SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus U    

ID / Description / Sequence
1 >lcl|NP_001008423.2|Plus1complement(39183579..39185699) NT_039551 hypothetical protein LOC380768 Gm1568 __SEG__ Chr12 {Mus musculus} MVDPVPEEEKEGAEPGGSEGDEATASEPPDAQGAQQPAASSASASAAAPRKAEVPCGAEGGRREQSPLLHLDLFNFACPEAEGSRYVLTSPRSLEACARCAVKPVELLPR
ALADLVREAPGRSMRVATGLYEAYEAERLAKLQQCRAERERIMREEKRRLFTPKGPAAAPASASASASASALSGGSSSSCSSSSSLPASPASRVARRTSPSPPARSRPPP
AGSRTGRKSHSLDSLSRRRDGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSASSAPNPLGRPSALALVPLTARSFSLGDLSHSPQTAQHVERIVRQVRAERGL
RGVPERDRKIAALMLARHQEERLLLEQRAAAHGQWEQQRVRAEQRREREEREKQRALERGRRAWAAQVEERRGRRGREEREAARRRQQQCERSEERRRELAERQGLLRRE
RVERAARDDRLRKLQQEQNLKQREEGRQEGRERAELVRRERAQRAARARERQEGQLQREKRELSRAERARHEALLRGRVRQQQEEREGLRSSLEASLGRAQENYEQLQEQ
RARELRERARREELQGRRAKEAAERKEREHQAHLEALARAGERRLQHAAQVAEEAVQQKARRVVQTRLEKERAQRANKEKVERDEDCRRRELLQAIGRKLERSEQLSRER
RSALESARSTARASFHVREKVREETNTRSFDRMVREAQLHASLDRK*
2 >lcl|NP_001028719.1|Plus1complement(26578515..26580380) NT_039185 hypothetical protein LOC433386 4922505E12Rik __SEG__ Chr1 {Mus musculus} MAGFHLFSPRSYGELGEPLLAGEQEFAAQLGWSELSLSPWAQTPGAEIETEVPWVHPKCSPTGRSRRRGYMTLPRESHSLTYVARRPSDRARKHRSGSLCLEGACGEAPT
KSSRTWQQQQPPRDQPSPRYPAARGDSSLQYIREAFSPPNAGTLLVENTHPGDRWAVPVGRRVGLWSPSSVLTDKSSVHSLELCKQSTQNRSNRDLTESLNKYDCPSASC
KEKSSQHAQVLKSKLDETVISLRDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERKLLLLQSQEQWQGQREQHKPQRGHGHEQPHQGYKQQGPRR
DRQARSAVRSENESEWMVQADNPEIRGLAKMDKVQAQAEHLKQCQVQSLREQERVLQSVRDLNRLQLQKRLEIAGHKREHVMMESPKKLQESNLSTVVNFQARKVLMDCQ
AKAEELLRKLSLEQSSQSSQSYQDIQKGLVKEQRHREQQAKAQTEAEQFQRRRWHAEEAEELLQVSKRVLAELAEQKSRQARSHAHKTTRDRAQHLQELNILRERNHHIL
KLTAEKEEKCHIKGIKEAIKKKEQRLAQMTSGKDPIFQEYQKGPASSKINRCFDQVAAEPQLSVHLQSGVY*
3 >lcl|NP_001032833.1|Plus194868953..94869246 NT_039606 putative mitochondrial import inner membrane translocase subunit Tim8 A-B Timm8a2 __SEG__ Chr14 {Mus musculus} MESAWSSRGTSLGSSDPQLQRFMEAEVQKQRVQLLIHHMTELCWEKCMDKPGPRLDGRAELCLVNCVERFIDTSQFILNRLEQTQKARPLFSERLSD*
4 >lcl|NP_001034604.1|Plus1complement(37762731..37763333) NT_039548 ADP-ribosylation factor-like protein 4A Arl4a __SEG__ Chr12 {Mus musculus} MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEE
AKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR*
5 >lcl|NP_001038948.1|Plus1complement(56627758..56628549) NT_039433 MAPK-interacting and spindle-stabilizing protein Mapk1ip1 __SEG__ Chr7 {Mus musculus} MYPFIPPARLLPGSPAPFLPSGPSCPQPSGPYPGPAVRVPGPTRSYVSTNVPFPELPRPNSAPTDPVGPLGTQGSMSSGPWAPGMGGQHPNVPYLFPESSPTPPLPVSGA
PPVAWVTVPPGAWEPPAQYPTPEASYPSPGLQPSPNNPYPLPPGPSAASPGPGSLHRMNEIPGGSPSDSSNPESTLESTGQKKHLKLDNKSIKRRRSKKKSKRVTWGDIK
TLTHKAESLGKQQGHNTTDPKMMLLCLMTMLHVNSQHESEGSK*
6 >lcl|NP_001070964.1|Plus1complement(44833793..44835127) NT_096135 protein EVI2B precursor Evi2b __SEG__ Chr11 {Mus musculus} MEFKYLVFIVLCQYLDNTFFSETEAITTEQQSLSTLITPSLYVTTDSQNTAGNALSQTTRFKNISSGQQASPAQITPEQATPAVYVSSSPLTYNITRQAESAVNNSLPQT
SPSGFTLTNQPSPSTYNSTGQPPKHLVYTSTQQPPSPAPTSSGKPEVESTHNQPTKSTPTIYLQRDTPPPPPPPLTSEPPSGKGTAHKNNHNAIAAILIGTIIISMLVAI
LMIILWKYLRKPVLNDQNWAGRSPFADGETPEMCMDNIRESEASTKRASVVSLMTWKPSKSTLLADDLEVKLFESSEHINDTSNLKTDNVEVQINGLSEDSADGSTVGTA
VSSDDADLALPPPLLDLDENLPNKPTVTVVSPLPNDSINPQPSPDGLNQVCEEQHSKIQEPFPPPPDSFNVPLSAGDFINNQESAHEAQCQEFSTPDLHPDLTDSLPPPP
TELL*
7 >lcl|NP_001074564.1|Plus17848128..7848778 NT_166289 hypothetical protein LOC75471 1700009N14Rik __SEG__ Chr4 {Mus musculus} MAAEGDPPVQFKLVLVGDGGTGKTAFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWDTAGQEKFGGLRDGYYIQAQGAIIMFDVTSRITYKNVPNWHRDLVR
VCENIPIVLCGNKVDVKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVVMDPALAKKYEHDLEVAQATALPDEDDDL*
8 >lcl|NP_001129589.1|Plus143549704..43550729 NT_039240 C2 calcium-dependent domain-containing protein 4D C2cd4d __SEG__ Chr3 {Mus musculus} MWLLEKAGYRVRTAEARALQAHPSLVPKRQARGSPSRCNPNVLTPDRIPQFFIPPRLRDPRGAEGRVDRNPGGRNLPVACSLPHLAGREGWAFLPESPHTRRRESLFHGP
RGLAAGLAPAQSRLHVSAPDLRLCRAPDSDTASSPDSSPCGSPHTPRPQSLSPDEASSADTSPYAPRRAPPLFHLDFLCCQLRPTKDSVLRLGPRGGQLRLSTEYQAGPG
RLRLRLVSAEGLPRPRTRPGSGGGGCCVILRLQPRVRPGAQRSRVVQSSCNPIFNEDFFFEGLRPPDLAVRSLRAKVLDRGAGLRRDVLLGECETPLIALLPPLAGGLGP
GSSLAPTHLSL*
9 >lcl|NP_001156743.1|Plus1complement(22897703..22900891) NT_039551 fibrous sheath CABYR-binding protein Fscb __SEG__ Chr12 {Mus musculus} MEECEEPEEPISLGRQEYRRRRRPSQPMVDKSQQTEITEKRKAMASVQPPAPKATHSIGNIPGSKDNYSRKEYESLRLSSQLQKTLMKRKHVQDMTDKSLQTEPIVEEKV
EVIFIDKTLKLEENTAGVGEIAPELPQSIPEVEIPTSRPTSHLIDRSQQTSCTGDWSLIYICPKEKVDKEQQTYFSELEIIIRSIPGSSMTKSKEETIPIAQEDPLVEIN
GSLEIEVLSPEELPDVMMSFTEGEISGELQALSNGEATVKGELFLTEEIPIQAPSPAEETSAAETATTTAKDVVDIQAPPADKLSSVEAPADISPTLVQGALSDKPSDQQ
YPQGTEMAPSELPVEDLDPFSEEVLEKVQALTTDSMLEDLGIAESTIAEETSGKVQHPLSEETSKEVPAEVHFPIAADFEESAILINEKFATDEVFEEYKPPIIEEVSAD
KATAEVQPPSAEDASEEVAPSEVLPPSTEQGTVEDLTAEVLSTPTEEGPTEVPPQPTEEGPAEVPPPLSEEGPAEVPPAPAEEAPAEVLPPPAEEAPAEVPPPLTEEGPA
