SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom U    

ID / Description / Sequence
1 >lcl|XP_001362360.1|Plus1complement(1941202..1941780) NW_001581888 ADP-ribosylation factor-like protein 4C-like LOC100010141 __SEG__ Chr2 {Monodelphis domestica} MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIRLSNGAAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHK
VTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALPELVPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR*
2 >lcl|XP_001363341.1|Plus1complement(577541..578152) NW_001581875 ADP-ribosylation factor-like protein 4D-like LOC100010329 __SEG__ Chr2 {Monodelphis domestica} MGNHLTEMAPNASIFLPHFQTLHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRMPLGGSRAITFQVWDVGGQEKLRPLWRSYTRRTDGMVFVVDATEAERLE
EAKIELHRISRASDNQGVPVLVLANKQDRPGALSPAEVEKRLAVKELAAATLTYVQGCSAVDGLGLQPGLERLYEMILKRKKVSWAGTGRKRW*
3 >lcl|XP_001363629.1|Plus118300953..18301549 NW_001581968 charged multivesicular body protein 1b-2-like LOC100012112 __SEG__ Chr5 {Monodelphis domestica} MSAMEKHLFNLKFAAKELSRNAKKCEKEEKAEKAKIKKAIQKGNTEVARIHAENAIRQKNQGVNFLRLSARVDAVAARVQTAVTMGKVTKSLAGVVKSMDAALRSMNLEK
ISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQGQVDLLLQEMADEAGLDLNMELPQGQTGSVATVASTEQDELSQRLARLRDQV*
4 >lcl|XP_001363796.1|Plus1complement(16685636..16686232) NW_001581976 charged multivesicular body protein 1b-like LOC100013717 __SEG__ Chr6 {Monodelphis domestica} MANMEKYLFNLKFAAKELKRNAKKCDKEEKAEKDKIKKAIQKGNTEVAQIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGRVTKSMAGVVKSMDATLSSMNLEK
ISALMDKFEHHFETLDVHTQQMEDTVSSTAALTTPPNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSSAAEQDELSQRLARLRDQV*
5 >lcl|XP_001364067.1|Plus13045948..3046553 NW_001582023 ADP-ribosylation factor-like protein 4A-like LOC100012657 __SEG__ Chr8 {Monodelphis domestica} MGNGLSEPGPGLLAGLPPFQCFHIVILGLDCAGKTTVLYRLQLDEFVNTVPTKGFNTEKVRVTLGNAKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMD
EAKTELHRITRLAENQGVPVLLVANKQDLRDSLPLAEIARLLAVGELAASTPWHLQPTCAIIGDGLREGLEKLHEMILKRRKMLRQQKKKR*
6 >lcl|XP_001364861.1|Plus1complement(32646132..32646608) NW_001581969 trafficking protein particle complex subunit 6B-like isoform 1 LOC100015105 __SEG__ Chr5 {Monodelphis domestica} MADEALFLLLHNEMVTTFYKSAEQEEVENGRCITKLENMGFRVGQGLIERFTKDTALFKDELEIMNFICKDFWTTVFKKQIDNLRTNHEGIYVLQDNKFQLLTQMSSGKQ
YLDQAPKYLAFTCGLMRGSLSNLGIKSIVTVEVSAMPACIFQVMIQKM*
