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSVYALYNNWEHMKGSLLQQSL*
44 >lcl|XP_002729492.1|Plus1complement(467851..469014) NW_047697 mKIAA1238 protein-like LOC100362344 __SEG__ Chr4 {Rattus norvegicus} MCSSVTGKLWFLTDRRIQEDYPQKEILRALKAKCCEEELDFRAVVMDEVVLTVEQGNLGLRINGELISAYPQVVVVRVPTPWVQSDSDITVLRHLEKMGCRLMNRPQAIL
NCVDKFWTFQELAGHGVPLPDTFSYGGHENFSKMIDEAEVLEFPMVVKNTRGHRGKAVFLARDKHHLADLSHLIRHEAPYLFQKYIKESHGRDVRVIVVGGRVVGTMLRC
STDGRMQSNCSLGGVGMMCSLSEQGKQLDIQVSNILGMDVCGIDLLMKDDGSFCVCEANANVGFIAFDKACNLDVAGIIADYAASLLPAGRLTRRMSLLSVVSTASETSE
PELGPPASAAVDNMSASSSSVDSDPESTTERELLTKLPGGLFNMNQLLANEIKLLVE*
45 >lcl|XP_002729642.1|Plus18839079..8840668 NW_047754 karyopherin alpha 2-like LOC100359600 __SEG__ Chr6 {Rattus norvegicus} MSTNENANSTAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQP
PIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKHGAIDPLLALLAVPDLSS
LACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQK
VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLIGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVI
LDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQSHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF*
46 >lcl|XP_002729989.1|Plus1complement(1082850..1083059) NW_047800 Sec61 gamma subunit-like LOC100363239 __SEG__ Chr8 {Rattus norvegicus} MDQVIQFVEPSRQLFVKDSIRLGKRCTKPDRKELQEITMATAIGFAIMRFTGFFVKLIHIPINSIIVGG*
47 >lcl|XP_002730227.1|Plus13337501..3337707 NW_048033 LRRGT00025-like LOC100362376 __SEG__ ChrX {Rattus norvegicus} MDQVTQFVELSQQFLKDSIQLVKRWTNPDGKEFQKIAMDSEIGFAIMGFIGCFMKLIHILINNIIVGG*
48 >lcl|XP_002730270.1|Plus1350282..350443 NW_048040 translocase of outer mitochondrial membrane 7 homolog LOC100361074 __SEG__ ChrX {Rattus norvegicus} MVKLSKETKQRLQQQFQDSHLPSAGGFTSLVIYLGFIGGTDPSIPDLSILSLL*
49 >lcl|XP_002730332.1|Plus1316785..317327 NW_048045 signal peptidase complex subunit 3-like LOC100360464 __SEG__ ChrX {Rattus norvegicus} MNTLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKIL
LRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF*
50 >lcl|XP_228519.1|Plus1complement(8436183..8437076) NW_048043 syntaxin 3-like RGD1564704 __SEG__ ChrX {Rattus norvegicus} MKDRLEELKNHINHGTVSLELDDTLMFDNHAFEKTETNTIEEFLQEVAELSLALTELEGLSQLIDKKQQGVLCCTTEESVFKEKNELNIIKASFASQARLIQPQLSTIQH
ELATDCKYWRAEHRIRQSQLSFLLSHYRGIISHHYVCETQNMVRLKEKMVRQADLAGVKLQEEDLEKLVANPVPPQIVGRDLDVLKAKQGLALAEVRNQQLLELECQISE
LRTIFFQVETFISGQQELLDSIEYNILRTQDYVEQSNETVKKALKYKRQSRFLMVISTVAGLCACCTCLSCITGPLH*