EVPPTLTEEGPAEVPLAPAEEVPAEVLPPPAEEVPAEVPPPLTEEGPAEVPPPLTEEGPEEVPPLPAEEAPTKVPPSPAEKGSAEVSPPQTEEGPAEVPPPPAEEFPTEV
PSSSAEEGSSEVPLPPTAERPEEAPPPATEEAPVEVLPPATEEAPVEVQSPAAEEGLAEVPPPPTEESPTHDVPTEVQVPQAKESPGQVLPLSGESTAEEASAQVQPPSF
EKAPLESLPLEEVEKIHLDNLPFEVQPLPTEDIAIGVPAESQALPADENPAREDTVETQPSSFEGAPIAENPIEAPLPASEADTGREDSAVHPSSLAPTDEAPAEIQILQ
TDDIPTEMSPVENQPLPAEEGFPEVVSEEEATAAEVRFPLSEGAPAQEATVEAQLTSVEESPKRASVDVQPLSPETPVEESPGVDLPLKTNEVTMQEFRVEKMPAEDPLP
PSEQTPADQVLLKEHRLSQVADISEKELESTTLTSDKMSEGIDSVPEDVSGTKDDQISTFKIEGTIKIELKN*
10 >lcl|NP_001157087.1|Plus123911236..23911418 NT_039625 keratin associated protein 20-2 Krtap20-2 __SEG__ Chr16 {Mus musculus} MCYYGSYYGGLGCGYGGLGYGYGCGYGCGYGCGYGCGYGGYGYGCCRPLCYRRYWSCGFY*
11 >lcl|NP_001170984.1|Plus1complement(54363257..54363793) NT_039687 TTD non-photosensitive 1-like protein Gm7102 __SEG__ Chr19 {Mus musculus} MYRPNFRPPTPPYPSPGIGGWGGGNNFWGALGGGPRPPSLWDCYRSPHHTPPCGPRARPYGSRQSQQHSSNFSGVRFASPSPGGYPGSYSRSPAGSQHQFGYSPGQQQTY
PQGSPRTSTPFGSGRGREKRMSNELESYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTDKKGRYFS*
12 >lcl|NP_031507.1|Plus127798995..27799522 NT_039551 ADP-ribosylation factor 6 Arf6 __SEG__ Chr12 {Mus musculus} MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDR
EMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS*
13 >lcl|NP_033054.1|Plus1complement(2076881..2077531) NT_039413 GTP-binding nuclear protein Ran, testis-specific isoform Rasl2-9-ps __SEG__ Chr7 {Mus musculus} MAAQGEPQVQFKVVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVR
VCENIPIVLCGNKVDVKDMKVKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEEDDL*
14 >lcl|NP_033290.1|Plus1complement(41670533..41670967) NT_039240 cornifin-A Sprr1a __SEG__ Chr3 {Mus musculus} MSSHQQKQPCTVPPQLHQQQVKQPCQPPPQEPCAPKTKDPCHPVPEPCNPKGPEPCHPKAPEPCHPKAPEPCNPKVPEPCQPKVPEPCQPKVPEPCNPKVPEPCQPKAPE
PCHPKAPEPCHPVVPEPCPSTVTPSPYQQKTKQK*
15 >lcl|NP_033291.1|Plus1complement(41623381..41623842) NT_039240 cornifin-B Sprr1b __SEG__ Chr3 {Mus musculus} MSSHQQKQPCTAPPQLHEQQVKQPCQPPPPEPCVSQVKTPCDTKVPEPCHPKAPEPCHPKAPEPCHPKAPEPCHPKAPEPCHPKAPEPCHPKAPEPCHPKAPEPCHPKAP
EPCHPKVPEPCLPKAPEPCQPIVPEPCPSTVTPILAQQKTKQK*
16 >lcl|NP_034958.2|Plus110147210..10148019 NT_039492 cbp/p300-interacting transactivator 2 Cited2 __SEG__ Chr10 {Mus musculus} MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSL
PASMQLQKLNNQYFNHHPYPHNHYMPDLHPTAGHQMNGTNQHFRDCNPKHSGGSSTPGGAGGSGTPGGSGGTSGGAGGSSAGGSGGGSTMPASVAHVPAAMLPPNVIDTD
FIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC*
17 >lcl|NP_056602.1|Plus1complement(12540366..12541025) NT_039578 histone H1.4 Hist1h1e __SEG__ Chr13 {Mus musculus} MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKK
AASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK*
18 >lcl|NP_067325.2|Plus1complement(19517746..19519611) NT_039185 rab proteins geranylgeranyltransferase component A 2 Chml __SEG__ Chr1 {Mus musculus} MAEKLPTEFDVVIIGTGLPESILAAACSRSGQRVLHVDSRSYYGGNWASFSFTGLQSWLKDYQQNHDSEEGVTATWQDLIHETEEAISLRKKDETIQHTEVFCYASQDVE
DSVQDTETLQRSSPLEASATPADSLDSASLPKERQSAYSTSYEVPSRHTEESDRELSLPSANVEDSLEKEKYCGDKTDMHTVSGEDKGEHKLVVQDSIEQPKRNRITYSQ
MVKESRRFNIDLVSKPLYSQGSLIDLLIKSNVSRYAEFKNVTRILAFWEGKVEQVPCSRADVFNSKELSMVEKRMLMKFLTFCLDYEQHSDEYQDFKQCSFSDYLKTKKL
TPNLQHFILHSIAMTSESSCTTLDGLQATKTFLQCLGRFGNTPFIFPLYGHGEIPQCFCRMCAVFGGVYCLRHKVQCLVVDKDSGRCKGIIDAFGQRISANYFIVEDSYL
PKETCSNVQYKQISRAVLITDQSILKTDSDQQISILVVPPLEPGTTSVRVMELCSSTMTCMKDSYLVHLTCSSSKTAREDLEPVVKQLFIPEAEAEAGKDELRKPRLLWA
LYFNMRDSSGVSRSSYCGLPSNVYICSGPDWGLGSEHAVKQAETLFQEIFPSEEFCPPPPNPEDIIFEAEG*
19 >lcl|NP_068358.2|Plus1complement(5711062..5712654) NT_039606 vesicular acetylcholine transporter Slc18a3 __SEG__ Chr14 {Mus musculus} MEPTAPTGQARAAATKLSEAVGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGSESPTLISEVWEPTLPPPTLANASAYLANTSASPTAAGSARSI
LRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAF
ISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMV
WLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAG
HIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAMRLREVQGKDGGEPCSPPGPFDGCEDDYNYYSRS*
20 >lcl|NP_077152.1|Plus164365155..64365754 NT_039674 charged multivesicular body protein 1b-1 Chmp1b __SEG__ Chr18 {Mus musculus} MSNMEKHLFNLKFAAKELNRSSKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQGVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKSMNLEK
ISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV*
21 >lcl|NP_079595.1|Plus1complement(17004027..17004449) NT_096135 hypothetical protein LOC66050 0610009B22Rik __SEG__ Chr11 {Mus musculus} MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDEHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRLIMLHDVRHEDGIKNFFTDVYDLYIKFA
MNPFYEPNSPIRSSAFERKVQFLGKKHLLN*
22 >lcl|NP_079680.1|Plus113069039..13069644 NT_165773 ADP-ribosylation factor-like protein 4D Arl4d __SEG__ Chr11 {Mus musculus} MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSAETERLE
EARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQPGLEHLYEMILKRKKAPRSSKKRR*
23 >lcl|NP_079977.3|Plus1679024..679590 NT_039455 trafficking protein particle complex subunit 5 Trappc5 __SEG__ Chr8 {Mus musculus} MEARFTRGKSALLERALVRPRTEVSLSAFALLFSELVQHCQSRVFSVAELQARLAALGRQVGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQAND
DARTFYIIEREPLINTYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHWHKGTTLMIKFEEAVIARDRALEGR*
24 >lcl|NP_080282.1|Plus1complement(29070254..29070892) NT_039674 vesicle transport protein SFT2C Sft2d3 __SEG__ Chr18 {Mus musculus} MADLHRQLQDYLKQGKASRPAAAEPLLGAKAAEEPEAGAWLGSRVLRWPWAQSAAEPPPAGLRCLPSVTRGQRLVAGGLCLLLAALCFGLAALYAPVLLLRARKFALLWS
LGSVLAWASAALLRGGPACGRLLRGEETPSRSTLGYAAALGATLYAALVLRSTVLTALGACAQVAALLYALIGLLPWGGVTALRLALGRLNRGTGLANALPV*
25 >lcl|NP_080415.3|Plus1complement(8902625..8904979) NT_039716 armadillo repeat-containing X-linked protein 2 Armcx2 __SEG__ ChrX {Mus musculus} MSRARDAGCVAAGIVIGASAWYCVYKYTRGKDQKKKRLTKPKNRASVGTGSRARAGLRAGFTIDLGPGFSPPNPVDIEIMNKAQGEASNLATTVAEEVAPAAPSPKVQNG
AESKVQELNGAKTEANLESVVMPSATCTVTPPPKVAGGLTAAEAPEIIGAPKVLEAPSTTEASGAVAAPGPTVSPMIAQTPGPVVPSPTIVSTGPAAIPWAVAHPGAVQS
PGPAVPPMAVQSLVPAAPSWAVVAPPGAVYIPVAAHFAGPAAASRVTQSPGTVIPPLPPPSSVLPRGVPSVPGRTVQSPGAAVHPVAAQSTGVVVPPRAVQYSGAAVTSG
GAAVPSGGAATPRAAASTQRTASTEVMQVPRVAAATEATETPRIGTPAMVAEASLPVHSGAAENPGTSGSSKTAATGKKAAPGAHTGAIPKAGSATGAVPKGGGGKGGNK
NRSGGKGKNRKNKVDVDELGMGFRPGDGAAAAAAASANGGQAFLAEIPESEEGESGWTDTESDSDSEPDVPQRGKGKRTIPMHKRPFPYEIDEILGVRDLRKVLALLQKS
DDPFIQQVALLTLSNNANYSCNQETIRKLGGLPIIANMINKTDPHIKEKALMAMNNLSENYENQGRLQVYMNKVMDDIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVN
SIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLGTQVPSSFSSLYNSYVESEILINALTLFEIIFDNLRAEVFNYREFNKGSLFYLCTTSGVCVKKIRALANHHD
LLVKVKVIKLVNKF*
26 >lcl|NP_081574.1|Plus18175261..8176373 NT_039433 coiled-coil domain-containing protein 89 Ccdc89 __SEG__ Chr7 {Mus musculus} MPQEEKTLRMDTPPPDEILGKQNENLQNQDEELGFKEMDGLREALANLRGLSEEEKGEKAMLRSRIQEQSQLICILKRRSDEALERCQILELLNSELEEKRLQEMEKLKA
QSEHIQKLENHFMILASNHEQMIRFKDAHKSENVKLKEENARLRQENNSLFSQALKDQEAKVLELTTLNKALVEELEVLKQRCAHEASQAQAREEELLGLQNQQACDHAK
ETEELRSQLQSIKQQHQQATEQMGKEQEANLNLNQELQARLQTVLREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSNLRVRELQRRV
DGIQKAYDELRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
27 >lcl|NP_082119.1|Plus118408797..18409375 NT_039240 ADP-ribosylation factor-like protein 14 Arl14 __SEG__ Chr3 {Mus musculus} MGLLNSKNPQSKQAHILLLGLDSAGKSTLLYRLKFAETLSTIPTIGFNVEMVQLQSSLTLTVWDVGGQEKMRTVWDCYCENAQGLMYVVDCSEGKKRLEDSRKEFKHILK
NEHIKNTPVVILANKQDLPGALSAEDITRMFKVKKLCSNRNWYVQPCCAVTGEGLDDGFRKLTEFLKSYRRTRETLAIFKQK*
28 >lcl|NP_082362.1|Plus1complement(43624869..43625444) NT_039674 motile sperm domain containing 4 Mospd4 __SEG__ Chr18 {Mus musculus} MASTSRAPAKPQQVLVLDPPTDLKFKGPFTGLLTAHLKLRNPSARKVCFKVKSTSPRRYCVRPNNGVIDPGCTVTVAATMQPSCCGPSKEVKHKFMVQTVFAPPDISDLE
AVWREAHPGELMDSKLRCVFEPPTESDKLEDGLRLRKATHPDKPRPSSSTSLKPARSTPLPVVLLVIGAVFFGFFLGKFVL*
29 >lcl|NP_082593.2|Plus1complement(14967237..14969966) NT_039202 protein DLN-1 2810030E01Rik __SEG__ Chr2 {Mus musculus} MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERVLKTKRRRVGR
ALATKAPPPERAAAASPRPAFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVRSPCKSSLNYETAQLQGNYVAFHSDPAYFRSLLCS
KHPAAAAAAAAAAAAAAAAAAYYQTAGPQPKAATGAGGPVSLTYRCKRKRGGAKNCLLPPHAGARRLLLLPRSYKAKAAAAAAAAAAAAAAAAGATCLERFHLVNSFCPP
PHHHHHHHHHHHHHHHRAQQPTPSHHPSHHHRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGSSLSSSSNSVSSEEEEEEGEEEEEEEEEEEGGSGASDSSEISSEEE
DSSTESDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAFEDAGRLPDLKSSVKAESPEEWSLQSWAPKGTPVYCPASLGSCFPEIRNDRVSEIT
FPHSEISSTVKRTDLTINCHAEGASSPSPKTNNVFPQQRILREARKCLQATPTTHCAENSTIAARFLNNDSCGTTANSGKDSKIPHCPEFATDLPSLQSDPRVDTATAAA
AAAAATKAESLCTGTGDKTLPFLHNIKIKVEDSSANEEYEPELITNKLKWECNDAEGEFYNMTEKKEEDALVPTAKEGFACPEKETPSLNPLAQSQGLSCTLGSPKPEDG
EYKFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETHEGTLDDFTVLNRRKKVASNVASAVKRPFNFMANFPCPPSLIIGKDGDLWPAYSLNTTKDSQPP
HKAHPIWKWQLGGSAIPLPPSHKFRKFNS*
30 >lcl|NP_082792.1|Plus1complement(529225..529929) NT_039189 hypothetical protein LOC73363 1700056E22Rik __SEG__ Chr1 {Mus musculus} MSLPLRLPYCSPARRLRAVLLFPYFRDPVTPPPSPTCSQEPDSDPEGGTPESYSEEDAWLCESSHWGPVLKGSVGAVPQSWAWPGPPNAPQAPQPRHRPPPNAVPASPAA
TSPCAMFWSPQSIRPPVLGRPRPSVAQGPRRAKERQPGTASAGGKEPELGLNSQNERRLRSMEGPTPALPIPRTLSIRGVTTGRGMSPVKRSGKLSKPASALPEKYQGRY
RRMTLEFKGVEKPR*
31 >lcl|NP_083351.1|Plus1complement(5364377..5365240) NT_039492 syntaxin-11 Stx11 __SEG__ Chr10 {Mus musculus} MKDRLAELQELSRSYDQQFPDGDNDFDAPREDIVFETDHILESLYRVIQDIQDENQLLLIDVRRLGRQNVRFLTSMRRLSSIKRDTNSIAKAIKTRGEGIHQKLRSMKEL
SEQAEARHGAHSAVARISHAQYSALARAFQQAMYEYNQAEMKQRDNCKIRIQRQLEIMGKDMSGEQIEDMFEQGKWDVFSENLLADLKGARAALNEIESRHRELLRLEGR
IRDVHELFLQMAVLVEKQEDTLNVIELNVQKTLDYTGEAKAQVRKAVQYKKKNPCRTICCFCCPCVN*