7 >lcl|XP_001366261.1|Plus1complement(437931..438497) NW_001581909 trafficking protein particle complex subunit 5-like LOC100018707 __SEG__ Chr3 {Monodelphis domestica} MDARFTRGKSAILERSLARPKTEVSLSAFSLLFSELVQYCQNRVYSVAELQARLAELGQQVGARVLDGLATREKGGRRETRVLGALLFVKGAVWRALFGKEADKLEQAND
DDKTYYIIEREPLINTYISVPKENSTLNCASFTAGVVEAVLTHSGFPAKVTAHWHKGTTLMIKFDEAVIARDRALDGR*
8 >lcl|XP_001366301.1|Plus1complement(25048189..25048647) NW_001581835 trafficking protein particle complex subunit 6B-like LOC100015304 __SEG__ Chr1 {Monodelphis domestica} MADEGLFLLLHEMVTGVYKSAEQVEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIIKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFLLLTQMSSGKQY
LDHAPKYLAFTCGLSNLGIKSTVTAEVSAMPACKFQVIIQKM*
9 >lcl|XP_001366983.1|Plus1complement(11336467..11338389) NW_001581989 rab proteins geranylgeranyltransferase component A 1 CHML __SEG__ Chr7 {Monodelphis domestica} MADKLPSEFDVIVIGTGLPESITAAACSRSGQSVLHLDSRSYYGGNWASFSFSGLLSWIKEYQEQSDIGEEWTAWKELILETEEGIALRKKDQTIQHVEVICYASQDSDD
HAEEIGALQKNPASLTSAGTNHPPDSMDTASSDTSKLLAPLSEPETALVVPEVDMTLEKENDGSYTDCSQLDLEPKKTENILITEDVADAPKKSGITYSQIVKEGRRFNI
DLTSKLLYSRGLLIDLLIKSNVSRYAEFKNVTRILGFQEGSVLQVPCSRADVFNSKKLTMVEKRMLMKFLTFCLDYEQHPNEYKAYEESTFSEYLKTQKLTPILRHFVLH
SIAMASETSTSTLDGLRGTKNFLQCLGRYGNTPFLFPLYGQGEIPQCFCRMCAVFGGTYCLNHAVQCLVVDKESGKCKAIIDHFGQRINAKYFIVEDSYLSEKTCSNVTY
TQISRGVLITDRSILKTDSDQHISVLTVPPVEPGSAAVRVIELSSSTMTCMKGTYLVHLTCTSSKNTAREDLELVVQKLFTPYAEVELEREALEKPGLLWALYFNMRDSS
GINRDSYNDLPSNIYVCSGPDYVLGNEYAVKQAKTVFQHFLPNEEFCPPPPNPEDIVFDADSMQPDVLAPKPDTTEEIKVQRNTEEHAQE*
10 >lcl|XP_001367927.2|Plus1complement(967386..967676) NW_001581993 mitochondrial import inner membrane translocase subunit Tim8 A-like LOC100013545 __SEG__ Chr7 {Monodelphis domestica} MNSSSSFFEGLGSVDPQLQSFIEAETQRQRFQQLVHQMTELCWEKCMDKPGPRLDSRTESCFVNCVERFLDTSQFILNRLEHQQKSKPGFSEILSD*
11 >lcl|XP_001368358.1|Plus1complement(3831073..3832257) NW_001581840 immediate early response gene 5-like protein-like LOC100014003 __SEG__ Chr1 {Monodelphis domestica} MECALDAQSLITISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQHPYSGGGGMMMSSAGEMAEFSPLQLPGDPEDRDPGARQQLHQLHQLHLHH
QQQLQQHRSCAAGAPAGGASGGGGAGELLEPVCAALLPGAHHREETLALQPSPSPQQQPPPPPALCTRDPSSSPSSSSSVAASSAASSSTASPSFYRSGGCCAPGGGYPL
TSDFGGSPLPVAGGNLHCSSQTTVLDLDTHVVTTVENGYLHQDCCVSAQCSCCCGGGQGAPGLGPAVPAPTALPGTKRKYYPGQEEEEEGGELGGDPPGGGPPFTPCKRA
RFEDFCPESSPDASNISNLISIFGSGFTGLVSRQPDSEQSLNGQLCSKQALASLGAWTRAIVAF*