51 >lcl|XP_234847.3|Plus113539843..13540223 NW_047773 nuclear transport factor 2-like RGD1565456 __SEG__ Chr7 {Rattus norvegicus} MGDKPTWEQIGSSFIQHYYQFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQPSITAQDHQPTSDSCIISMVVGQLKADEDAIMGFHQMFLLQNINDA
WVCTNDMFRLALNNFS*
52 >lcl|XP_236702.4|Plus1complement(3038858..3044326) NW_047803 xin actin-binding repeat containing 1 Xirp1 __SEG__ Chr8 {Rattus norvegicus} MADAQMQVVHTPTIQMRTGEDLPLPPPSALEGLPPPPPKESFSKFQQQRQANELRRLYKHIHPELRKNLEEAVAEDLAKVLGSEEPTEGDVQCMRWIFENWSLDAIGDHE
RPAGKEPVSGGNVQATSRKFEEGSFTNSSDLEPGPQLSGGDVRATRQLFETKSLDALTGQEEATQMTMKEPAVSGDVQGTRKLFETKPLDMLGSCPSIQDQSPLELRSEI
QELKGDVKKTVKLFQTEPLCAIQDAEGAIHEVKAACREEIQSNAVRSARWLFETRPLDAFNQDPSQVRVIRGISLEEGALPDVSATRWIFETQPLDAIREILVDEKDFQP
SPDLIPPGPDVQHQRHLFETCALDTLKGERETEAEAPAKEEVIPGDVRSTLWLFETKPLDAFRDQVQVGHLQRVDHQKGEGPVIECLSSNGTSALPLSQGVPQNNGPKGD
VKTFKNLFETLPLDSIGQGEPSACGNINRGQRTDSTGLSEGADAPVYAMQDSRGQLHALTSVSREQVVGGDVQGYKWMFETQPLDRLGRSPSTVDVVRGITRQEVVAGDV
GTTRWLFETQPLEMIHQQEQQKREEEEGRGPGGPPPELPQKGDVQTIRWLFETYPMSELAEKQESEVTGPVSKAEAQSCTWMFGSQSLNQAEGSGEQHLQTSQVQAGDRQ
TDSHVFETESLSAQGQSSGRKPVRYCSRVEIPSGQVSRQKEVFQALEAGKRGVQETVLSPGSIPTGSVHKFTWLFENCPMGSLAAESVSGGNLQEEQPKVSADPGTPERQ
ETAAERTLRTLHATPGILHHGGILMEARGPGELCLAKYVLPSPGQGRPCVQKEELVCGELPRIVRQVLGRTDVDQQGLLVQEDTAGQLRLHPLKLPGPGDPENIEDMDPE
LQQLLACGLGVSMAKTGLVMQETGQGLVALTAYSLQPQPTSRGPERSSVQLLASCIDKGELHSLPSLRWEPPTDSSSVPVTEETQRLPPTESIIRVTPLDSTMKMGHLRV
SGSTPCPPLPRAAGKVVLPNGRPGAPLQEARKQVDISHAGQKGKAASGRPEGTIAPPLGSGAPNLQEAMQNLRLATAEAQSLHQQVLSRHAQGSDPAATSISAQDVLQVP
TPTTTQGSIMPVAGRDARITAVPRKVSGDNKAVPRGLPRGRVTIQDGIYAAHPVRTSDLPGAIQPSEKEPQPRDSPPQADQGQSPRPEYHEPGGHSQRAWGPLGKVMPQI
WPECLQAADTSLKTVPLTHHTLTPKPQAAGDSLHSHNASPPTLPAAVTEEPDHPAQGHHQKDSVQQASKPLREPLLHSHNRPAGQKTLEGSETKLSKAESTVLPRKKPPV
PPKPAHLSQVHPPHRLPKPLAASASISEAGQDHKPGEPGVANPGSAKAPTIAGQGCLPLAECSKGQKQPMRQYPLSTTASRPSGGQTSNSNSQSPESRKLTILNNDNDVS
PPQKHPSSPKQQPMDGSKQRTPESPEIVQGSHQELQGLLSQVQTLEKEAAHTVNVQTLRKLFEGAPQLAGGTRQVPTAPHKTEVSVEQAFGELTRVSSKVAQLKEQTLAR
LLDIEETVHKALSSIFSFQSEGHTSSPPQGSAKDLGVKKVSTSNRARPMGSNQVKEPPAVENQEKVESRPEAQGQDEIRNHAEARGQAAVNVLPSRRLETARAEPGLQQV
SPSCRGSSSPTFISIQSAAKTLLDASSPQGSHSISGKNTHLAQDISQALLYQRDIQDQAGTKEMAIKGSVPTGQQENVLEFQTGSATSKSYGATKTVTEQYEEMDQFGNT
VLTSSTTITQQAEPLMDPRPQLGLYTFPMLRQFLHSPSRFNSDLAGAEIPWVPCSHFHPAAQ*
53 >lcl|XP_344253.3|Plus1421099..421563 NW_047428 hypothetical protein Hbld1 __SEG__ Chr14 {Rattus norvegicus} MAAARALSLTVEAFGAPIPRRQGRLLAAFPRLLTRWETTSSIPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDS
DNLAYVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKI*