32 >lcl|NP_083817.1|Plus110131603..10132145 NT_039716 signal peptidase complex subunit 3 6530401D17Rik __SEG__ ChrX {Mus musculus} MNSLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKIL
LRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF*
33 >lcl|NP_083956.1|Plus1complement(74032180..74033385) NT_039606 hypothetical protein LOC76627 1700110M21Rik __SEG__ Chr14 {Mus musculus} MLPVNKDQVLLQNTVPPGCPPQVLSQFVNSPAPNLASLCPHPTLPSSHFPLPAPPQAYFFSSLTQTHSPGPHFSSDSNSDFVPPHSSSHPRSSSCFGQNYTYFGEKLPSP
HSISPSNYQLCVSPPLTGSSSLSQLQHSSPHSCQSPSRLQDLQSPKITSPVPSSPSPRIQNNKQTWQWPQSGSIKSSRGAGVCVPSKVDPAEFKDSGTLTQALVDHVGRR
RIARDLQIQFLQRLWLGTPGHAPVVEYPICLVCLQIRTPSCPTPKYKTVPQLLAFPQLLPCVQGQESGPLRIGIGFGLRLPRGQARALHLLPPKNSTPVGVESQEEALQR
QKSTIQESVQITGTLFQARSLRSIDLQSPKPSQCSRSLLQEPRQVAASPKAGPSVSKRSVTLGSILRKSPS*
34 >lcl|NP_084099.1|Plus110092056..10092598 NT_039716 signal peptidase complex subunit 3 2900062L11Rik __SEG__ ChrX {Mus musculus} MNSLLSRANSLFAFTLSVMAALTLGCILTTAFKDRSAPVRLHVSRILLKKVEDFTGPRKKSDLGFITFHISADLEKTFDWNVKQLFLYLSAEYSTKSNAVNQVVLWDKIL
LRGENPKLNLKDVKSKYFFFDDGHGLKGNRNVTLTLSWQVIPIAGILPLVTGSGRVSVPFPDSYEIATTF*
35 >lcl|NP_084342.1|Plus18818248..8819618 NT_039716 armadillo repeat-containing X-linked protein 1 Armcx1 __SEG__ ChrX {Mus musculus} MGRTREAGCVAAGMVIGAGACYCVYRLTWGKDENEKLWDEEEEEEEEEEEKSCSDKTEKELKTNVGVGARGKPQDDSKSKVEVNVGPENGPGVKKEVHPESQSGGGLEAK
AKALFKTLKEQARAKAGRGIRLPNISRNRTLTSSLPCPGGRGGGCHPGRTGSRARNRTSGKVKRKNRSKSNKAPATAWPVRKGKFSFPYKIDDILSAPDLQKVLNILERT
NDPFTQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTRDPIIREKTYNALNNLSVNSENQGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQHLLSY
SFPDFFALLFLGNHFTKIQTMKLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKSEGLASSRKEFSRSSLFFLFKESGVCVKKIKALASH
KDLVVKVKVLKVLTKL*
36 >lcl|NP_666252.1|Plus173406464..73407555 NT_039240 translocating chain-associated membrane protein 1-like 1 Tram1l1 __SEG__ Chr3 {Mus musculus} MGLRKKNARNPPVLSHEFMVQNHADMVSCVGMFFVLGLMFEGTSEMSIAFLTLQHGVVVPAEGLPSGSRTLYHYGVKDLATVFFYMLVAIIIHATIQEYVLDKLSRRLQL
TKGKQNKLNEAGQLSVFYIVSGIWGMIILASENCLSDPTLLWKSQPHNMMTFQMKFFYISQLAYWFHSFPELYFQKVRKQDIPGQLIYIGLHLFHIGGAYLLYLNHLGLL
LLMLHYAVELLSSVCSLLYFGDERYQKGLSLWPIVFISGRLVTLIVSVVTVGLHLAGTNRNGNALSGNVNVLAAKIAVLSSSCSIQVYITWTLTTVWLQRWLEDANLHVC
GRKRRSRARKGTENGVENPNRIDSPPKKKEKAP*
37 >lcl|NP_666267.3|Plus12497099..2501883 NT_039267 AT-hook DNA-binding motif-containing protein 1 Ahdc1 __SEG__ Chr4 {Mus musculus} MRVKPQGLVVTSSAVCSSPDYLREPKYYPGGPPTPRPLLPTRPPASPPDKAFSTHTFSENPRPPPRRDPSSRRPPVLAKGDDLLPPRAARPVSQAHCPSPAPDNSSLRHW
DNGRVNLRPVVQLIDIMKDLTRLSQDLQHSGVHLDCGGLRLSRPPAPPPGDLQYSFFSSPSLANSIRSPEERANPHTKSERPSHPLYEPEPEPRDSPQPGQGHGPGAAAT
ATGLPPEPEPDGPDYSELADADILSELASLTCPEAQLLEAQALEPPSPQPEPQLLDPQPRFLDPQALEPLGEGLELPPLQPLADPLGLPSLTLQALDTLPDSLESQLLDP
QALDPLPKLLDVPGRRLEPQQSLGHCQLAEPLRLDLCSPHGPPGPEGHPKYALRRTDRPKILCRRRKAGRGRKADSGPEGRLLPLPMPTGLAAALAEPPPLPPPPPPTLS
GPGPVPELEPESSQTPMVPTRKGKCRGVRRMVVKMAKIPVSLGRRNKTTYKVSSLSSSLSVEGKELGLRVSSEPTPLLKMKNNGRNVVVVFPPGEMPIILKRKRGRPPKN
LLLGPGKPKEPTVVAAEAATVTAATMAMPEVKKRRRRKQKLASPQPSYAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPSEPESVHQAPDTQSISQFLHRVQ
GFRRRGGKTGGFGGRGGGHAAKAARCSFSDFFEGIGKKKKVVAVAAPGLVGPGLTELGHPRKRGRGEVDAVTGKPKRKRRSRKNGTLFPEQVPSGPGFGEAGAEWVGDKG
GGWAPHHGHPGGQAGRNCGFQGTEARAFASTGLESGASGRGSYYAGAPSGQTELSQERQNLFTGYFRSLLDSDDSSDLLDFALSASRPESRKASGTYAGPPSSALPAQRG
LATFPSRGAKASPVAVGSSGAGADPSFQPVLPSRQTFPPGRATSYGITPATSDCRAAETFPKLAPPPSAVARSPTTHPPANTYPPQYGGYGAGQSVFASAKPFSGQDCAN
SKDCSFAYGSGNSLPASPSSAHSAGYAPPPTGGPCLPPSKASFFNSSEGGPFSGSAPTPLRCDSRASTVSPGGYMVPKGTTASAASVASSSSSSFQPSPENCRQFVGASQ
WPFRQGYGGLDWASEAFSQLYNPNFDCHGSEPNVILDISNYTPQKVKQQTAVSETFSESSSDSTQFSQPVGGGGFRRANSEASSSEGQSSLSSLEKLMMDWNEASSAPGY
NWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFSTSTSATASGYPSKRSTGPRQPRGGRGSGACSAKKERGGTAAKAKFIPKPQPVNPLFQDSPDLGLDYYSGDSSMSPLP
SQSRAFGVGERDPCDFMGPYSMNPSTPSDGTFGQGFHCDSPSLGAAELDGKHFPPLAHPPTVFDAGLQKAYSPTCSPTLGFKEELRPPPSKLTACEPLKHGLQGASLSHA
AQAHLSCRDLPLGQPHYDSPSCKGTAYWYPPGSAARSPPYEGKVGSGLLADFLGRTEAVCLSAPHLASPPATPKADKEPLEMARPPGPPRGPAAATAGYGCPLLSDLTLS
PVPRDSLLPLQDTAYRYPGFMPQAHPGLGGGPKSGFLGPMAEPHPEDTFTVTSL*
38 >lcl|NP_666746.1|Plus1complement(9990877..9991827) NT_039578 olfactory receptor 1370 Olfr1370 __SEG__ Chr13 {Mus musculus} MNLGNESAPKIFILLGFSSHPWLEMPLFIMVLVAYVCTVLGNISIIVVSRRDPQLDSPMYFFLSNLSFLDLCFTTTTIPQLLRNLWGPDKSISYGGCVTQFYIFHFLGAT
ECILLAVMSLDRYIAICKPLRYPAIMHQQLCILLVSMAWLSGLANSLLQSTLTVKLPFCGNNKVDNFLCEVPVMIKMSCANTAFNIAMLSIVGTFYSLVPLSLILISYGF
IVATVLRIRSSEGKKKAFNTCGSHVVVVTLFYGPVISMYVQPSSSNSQDKNKLLSLFYSLVTPMLNPFIYTLRNKDMKGAMKRLLVSLYHKGAEQT*
39 >lcl|NP_777364.3|Plus1complement(54485..55675) NT_166287 cysteine protease ATG4A Atg4a __SEG__ Chr3 {Mus musculus} MESVMSKYENQILIFPDYLEEFPDTDELVWILGKQHPLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWNWERQKEQPKE
YQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVIKKTHFI**MEFLGCLCFHG*HSGH*RYQENVLCSSCGCC*PSW*FSDCIQSE*RHLCPVLSLETP
AAHCAPSPGHKPNQSCVC*SIQRVF*DATVFRGFRRKAK*RLLFHRILRR*AHFFGPSHNPDFC*H*REWTSRRPDFSLPAVSTADEYPELGSFCGLGIFLQRRERL**L