12 >lcl|XP_001368928.1|Plus1118676762..118677301 NW_001581900 ADP-ribosylation factor-like protein 5A-like LOC100023527 __SEG__ Chr3 {Monodelphis domestica} MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKML
AHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR*
13 >lcl|XP_001369189.1|Plus156134606..56136792 NW_001581871 exocyst complex component 8 EXOC8 __SEG__ Chr2 {Monodelphis domestica} MAMAMSDSGASRLRRQLESSGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAA
AAAAGAAAAAGADEGGGGCPGGRDHLRGPAGFFPGHGGAARDNQSAGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATW
LPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSEKRRREQEEAAAPRGPPHVSSQTTNPFEDEEEEEEPTTPEVE
EKVDLSMEWIQELPEDLDVCIAQRDFEGAVDLLDKLNHYLEGKPCPTPVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAA
AVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFETDFASSNSGCYSAFIVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLTFIIHALL
VKDIQGALHSYKEIIIEATKHRNSEEMWRKMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQH
VDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEQGVGKPAKQLQDLRNASRLIRVNPESTTSVV*
14 >lcl|XP_001369217.1|Plus157047190..57048776 NW_001581871 importin subunit alpha-2-like LOC100022043 __SEG__ Chr2 {Monodelphis domestica} MSTNENANSPAARLNRFKNKGKDSTEMRHRHIEVNVELRKAKKDDQMLKRRNVSTFPDDATSPLQENRNNQGSALWSVEEIVKGINTNNLEVQLQATQAARKLLSREKQP
PIDQIIEAGMIPKLVGFLGRTDCNPIQFKSAWALTNIVSGTSDQTKAVVDGGAIPAFIALLASPQAHISEQAVWALGNIAGDGSAYRDLVIKYGAIDPLLALLAVPDISS
LACGYLRNLTWTLSNLCRNKNPAPPIEAIEQILPTLVCLLHHDDPEVLVDTCWAFSYLTDGSNDRIEVVVKTGVVPQLVKLLGSGELPIVTPSLWAIGNIVTGTDEQTQI
AIDSGALAVFPSLLTHPNTNIQKEAAWTMSNITAGRQDQIQQVVNHGLVPYLVGILSKGDFKSQKEAVWAVTNYTNGGTIEKIVYLVQNGILEPLINLLSAKDSKIVLVI
LDAISNIFLAAEKLNKTEKLCILIEECGGLDRIEALQSHENEMVYKASSSLIEKYFSAEEEYQNVVPESTSDGYTFQIQDGAPGTFNF*
15 >lcl|XP_001369742.1|Plus112278404..12278985 NW_001581996 ADP-ribosylation factor-like protein 14-like LOC100015738 __SEG__ Chr7 {Monodelphis domestica} MGISSSQPSRLKPARVLLLGLDSSGKSTILYKLKRIKDFTTFPTVGFNVEMIETEKNLSLTVWDVGGQERMRRLWGHYCENTDVLVYVVDCVDHRHLEDSRREFELILTN
EHIRHIPVVLLANKQDLPGALTAEDVTRKFRMKKHCGDRNWYVQPCSATSGEGLAQGFRKVTEFVKSGRKAREAITWDFFKQN*
16 >lcl|XP_001369912.1|Plus1complement(64920278..64921087) NW_001581871 surfeit locus protein 4-like LOC100025002 __SEG__ Chr2 {Monodelphis domestica} MGQNDLMGTAEDVADQFLRVTKQYLPHVARLYLISTFLEDGIHMWFQWSEQRDYIDATWNCGYILASIFVFLNLLGQLTGCILVLSRNFVQYACFRLFGIIALQTIAYSI
LWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLKFMTLLHFDASFFSILQNIVGTALIILVAIGFKTKLAALTLVIWLFGINVYFN
AFWTVPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW*
17 >lcl|XP_001370347.1|Plus1complement(129544097..129544837) NW_001581879 cbp/p300-interacting transactivator 2-like LOC100026062 __SEG__ Chr2 {Monodelphis domestica} MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHHQQQQQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSTMPPTARFNNSQFMGPPVASQGGSL
PASMQLQKLNNQYFNHHPYPHNHYMPDLHPASHQMNGTNQHFRDCNPKHSSSSGNSGGSSSNSSSNMPSSVPHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELP
ELWLGQNEFDFMTDFVCKQQPSRVSC*
18 >lcl|XP_001370639.1|Plus1complement(78780044..78780571) NW_001581835 ADP-ribosylation factor 6-like LOC100024405 __SEG__ Chr1 {Monodelphis domestica} MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDR
EMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS*
19 >lcl|XP_001370644.1|Plus1136484978..136485841 NW_001581879 syntaxin-11-like LOC100026529 __SEG__ Chr2 {Monodelphis domestica} MKDRLPELLELSQQYDQRFPDEANERNGSQENIIFETDHILESLYKDIQDIQTENHLLIVDVKRLGKQNLRFLTSMRRLSSIKRDTNSIAKDIKTRGEAIHKKLQMMKTF
CEVAELKHGANSAMARISKAQYNVLTWTFQQAMHDYNQVEMNQRENCKIRIQRQLEIMGKDVSRAQIEEMCEEGKWDVFSENLLSDVKGARSALNEIESRHKELMKLESR
IRDVYGLFLQMAVLVEEQGETLNVIELNVEKTQSYTGEAKAYVKKAVEYKKKNPCWTLCCCCCRCCN*
20 >lcl|XP_001370850.2|Plus1complement(5572918..5573580) NW_001581965 vesicle-associated membrane protein-associated protein A-like LOC100017226 __SEG__ Chr5 {Monodelphis domestica} MVDPPTDLKFKGPFTDVVTTDLKLRNPSDRKVCFKVKTTAPCRYCVRPNSGIIDPGLTVTVSVMLQPFDYEPNEKSKHKFMVQTIFAPTNTSDMDAVWKEAKPNEPMDSK
LRCILEMPTENDKLIDMEAAKPHSKADGTLMKQYSSPSFNDTATKRLVEKCKRLQGEMMKLSEENRHLRDEGLKLRKVSQMEKRSSNVIPSLLVVIAAIFIGYFLGKFIL
*
21 >lcl|XP_001371073.1|Plus1complement(10663662..10664555) NW_001582021 GTPase IMAP family member 7-like LOC100017544 __SEG__ Chr8 {Monodelphis domestica} MDVDEANVPRIVLVGKTGHGKSATGNTLLGKELFASGVSANSTTKTCQKEVASWKGKGFLVVDTPGLFDTKKSLETTCNEISRCVIYSCPGPHAIILVLQLGRYTKEEKH
SVSLIKALFGKLAMNYMIILFTRKDDLKNEKLDNFLKESEDLQSLIHECGGRYYAFNNKAEGNEREVQVKELLDLIEKMMQNNKGKHFSDKIYEKTNEALKRRRRALKEI
YTQERDDEIQIIEQEYANESSLTEEQIREKQERIKKVEREYEEKMKNINAEAERTVFEQVVQFVKDLICKISGWFKK*
22 >lcl|XP_001371252.1|Plus1complement(140281..140946) NW_001581941 SERTA domain-containing protein 1-like LOC100017811 __SEG__ Chr4 {Monodelphis domestica} MLGKGVKLKREEEEEEDLTSQDWWLEETTPSPNPEEGASPAPLPPSSLFNLSIFKLHHGLRRGEPDLRHLVLVVNTLRRIQSSMALEPSPPEPPCPAPVDPLPVAPDAPL