54 >lcl|XP_573294.1|Plus119877780..19878391 NW_047356 RAN binding protein 1-like RGD1565297 __SEG__ Chr11 {Rattus norvegicus} MAAAKDSHEDHHTSTENADESNHDPQFETIVSLPEQEIKTLEEDEEELFKMRAKLFRFASEDDFPEWKERGTGDVKFLKHKEKGTIRLLMRRDKTLKICTNHYITPMMEL
KPNAGSDRAWVWNTHTDFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKGPGKNDNAEKVAKKLEALSVREARDEAEEKSEEKQ*
55 >lcl|XP_574959.1|Plus145563185..45563556 NW_047625 guanine nucleotide exchange factor MSS4-like RGD1563962 __SEG__ Chr2 {Rattus norvegicus} MEPCELQNELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPDLVDGSNPDGDLLEKHWLVNDMFIFENVGFTKDVGNVKFLVCADCEIGPIGWHCLDDK
NSFYVALERVSHE*
56 >lcl|XP_574984.2|Plus1complement(11885289..11885747) NW_047626 cornifin-A Sprr1al __SEG__ Chr2 {Rattus norvegicus} MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKEPCHPIPEPCNPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCQPKVPEPCHPKAPE
PCHPVVPEPCQPVAPEPCQPVVPEPCPPTVTPSPYQQKTKQK*
57 >lcl|XP_576028.1|Plus121610661..21611290 NW_047760 mitochondrial import inner membrane translocase subunit Tim23-like RGD1559672 __SEG__ Chr6 {Rattus norvegicus} MEGGGGSSNKSTSGLAGFFRAGGADYSNADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGALNGLRLGLKETQSMPWSK
PRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLAGLTLTSVSALYNNWEHMKGSLLQQSL*
58 >lcl|XP_576033.1|Plus1complement(29426352..29426867) NW_047760 mitochondrial import inner membrane translocase subunit Tim17-A-like RGD1560665 __SEG__ Chr6 {Rattus norvegicus} MEEYAREPCPWRIVDDCYGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKNRAPQLGGSFVVWGGLFSTIDCGMVQIRGKEDRWNSITSGALTGAILAARTGPV
AMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSPFGDYRQYQ*
59 >lcl|XP_576068.2|Plus1complement(5871077..5873185) NW_047761 hypothetical protein RGD1561115 __SEG__ Chr6 {Rattus norvegicus} MVDPVPEEEKEGAEPGGSEGDEATASVPPDAQGAQQPAASSASASAAAPRKVEVPCGAEGGRREQSPLLHLDLFNFACPEAEGSRYVLTSPRSLEACARCAVKPVELLPR
ALADLVREAPGRSMRVATGLYEAYEAERLAKLQQCRAERERIMREEKRRLFTPKGPAAAPASASASALSAGSSSSCSSSSSLPASPASRVARRTSPSPPARSQPPPAGSR
TGRKSHSLDSLSRRRDGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSASSAPNPLGRPSALALVPLTARSFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVP
ERDRKIAALMLARHQEERLLLEQRAAAHGQWEQQRVRAEQRREREEREKQRALEQGRRAWAAQVEERRGRRGREEREAARRRQQQCERSEERRRELAERQGLLRRERVER
AARDDRLRKLQQEQNLKQREEGLQEGRERAELVRRERAQRAARARQKQEGQLQREKRELSRAERARHEALLRGRVRQQQEEREGLRSSLEASLGRAQENYEQLQEQRARE
LRERARREELQGRRAKEAAERKEREHQAHLEALARAGERRLQHAAQVAEEAVQQKARRVIQTRLEKERAQRANKEKVERDEDCRRRELLQAIGRKLERSEQLSRERRSAL
ESARSTARASFHVREKVREETNTRSFDRMVREAQLHASLDRK*