V*PCSEGNSKGEFEDV*IGSEAPITLASLCTSSQARSDNHRGRIHRVD*TTGGL*AGGRF*NSECRL
40 >lcl|NP_777620.1|Plus1940442..941317 NT_039353 GTPase, IMAP family member 9 Gimap9 __SEG__ Chr6 {Mus musculus} MAGQGDTEVRIILVGKTGNGKSATANTILGRRQFDSKICANAVTKTCQRAYREWKGKNLVVVDTPGLFDTKETMKTTCFEISRCVLYSCPGPHAIILVLRLDRYTEEEQK
TVALIKGLFGEAALKYMIILFTHKEDLEDQSLDNFVSDAGEKLNNIISQCGKRYLAFNNKAALDEQENQVQQLIELTEKMVAQNGGSYFSDKIYKDIDSRLNHCLEELKE
TYAQQLTSEIERIEKEYAAKLEKGKAAQIVFAQRNHDEKLRNLKEKAEETVFMYIFQKIKEILSKLWDELW*
41 >lcl|NP_778154.1|Plus1complement(42603104..42605302) NT_039649 TIR domain-containing adapter molecule 1 Ticam1 __SEG__ Chr17 {Mus musculus} MDNPGPSLRGAFGILGALERDRLTHLKHKLGSLCSGSQESKLLHAMVLLALGQDTEARVSLESLKMNTVAQLVAHQWADMETTEGPEEPPDLSWTVARLYHLLAEENLCP
ASTRDMAYQVALRDFASQGDHQLGQLQNEAWDRCSSDIKGDPSGFQPLHSHQGSLQPPSASPAVTRSQPRPIDTPDWSWGHTLHSTNSTASLASHLEISQSPTLAFLSSH
HGTHGPSKLCNTPLDTQEPQLVPEGCQEPEEISWPPSVETSVSLGLPHEISVPEVSPEEASPILPDALAAPDTSVHCPIECTELSTNSRSPLTSTTESVGKQWPITSQRS
PQVPVGDDSLQNTTSSSPPAQPPSLQASPKLPPSPLSSASSPSSYPAPPTSTSPVLDHSETSDQKFYNFVVIHARADEQVALRIREKLETLGVPDGATFCEEFQVPGRGE
LHCLQDAIDHSGFTILLLTASFDCSLSLHQINHALMNSLTQSGRQDCVIPLLPLECSQAQLSPDTTRLLHSIVWLDEHSPIFARKVANTFKTQKLQAQRVRWKKAQEART
LKEQSIQLEAERQNVAAISAAYTAYVHSYRAWQAEMNKLGVAFGKNLSLGTPTPSWPGCPQPIPSHPQGGTPVFPYSPQPPSFPQPPCFPQPPSFPQPPSFPLPPVSSPQ
SQSFPSASSPAPQTPGPQPLIIHHAQMVQLGVNNHMWGHTGAQSSDDKTECSENPCMGPLTDQGEPLLETPE*
42 >lcl|NP_780683.1|Plus18316592..8317392 NT_078458 family with sequence similarity 109, member A Fam109a __SEG__ Chr5 {Mus musculus} MKLNERSLAFYATCDAPVDNAGFLYKRGGRGTGSHRRWFVLRGNILFYFEAEGSREPLGVILLEGCTVELVDAREEFAFAVRFAGGRSRPYVLAADSQAALEGWVKALSR
ASFHYLRLVVRELEQQLAAMREGSPANALPANPSPVLTQRPKENGWVVWSTLPEQPSVAPQRPPPLPPRRRASAANGPLASFAQLHARYGLEVQALRDQWRGGQAGLASL
EVPWHPGSAETQTQDQPALRGHSGCKVLHVFRSVEWPVCNPGSQGT*
43 >lcl|NP_780700.1|Plus126096408..26098765 NT_096135 Smith-Magenis syndrome chromosomal region candidate gene 8 protein homolog isoform 2 Smcr8 __SEG__ Chr11 {Mus musculus} MISAPDVVAFTKEDEYEEEPYNEPALPEEYSVPLFPYASQGANPWSKLSGAKFSRDFILISEFSEQVGPQPLLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGS
AYPKLNFVEDSKVVLGDSKEGAFAYVHHLTLYDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSKASECLKMGNRKAFAGELEKKLKDLDYTRTVLHTETEIQKKAN
DKGFYSSQAIEKANELANVEKSIIEHQDLLRQIRSYPRQKTKIPDLQPGDTEHTQDQADQVSTTSNPEESANADLYTCRPAYTPKLIKAKSTKCFDKKLKTLEELCDTEY
FTQTLAQLSHIEHMFRGDLCYLLTSQIDRVLRKQQPITNFLFEDFVEVDDRMEKQENVPSQPSQDRLPPKPVEECPIPKVLISVGSYKSSVESVLIKMEQELGDEEYTGV
EATEARSFDPQENLDYLDMDMKGSISSGESIEVLGTEKSASVLSKSDSQASLTVPLSPHVVRSKAVSHRTISEDSIEVLSTCPSEALIPDDFKASYPSAINEEEAYADNE
GAIHFQASAGSPEPDETQEGNLENIPSQIDSSCCIGKESEGHLVPLPTPAYTLSDEDSVVSIPPQRYIQKDQGLHVDFGVENTDPSPRDNSCEMFPAYELDPSCLLASRD
VSKMSLDNYSDTTSYMGSAASTSSDRIPSAPPAGLSSERHKKRAGQNALKFIRQYPFAHPAIYSLLSGRTLVVLGEDETIVRKLVTALSIFVPNYGCYAKPVKHWISSPL
HIMDFQKWKLIGLQR*
44 >lcl|NP_796279.2|Plus1complement(3253983..3254561) NT_078297 ADP-ribosylation factor-like protein 4C Arl4c __SEG__ Chr1 {Mus musculus} MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHK
VTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR*
45 >lcl|NP_796311.2|Plus134364624..34365154 NT_039606 ADP-ribosylation factor-like protein 11 Arl11 __SEG__ Chr14 {Mus musculus} MGSVNSRGHKAEAQVVMMGLDSAGKTTILYKLKGNQLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATWKDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDP
NMAGVPFLVLANKQEAPGALPLLEIRNRLGLEGFQKHCWELRACSALTGQGLQEALQSLLHLLKSR*
46 >lcl|NP_808389.2|Plus1complement(22996018..22999335) NT_039687 ran-binding protein 6 Ranbp6 __SEG__ Chr19 {Mus musculus} MAAAGSAGLPATVSEKQEFYQLLKNLINPSCMVRRQAEEVYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPPEVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDESGTNHWPEGLKFLIDSIHSKNVVLWEVALHVFWHFPGIFGNQDRHDLDIIKRLLDQCIQDQEHPAIRTLSARAAATFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDDDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKVVLPMTKEHIMQMLQSPDWKCRHAGLMALSAIGEGCHQQMEPILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
SFQKKFHEIVITALLRTMENQGNQRVQSHAASALVIFIEDCPKSLLILYLENMVKSLHSILVIKLQELIRNGTKLALEQLVTTIASVADAIEESFIPYYDIFMPSLKHVV
ELAVQKELKLLRGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGKDFEQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKMMVPLLKFYFHDNVRVAAAEAMPFLLECARIRGSEYLSQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGGILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAIGKILKF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLNFLCDLIESNHPVVIGPNNSNLPKIISIIAEGKINETISHEDPCAKRLANVVRQIQTSEELWLECTSQLDDEQQEALHE
LLSFA*
47 >lcl|NP_848889.3|Plus1819939..820862 NT_039638 proline-rich protein 18 Prr18 __SEG__ Chr17 {Mus musculus} MLRLLGRVMSFLPMPPPPPPPPPPPRTPGGPAARQLSRRPCAPPAPSPPAASAAGGEKKRRPPEMLLSSSWPSATLKRPPVRRGPGLGSGTPQPATSARVPPQPSPGRGG
TSTTCSAPRRVACSHIPAGSTASGTSAGAGAGPDDATRFSLNLTPEAILVIQRRHLEKQLLARPRRPFPTPSADPRLPLVPCPRTRASTLRRGGPTSVPNAPLAVAVSSR