CTSVSALLDDLSHIEGLCDTQTSFSEDIPLSRPPETGLDPGRPAPLGSLELLLEDGLEGLFDDIDTSMYDCELWPNLKTDSGETEDKIQGQGLDVSELDYLMDVLVGTQT
L*
23 >lcl|XP_001371525.1|Plus1complement(3433291..3434040) NW_001582005 sesquipedalian-2-like LOC100018210 __SEG__ Chr8 {Monodelphis domestica} MKLNEPSVAHYAVSGSPADHEGFLRRCSSPGPRQPSAPSASGSCPRCWFVLKGNLLFYFEGRESRAPLGLIVLEGSTVELCEAPQEFAFAIRFASPGARPYVLAAEDQQD
QEAWLKVLSRASFSYMRLLVHELEGQLREMQLGPASRAARSPPRPPPEPEDGCPPLGDGLAERDEGGPRLPAPSTRRRLADSYPWGPAGPPLNGGDSPVSPETSCFSKLH
GWYGQEITGLRREWLQARALAGRRAVKGS*
24 >lcl|XP_001371745.1|Plus1complement(17771224..17773413) NW_001581859 inositol polyphosphate 5-phosphatase OCRL-1-like LOC100018574 __SEG__ Chr1 {Monodelphis domestica} MSLEKKRTIPYHQIKTRNDSPPTVSPMKRELSCEKGTESKEPSKGPSTMRKLFGPSTQPRMQKELIRLIAAKREKEYVNFHNFRFFVGTWNVNGQSPDSGLEPWLNCDRD
PPDIYCLGFQELDLSIEAFFYFESTKEHEWLASVKRALHFKSKYNKVQLVRLVGMMLLIFARKEHCMYIQDVVTDTVGTGLMGKMGNKGAVAVRFMFHNTTFCIVNSHLA
AQMEDVEGRNQDYKDICARMSFLVPNQGHLNIMKHDVVIWLGDLNYRIYIYSAKEVKWLISRNDLHKLLKLDQLNIQRSDKKAFTDFTEGEIRFIPTYKFDTKTDRWDSS
GKCRIPAWCDRILWKGENIQQLRYQSHMGLKTSDHKPVSSSFLIGVKVVNNSKYQEVLKDSVQLMDRMENYFLPSIVLSKREFVFENVKFQQLQKEKFQITNNGQVPCHF
SFISKNGESQYCKPWLQVNPCQGYLEPNETLDISLSVYVSKDSVPVLKSGEENIKDILILHLDQGKDYFLIISGNYLRSCCGTSLEALCQMRRPIREVPVSKLIDLEMTP
LEENASEKPLQIPKELWLLVDHLYKHACHQKDLFQTPGSQKEVRQIIDCLDTSIPKAIPGSNYSVAETLLIFLEALPEPVVCYELYQDCLNYSHNFQLCQKVISDLPQCH
RNVFWCLIAFLRELLRHSESNNINANMLANLFSSLLLRPPPNLKARQTQTNHQCAVQFLLGFLLGGDKH*
25 >lcl|XP_001372067.2|Plus1complement(5168555..5169580) NW_001581881 c2 calcium-dependent domain-containing protein 4D-like LOC100019107 __SEG__ Chr2 {Monodelphis domestica} MWLLEKAGYKGGSEEPGTPWRPHILFSKRKPPRTSPSACPNVLTPDRIPQFFIPPRLPGMGCPEPGTERETGWTRGQELQAACSLPHLTGREGWAFLLESPHTRRRESLF
HMAPTASGSEGPPLKPRKHLSSPDLRLCLALESDMAPSPDSSPFSSPQPGSPRSHLGLPSMHLSSPGSLSPEEESSTDASPHHLGPPTPPLFHLDFLCCQLQVTKESLVS
LGPRGGQLRLSAEYQAGLGQLRLRLISAEELPRGRGGAKGSSGCCVVFRLRPGSWPQAHRSRLVKCSSNPIFNEDFFFEGLKPSDLTTHTLKAKVLDKGTGLRRDVLLGE
CEAPLVTLLPT*
26 >lcl|XP_001372122.2|Plus1complement(21930330..21931958) NW_001581995 carbohydrate sulfotransferase 2-like LOC100019189 __SEG__ Chr7 {Monodelphis domestica} MSNSSGRALPPGGSPWPAAAAPRPPLLPLRPLPPGAPTAAGLSLFPPWPRRLGRRWPASPLGMKVFRRKALVLCAGYALLLLLTMLNLLDYKWHKEPPQQCRGEPPGPAP
PPVRPPGSPARPDLRSLYRSPAAVAPAAPGSAAKGSAGPGPGGGGGGNSSGPGAPASAGPGPRKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDA
VSLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLR
DPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGGKKEGLGSGPADYHALGAMEVICNSMAKTLQTALQPPDWLRGHYLVVRYEDL
VGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAASAWRAALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL*
27 >lcl|XP_001373497.2|Plus1complement(10100369..10100896) NW_001581903 mitochondrial inner membrane protease subunit 2-like isoform 1 LOC100021306 __SEG__ Chr3 {Monodelphis domestica} MMPPQGFGRRYMKAFLKGFFVAVPVTVTFLDQVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNYEVQRGDIVSLISPKNPEQKIIKRVIALEGDIIKTIGHKNRY
VKVPRGHMWVEGDHHGHSFDSNAFGPVSLGLLHAHATHILWPPERWQRLESILPPERAPVQMEEK*
28 >lcl|XP_001374439.1|Plus120040070..20041290 NW_001581861 c2 calcium-dependent domain-containing protein 4A-like LOC100022659 __SEG__ Chr1 {Monodelphis domestica} MWCLERLLRIRTRPAATSAFSPASFTNVLTPANIPEFCIPPRLLPSPSPALTRDLWQEEELRQECVRAREDPDLTDWDPRSQAALSLPHLPRQPTSYGFCTLLESPNTRR
KESLFLGGSAAAAALLLQAPSQSLLRPRAHTYCGSGGTNASCNLRGRRVAPDSPAIGCSSSSSSSSASSSPCSSPRPQVAPAKRSRSRQGYRHLLRAPDALGRALRASGS
RVLARARSVSSAEDDDEDYEAVGDACRISQTATCQSGSAQKRALSPSPSPSPLGPLQERLEVQSTLALDCDGGALHLATEYCPVSQRLRIRLLSAQGLYSCTAEPGAIGC
RVSITLVLPGKTHKQRSAVVRRSRNPVFNEDFFFEGLSENDLRRTAVRVKAENKGRGLERDRLLGRGELELRTILL*
29 >lcl|XP_001374460.1|Plus1complement(20248571..20249896) NW_001581861 c2 calcium-dependent domain-containing protein 4B-like LOC100022688 __SEG__ Chr1 {Monodelphis domestica} MRFLEKLRDSTGVSTALEPEKVAVDLVSKRPAVSPFCNVLTPGRIPAFCIPPRLPSHTVPALQPLGSSTSPPRRCTVETDMWPHSRNSSGSTGEELLRSECVRAREDPDL
TDWDPRSQAALSLPHLPRQPTSYGFCALLESPNTRRKESLFLGSSAAAAALLLQAPSQSLLRPRAHTYCGSGGTNASCNLRGRRVAPDSLAIGCSSSSSSSASSSPCRSP
RPQEATAKRSRSRQRYRRLLRAPDALGRALRASGSRVLARARSVSSTEDDDEDYEAVGDARSISQTATCQSGSAQTRALSPSPSPSPLGPLQERLEVQSTLALGCDGGAL
HLATEYCSVSQRLRIRLLSAQGLYSCTAEPGAIGCRVSITLVLPGKTHKQRSAVVRRSRNPVFNEDFFFEGLSENDLRRTAVRVKAENKGRGLERDRLLGRGELELRTIL
L*
30 >lcl|XP_001374784.1|Plus1complement(37974099..37975298) NW_001581981 hypothetical protein LOC100023161 LOC100023161 __SEG__ Chr6 {Monodelphis domestica} MEAAKETLENQRTSTENVNDTNRNPQFEPIPLDKIKTLEEDEEELFRMRAKLFRFTYVNGLPKWKERGTGDMKLLKHKKKGTIRLLMRRSRTLKICANHYVTPWMELKSN
VWSDRAWVWYTQADFADETLKHEVLAIRFLNAENAQKFKAKFEECRNEIKEKEERLASGRNPTLRLLVKEDSQGEPEGLDKVVQKLKELSVEEDRQGKSESLDKVAPKLE
LSVEDDSQGKSESHEISQKPGELLVKEDSQGEPNDLDKIVQKLEEFSVEEDRQGKSESLDKVAPKLELSVEDDSQGKSESHEISQKPGEQLVKEDNQGEPKDLDKVVQKL
EEFSVEEDSQGKSESRDKVAPKLELSVQDDGRGKSESHEISPKSEFSVEEASQKAEEKEETHSKAEEEQ*