PPRASLLPGGLQATLPSPCPSSLRPVLKVSLLNEKHKYDDEEYEEEVEVVDEGLVRKCTEWLRGVESAAAARGRTGHLDSLPHLSTL*
48 >lcl|NP_862902.1|Plus110877844..10880252 NT_039455 zinc finger protein 828 Zfp828 __SEG__ Chr8 {Mus musculus} MEVCQELRKPALSLECGHCSFRGTDYENVQLHMGSIHPEFCDDMDAGGLGKLIFYQKSAKLFHCHKCFFTSKLYANVYYHITARHAASDKWSEQPKEQPSKDTESGKSPS
PPERQNPAFDPAEARPTPALPMEAQKTSPSLCPESQASGPPVLEPQGAGPLISPEPQAPCLPAEASKAAPVPCPERVDPPCELPELEKPERGPSPESVKSALVSSKPPKH
SSFADTGAAPSALSPESPVLATSPEPWGPSLSASPESRKPARTASPEPRKPSPAESPELWKPFPAIASEPRRPTPAVSPGSWKPGPPGSPRPWKSSPSATSGPWKSSKPV
QPMSPGPWKPIPSVSPGPWKPAPSMSTASWKSSVSSGSWKTPPTSPESWKSGPPELRKTALPLSPEHWKAVPPVSPELRRPGPPLSPEIRSPAGSPELKKPSSSPDLWKV
SPDQRKTSPASLDFPEPQKSSCGSPPDLWKSSFIMESQKPNVFSETRKHTASGSSESPKVASDIWKPVLSIDAEPRKSTLFPEPTKAVLPASPEPRKRALFPESRKHVFL
PELPKSAVFSDAQKAPELSEEIQLEAVDNAKCDSLAQEGLLATPKKLLDEALSPSSKKLKKDSQENSDAELSSSEYIRADLDTLDTKGQESSSDQEQVDVESIDFSKENK
MEMGSTEQAKNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAHGQSLLKCPRCNFESNFPRGF
KKHLTHCQSRHNEEVNKKLMEALESPLEEQQI*
49 >lcl|NP_932771.1|Plus1complement(52252730..52254880) NT_078575 exocyst complex component 8 Exoc8 __SEG__ Chr8 {Mus musculus} MSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRVQALAEETAQNLKRNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLALLPAAAAGAS
AGEDTAGAGPRERGAVQAGFLPGPAGVPREGSGTGEEGKQRTLTTLLEKVEGCRDLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNA
LYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSDKRRREQEEAAAPRAPPPVTSKGSNPFEDEDDEELATPEAEEEKVDLSMEWIQE
LPEDLDVCIAQRDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAAAVHTAIRQLRIE
GATLLYIHKLCHVFFTSLLETAREFETDFAGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGEIGLDLTFIIHALLVKDIQGALHSYK
EIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDYSLRCEQDPE
KKAFIRQNASFLYETVLPVVERRFEEGVGKPAKQLQDLRNASRLLRVNPESTTSVV*
50 >lcl|NP_997163.2|Plus1complement(25341672..25342643) NT_039185 coiled-coil domain containing 121 Ccdc121 __SEG__ Chr1 {Mus musculus} MLAQSPGDAPPPTPHLTILNTYLKPKLLTSLEKRVKRKTVVAMKELSQQIQETKCRRERLLKDSRQLLEEKYRVQAENQLFMEYLRKNKEQCEKKQEELWKQYVQECGEI
ERERQELASRYNQRNAALQAQLLQGRKTQKDLKQQLQALKPVYKIKEGQDVKIQTLEKEQEKVRSETATKDREAHFQFLREKALMEKELQEWHLMELGQINTTGLTRKYK
ALALAAKQAHSEFCGSLHRENQQLRKELQQLSQEYGRLDAVRSQLEKHRQLAKEQQWYLEALTRGRQRLQAERERHHRGHNPRLKEQRASKTMLSTKSKASSK*
51 >lcl|XP_001003873.1|Plus1complement(67531310..67531840) NT_039649 nuclear transport factor 2-like Gm9386 __SEG__ Chr17 {Mus musculus} MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISIVVGQLKADEDPIMGFHQMFLLKNINN
AWVCTNDMFRLALQLRLTSSWPQSRCFLLPLPNPSSLLQMLQISYTNEQGRGGSGCRALLSPRCCA*
52 >lcl|XP_001473221.1|Plus1complement(9449248..9450837) NT_162143 importin subunit alpha-2-like isoform 1 Gm10259 __SEG__ Chr3 {Mus musculus} MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQP
PIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLST
LACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQK
VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVI
LDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF*
53 >lcl|XP_001474007.1|Plus1complement(7483081..7483464) NT_039674 nuclear transport factor 2-like Gm10349 __SEG__ Chr18 {Mus musculus} MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNIND
AWVCTNDMFRLALHNFG*
54 >lcl|XP_001474231.1|Plus123888637..23888822 NT_039625 hypothetical protein LOC100040288 Gm2692 __SEG__ Chr16 {Mus musculus} MCYYGSYYGSLGYGYGGLGYGYGCGYGCGYGCGCGYGGYGGYGYGCCRPLCCRRYWSCGFY*
55 >lcl|XP_001474441.1|Plus124012309..24012473 NT_039625 hypothetical protein LOC100040445 Gm2775 __SEG__ Chr16 {Mus musculus} MCYYGSYYGGLGYGYGCGYGCSYGGLGYGYGYGRFGYGCCSPCCCGRYWSYGFY*
56 >lcl|XP_001474476.1|Plus123856461..23856625 NT_039625 hypothetical protein LOC100040281 Gm10061 __SEG__ Chr16 {Mus musculus} MCYYSGYYGGLGYGYGGLGYGYGYGCGYGCGYGGYGYGCCHPLCCRRYWSCGFY*
57 >lcl|XP_001476807.1|Plus1complement(11868458..11868664) NT_039474 protein transport protein Sec61 subunit gamma-like Gm10144 __SEG__ Chr9 {Mus musculus} MEQVMNFVEPSRQFVKDSVRLVKRSTKPDRREFQKLSMATAVGFAIMGFIGFLMKLIHIPINNNSVGG*
58 >lcl|XP_001478063.1|Plus120318308..20318913 NT_039472 transmembrane emp24 domain-containing protein 2-like Gm10698 __SEG__ Chr9 {Mus musculus} MVTLAELLALLAALLATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTI
DIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV*
59 >lcl|XP_001478570.1|Plus123843037..23843243 NT_039472 protein transport protein Sec61 subunit gamma-like Gm10177 __SEG__ Chr9 {Mus musculus} MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG*
60 >lcl|XP_001478849.1|Plus1complement(24909389..24910048) NT_039578 transmembrane emp24 domain-containing protein 10-like Gm4024 __SEG__ Chr13 {Mus musculus} MSGLFGPLSRPGPLPSAWLFLLLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGLRPHLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFE
SKGTGQIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE*
61 >lcl|XP_001479532.1|Plus1complement(38106307..38106513) NT_039170 protein transport protein Sec61 subunit gamma-like Gm11575 __SEG__ Chr1 {Mus musculus} MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG*
62 >lcl|XP_001480211.1|Plus131672432..31672638 NT_039500 protein transport protein Sec61 subunit gamma Gm4184 __SEG__ Chr10 {Mus musculus} MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG*
63 >lcl|XP_001481264.1|Plus1complement(76501853..76503442) NT_039649 importin subunit alpha-2-like isoform 1 Gm10184 __SEG__ Chr17 {Mus musculus} MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQP
PIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLST
LACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQK
VIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVI
LDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF*
64 >lcl|XP_003084555.1|Plus169474023..69474232 NT_039207 protein transport protein Sec61 subunit gamma-like LOC100503333 __SEG__ Chr2 {Mus musculus} MDQVMMQLVESSWQFIKDSIWLVKRCTKPNKKEFQKIAMATAIGFAIMGFIGFFMKLIHIPINNIIMGG*
65 >lcl|XP_003084563.1|Plus1complement(94063805..94064011) NT_039207 protein transport protein Sec61 subunit gamma-like LOC100504160 __SEG__ Chr2 {Mus musculus} MDQVMQFVEPSQQFVKDSIRMVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG*
66 >lcl|XP_003084578.1|Plus128407603..28407863 NT_039207 signal recognition particle 9 kDa protein-like LOC100503508 __SEG__ Chr2 {Mus musculus} MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAKESRNVTMETE*
67 >lcl|XP_003084777.1|Plus138367930..38368097 NT_039433 mitochondrial import receptor subunit TOM7 homolog Gm7226 __SEG__ Chr7 {Mus musculus} MVKLSKEAKQRLQQLFRGGQFAIRWGFIPLVIYLGFTRGADPGMPKPSVLSLLWG*
68 >lcl|XP_003085103.1|Plus1complement(3710396..3710602) NT_039618 protein transport protein Sec61 subunit gamma-like LOC669751 __SEG__ Chr15 {Mus musculus} MDQVMQFVEPSRQFVKDSVQLVKRCTKPDRKEFQKIAMATAIGFSITRFIVFFVKRIHICINNITVGG*
69 >lcl|XP_003085157.1|Plus123838237..23838404 NT_039625 hypothetical protein LOC100502776 LOC100502776 __SEG__ Chr16 {Mus musculus} MCYYRGYYGGLGYGYGGLGCGYGCGYGYGYGGYGGYGYGCCRPLCCRRYWSCGFY*
70 >lcl|XP_003085339.1|Plus1complement(12183704..12183910) NT_039716 protein transport protein Sec61 subunit gamma-like LOC632883 __SEG__ ChrX {Mus musculus} MDEVMQFVEPSQQFVKDSIWLVKRCSKPYRKEFQKIAMATAIGFAIIGFTGFFMKLIHIPINNIIVGG*
71 >lcl|XP_003085436.1|Plus1complement(11370195..11370674) NT_096135 vesicle transport protein SFT2A-like LOC100503863 __SEG__ Chr11 {Mus musculus} MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVF
TLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSLLG*
72 >lcl|XP_111398.7|Plus149617321..49628618 NT_078575 zinc finger protein 469 Gm22 __SEG__ Chr8 {Mus musculus} MPGERPPTLPRDLQPCQIARSLGCPSQHPLKDHGSASRTTQGMRDDGSKAQGSPEAQLSQAKDVEQEDLILRVQAPAARSYAHVYPWPASRMESGHPQLHSLSPSRIRCI
LGEPLKDLRHEAPQVSDTKVPQGQKTRARHRPGIPRAKALPSPEENSSQRCFQEASSSFTSTNCTSPSATPGSLPRRAPQSDGTSPHRHASGTNLQAIGTNPWPPAAENS
FPGANFGVSSAEPKPFPDGSRPSSPQGVSAPYPFPVETVQHERAAETMLFTFHQPLVAWSEEALGTNPAYPSLPCNPGPSGGASAPSDLGGALSPPGAARLLPSPFHDSL
HKSLTKGIPEGPLPARDGLGSPRGLPNPPPQRHFPGQGYEANGVGTSPASLDTELPTPGPPPTHLPQLWDTTAAPPYPTSTLDPAAAARTAFFESQQQLCLPHSPPLPWS
PVLTTPGPNSHQMGVLSQLTFPRGSSEWQGDSPGTLGALNTIPRPGESALRSSPGQPSSSPRLLAYGGLKDPGTQPLFFGGAQPQMSPQGALSLPPPRVVGASPSESPLP
SPATNTASSSTCSSLSPPSSSPANPSSEDSQQPGPLRSPAFFLPPTHSQETSSPFPSPEPTYTLPTRYQSETAKAFPLPTEGPGAEDAFKSQEGAPFSHKSPSLGRDGLK
GFPPEPPPPPPPPPYSAQHFSLSSASLDQLDVLLTCRQCDRNYSSLAAFLEHRPLCSLLLTKTKDGSLQPPGLPTPTTTSKAPTDAHSALLEHNQTVPFLLTRDDPAVTS
FPLPTSDLDMEDDAKLDRLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGSRGPSTGHPLNNQVGSISKNGTQPQLPSKAAVPEPQAPCTGNRSHPARNRPKTRSLGLA
SVQADATTLVRQQRRGKQFKLFRKEPGMAKGTNSQAKAICLRPRKKGHSAEHPRPQARKSQTRKGHARADHSISRATSKETRSSKHLQLPSGKDSRKRRGRGGSWSKELI
HKIVRQKNRRHGQQAPRNQVSHVPPLPGRPPSTQEGRLSGQGCASESEEEAGMQQRRDLGGPAQGCSPHSRQRWRQGKKRKKEDLTQNPRKVMRQEAGENGGSPTPRTQS
LLPSSEAGEVSVERGLEHRGHPIIAPKHPPRVLATTKTQEKNHAALDFPQEGEKPEVAADTTELRERPSSPAHCGGESPRPAAPVPARAGSPSGSHPETLSGNSVPVPDA
GCLLGTSGCMKPPTLHTREDSASQPGRCLVPIDKLADMFYTESSLPVFKNSSPGCDPDHCDRRSLECPAAKRGSLPNSDTCELFLGSKDLAYCFPDDLYTKPLAMDPLPA
RSCYLSQDSMETLESTPSKSPPYPVETDPGKVHSPLTLESTSLFAGLPEDGFDPPLYDNLSANRVTHGPLAGPDPLPKKPLADPLYPPFLLLEEISPVLPGSFPGLSKGK
TVSKQCPSEQTVPPRPPAVPEKGSECSNLCEDELEIKRLVTELESQLQGEGSTVGTSGEPEEATQEGKMDTSPKQASLLPTNPATSAQREPAEDITGLEGSSSHQERALK
NPQKQWPYPASCHTEKAAPPCGIQENPGCGAPLSLEGFTLGLQRTRETIIPDADSQIPLSDRLPDSSNQQVALLHAGSLAKDSPKHGLLFPKNNEAPGTQNSNAPPLLPG
KHTRGHSLDPFCEAQEPCPTSPALEGFNSPSAHPALEPNLILKGDEEVTSLPSASLSHGSKGHSEDQAGSSIGAVLNKPIAKDLDFKGASAPAGTSPQSTLQSGGRAWSH
PVPDPPWEPSASIGQRRQDPACCSFPLRQVLDATAKSRENAQGLQSGDPSVTGGARMKEDSSRAVNVSALPANIQKQLRSKADGRLGSPSQPEKIKGQGQANRLQPKSWR
SLEDPDALNKVSAHLEARPARGRRPRQGNRAARGLRRQALFSTSPTDPDSTSLLPIQKACPLQKEPAERSPEKAASPQPLFSQENPAPSNRDLAACVFSTRPQATPTPSD
LEPMPQEDPETRVKPSKPLAPSSYRDLPSPDDQPTCPVLVPLGASYGLTTKEAEPPASPTLLVTSCCGPEEPLSQHSLLGTSSPKDPPVGSLGSISFSAPVLLERNSPKG
IAVRTLEDSGKEELRLSPAHSSAPPLGDPSSPKMTIEAAPLTSIAPKDGLDSGETLEVPAPHCMGAPSLSNPERTYSKGPSLGPVSSTPCPGHGEGRGIIAVPTDLATLE
TTGPDSQICQEDGADVSIKEQDNPETPGTRHCNVTKVARANARGMPTGLHLTLETPLSGTSSDSRSDSPQYHISISHRPPQKNFSDPQDHKRRPRGLNKKPEHAEQTPAE
LPETCQLCSASFRSKAGLSRHKARKHRPQREPRSLLSPMPVPACQPSDPMTKACQTPGKKSHKVSEKGRPSRPALGAGRSSGPPPLQDTMGPEILKRTSEKSEGAGTLDT
PLSQHPPTLGLSEQGESAEVPASKPRRADRWGTNQLHPDQTEVRGKRQGGQPADSPSHPERKPNRKGVKLRARRQKHGPGGTTHVTSDLPTACGHPLIPLSLSPEGGCRP
AVRPPPPSSTGGPRALEDAEDVGPGALCTEEVPAQKAPQEHPVCQGTIEKEHPVEQKATWTQWFWGPEEATASDISGEPSRAIESQPTEDHTGVKGRSDEGTGKGTPDLP
DRTHSSEVDNTISSYPQGPIKDPETQNEVHGSDGAPSPEQRDPPDLFDDDISFSRLFPLDGRLTQKNLRVYGKRCQRPKCPSPKEPIAEVINSVSLGSTRLPTDLSDSGS
LCLSREEEDVWDDEVMSLPESLLLDGLLSNKTPGLDPWTPSLSLWALESDRQTSCVEEKPSCLMENQDEWSEPIPQLHMVPAAWRDLEHCSPACETASSVGDMSPEPPNL
EREHDNRPPGNASLPPLYVKDFEALSTQLEIQDLCFLRPCSDLVELSNPGALDFQVTANSQGPPDKRMEGTARARRAKGRDLRVKGKRASYKCRVCFQRFHSLGELDLHK
LSHSPSPPPTCYLCVERRFSSRELLREHLWEKHVQGKAGPWACGMCLKEVADVWMYNQHLREHAARFARNGQARRALGDLPGCLEGESALTHFLNTIVERASKPQRTKRS
IGKDSREPSEQEGDAGKKTPRRMKRKARASVTPSQDGAEGGSLSVLTSSSATCSDSAKTPPAPSPDPWSHGESPLQAVPVHEDCKDPSRDCHHCGKQFPKPFKLQRHLAV
HSPQRVYLCPRCPQVYPEPWELKVHLGLTHGVTEEKELPHVPLYACELCANVMHVIRRSFVCSSCNYTFAKKEQFDRHMGKHLSCDLQPFTLRSVKRPGVPRRKTRVSQD
VLPSKQNRLMAPFSPPELSTDRIPSTTSPTPSEVSLPALPLAPSLILDQPSSQENPVDQADHSPRGNNLPLSGQDLPPPSLSPFSAASAEGTGGCCKLNRTLEKPEHEAS
LGSLEPCKWQALVGEKRALHLFPGKHKSPGNGDKCAPGCSPGHPSQLQERLVTTHHMAPEGRIEGPSQKGNATKPGAYSSTSHHRAAEPTKKALKPPAPPRKPGGMGIPA
AELVLSPEDRVKPNTSKGKLRGTPQSSGGLQPGTQTGGGSQPQPTSGQLQSEMASTPTEPSCPSWASSTPDQPPPRAHTKGSTRGPGDAVHQGVQVHSSPREKRESHGRQ
RKGQALGLGRHGSVGNTGKAPLAPDKSSRAPRKQATPSRVPPVKSRPSGQSSRARPQPSAQRKGDPGHTSEKGSLPQARALSRPYKRVRALHVSGVAPMEPRDRRTAEAQ
SDLLSQLFGQKLTSFRIPLKKDSSQ*
73 >lcl|XP_485041.3|Plus1complement(44700459..44700935) NT_039207 trafficking protein particle complex subunit 6B-like isoform 1 Gm13880 __SEG__ Chr2 {Mus musculus} MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENTGFRVGQGLIERFTKDTERFKVELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQ
YLEHASKYLALTCGLIRGRLSNLGIKSIVTAEVSSMPACKFQVMIQKL*
74 >lcl|XP_485050.4|Plus1complement(57394881..57395723) NT_039207 ras-related protein Rab-5B Gm13991 __SEG__ Chr2 {Mus musculus} MDTENVVRGVWLSCSCLSVPHRLGPYGGYGAPGLLRPGSPSPSPSPFATLWHSPPSTFSYFDNLAMTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQF
HEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDN
SLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN*
75 >lcl|XP_896829.2|Plus1complement(32811821..32814853) NT_039674 hypothetical protein LOC381148 Gm1614 __SEG__ Chr18 {Mus musculus} MLTALAPLALPGLSRRLPAPAGRQDSSGSSGSYHTAPGSPEPPDVGPDTEGRGTWLWVAPGRGAGAQPVLSVSAQNSRQQHGSGSGFPRGPGSGPLPPRPQLRMLPSGEM
EVIFGAGPLFNRSDAEDLQEQQLMAPTFSSPQLPGPASPASVSSQPQVPDGGSRWATYLELPPREPSPAVSGQYECVEVALEERSAPVRPRTVPKRQIELRPRPRSPSQD
SRAPRPRLLLRTGSLDESLSRLQAAAGIVQTALARKLGSAVPAPSNVTFKSTAKPESTTNSQETTDSTRVLLEEAKSRPPRAHDNSSSARVPRPWPSLRERAIRRDKPAP
GTEPLGPVSSSIFLQSEEKPHQAYKQESKTQFPRETPDRTVPRARSPPFHSRGSRVVPSRVVRPRSPSPPQQAPNGSPHNPPQPSKIVWRRSSPAFPGGTSSAWENRNAS
VEEVVSRRTPSPPPLPQWTQGVARVGNPCPEAPLVWKVPNSRGGDAVGLSRDSSLPALLPREAPHPIETRTPSPGETWSPVVQGASTALHQEAMNGLTQELEPPTPSAPA
TPELTEALCLLSLENAGIAVRGGQRSPDVDTPEQPRSHLTSTLDDDVCPEAVGSGEAASERPRVTIPRPRDVRKMVKTTYAPSFPAGTPGSGLPAPPADTCGEDGDASKT
HKLPALESPAPAHYTSIFLKDFLPVVPHPYESPEPSLHATPKDASQSSGVPRRRAENSTAKPFARSEIRLPGALAFGQRREKTPSVQRRGPGGENPDAEAQRLVRDPEGR
TSPLGGARTSTQCSPLESTGTRPPRPGSPQACPNSSLRAAPELETPLVAPATAVQAPLLPDHPATAARAAAPFPRAASAPPTDRLPPASSLGRRPPGAAPAGKVLVDPES
GRYYFVEAPRQPRLRLLFDPESGQYVEVLLPPSPSPSRQPRQPYAPLALGPGLYPPAYGPISGPSLSPLSPNLSALGSLQLPWAPEAGPLEGMYYMPLSGTPSPAPPMLF
CAPPSSSGPIQSSKGSVFPL*
76 >lcl|XP_984013.2|Plus123966225..23966404 NT_039625 hypothetical protein LOC640636 Gm7303 __SEG__ Chr16 {Mus musculus} MCYYGSYYRGLGYGYGCGYGYGCGYGCGYGCGYGCGYGGYGYGCCLPLCCRRYGCCGFY*
77 >lcl|XP_999489.1|Plus138810515..38813172 NT_039706 hypothetical protein LOC245516 Gm4990 __SEG__ ChrX {Mus musculus} MARNLQKAFEWADDIIESVQQQPPPPRLTSTREKSLHEKLYDIYVEECEREAEAGGPQSNANLLEKLLRKEALPCLVVNLYSENQGYSLMLKDKSGSFSETSQLPYDVKK
LLEYLDAEELPSFLIDVLDKSPVNVFHHGCVIAEIRDYRQCSNVHPPGELGAEPALSSDVSSAWSSAASSAESSAVPSTTSPPAYQTRHILLRPTMQSLVSDVESITSDN
RQWNEEEKLELERRLILATAEPLCLDPSIAVACTANRLLFNEQKMNTDPVKQCFKRPTPPSLDQQEVSSGCTCPPDLTTMTPSKKAKIGPDDPDELLLTDTDAWMQGPCE
LTMPSELDVQTYINKVPSLLFDDEEPNVLEVPEVKHGFMFDYEDDNQLWEMNSNIMKSLNDPFFSADIGPLPEDRIDSHMYFPHMSLDDYADDFVARVDSEPREIVDICQ
GSAQGEAKCSDKVTQGFSSSVCLPQPSLETKPIVSVVPKPTPSLVSKPTTSLVSKPTISVVPKSTTSVVPKPTTSLAAKPKISVVPKPTTSLVAKPATSLVAKPATSLVA
KPATGLVPTSVLEQESRILPPLALTQISKLGSSTVSCGQNVPPAPKTSTVVQQATVGMSRVNVLPLALQPTARSSENKPKVQGLTSITTTDVINVVKSKAKPSLVGNSTQ
VLGRPTSVPAAAGITQNSLLPTRQQPPRPAQRPVKSPMQIIINNTANPLTVKLPPGSVILRPGPQKSSQGQPQQIYVLIPKQQQTPKAPAPPQPVPPASSQGPNNNQQLL
LPARQTSRLSTEQTGLLNTGGARGVQLTPTPTSVVSRVGSTQKSHRQSTHLQSLERPATLVQQRQTQSQNVQVRIIPHIVTVGKPGTQCSDRVGMQLVNPVIEQEAHQTP
QNPES*