31 >lcl|XP_001375285.2|Plus138104807..38105121 NW_001581989 vesicle-associated membrane protein 3-like LOC100023856 __SEG__ Chr7 {Monodelphis domestica} MSTSGPPPSGAASGSNRRLQQAQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAILITVVVVIIVIIIVWSVSS*
32 >lcl|XP_001375296.1|Plus150062005..50062274 NW_001581879 mitochondrial import inner membrane translocase subunit Tim8 A-like LOC100023871 __SEG__ Chr2 {Monodelphis domestica} MSGRDSEDSQLQHFIEMETQNQRFKHLVHQMTKLWWQKYMDKSGPKLDSQAETCFVSSVERFIDTSQFILNRLEQTQKSRPAFSEGLSY*
33 >lcl|XP_001376218.1|Plus130524214..30526145 NW_001581871 uncharacterized protein C1orf65-like LOC100025202 __SEG__ Chr2 {Monodelphis domestica} MEGTGRFSPLPYLEVYDHEPLGGEPAPLPVAVPRGSPGGLKGEALTANKDAPAAALPGCQAFERTRGAAGTPGTAQQALHPPTPQPQRRLFPSSPRESRSLTDVGRRPPD
RARRQLPRSRRPDDDRDSAARASRLGRASYNLAWQQPQQQQQQQTLSNSGKKDMPAPTPRGDYTVPRGTLTLEREPSGDQWATTVRRCLGHWVPSSHSLEKSVLPSKEIR
VRASSLEPRGKTVNQLVEIGSQYSQTHGANKETQMESFQNLKDNQTESMIPPRDKKIVTLMMDRLKKARKIQELQHQAAEAWEEVKRCDQRFQVMLERERQHQLSQSKEQ
WERQKEERRARLSKEQQERLETWEKEMALRESKWKRQVQEQESQRREKLERAREQAEYRKHCQEQMLKEKEVMQRDRREQNIQQLQEKMVQACYKRQLKNLEGRKKLQEN
NLTASASHQVRKVLLDSQNKAEEILRRLSLEQRSQRSQEIHQRLIEERHKELKEKALKEEEHLLLAKWRAEETEEQRKLHKKMLVELGDLKIQQARDNVHKNIKDKADRI
REFNFLREKNHYFLKQKAEEEAKCHIEGIKEAIKKKEQKMSQISREKDATIEESRKIAQASLQMREKVKALQVSFDRMAWEAQFNASLHGGSH*
34 >lcl|XP_001377116.1|Plus1complement(43179632..43180318) NW_001581960 vesicle transport protein SFT2C-like LOC100026545 __SEG__ Chr4 {Monodelphis domestica} MADLNRQLQEYLAQSKGAASADTVPLLPTEGKEAAEAGGASSVGVWLGRVNPFPSRGGLAWAWPRGSALPPEEPEPGPGPPCLPSLSRWQRLTASGVCLVLAVLCFGLAA
LYAPLLLLRARKFALLWSLGSVFALAAAALLRGGPACLRLLRCEERPSRGTLFYLAALGGTLYAALGLRSTAFTALGAVAQLAALLAALFGLLPWGSGPALRYALGSLCG
GLARTLPV*
35 >lcl|XP_001378595.1|Plus1complement(57416983..57417567) NW_001581963 ADP-ribosylation factor-like protein 11-like LOC100028600 __SEG__ Chr4 {Monodelphis domestica} MGNLNFRAQHKEEPRVVIMGLDSAGKTTLLYRLKSNQQVETYPTVGFNVESLEASKHGSLTLWDIGGQDQLRSSWKDYLEDTDSLLYVLDSTDEDRLPEATVELENVLNN
AHMVGVPFLVLANKQEVPGALSLLEIRDRMQLDRFNDRCWELRGCSALTGEGLKEAQLALERLLQSRKQLCLYTMQVNGERKKS*
36 >lcl|XP_001380560.1|Plus111562018..11562386 NW_001581894 nuclear transport factor 2-like LOC100031249 __SEG__ Chr3 {Monodelphis domestica} MGDEPFGERTGSSFVHHHDQIFDDDRTPLGALQIDASCPTWEGQRCQGKAAIVEKLSSLPFQKRQRSITATPDGCILGMIVGQLKAREDPIMGFHQIFLSKNITDAWVCT
KAMLRLACHNFS*
37 >lcl|XP_001380904.1|Plus1complement(132432084..132433331) NW_001581879 EH domain-containing protein 1-like LOC100031716 __SEG__ Chr2 {Monodelphis domestica} MSKTKGHKGSYLFLSVAQRLSKLYLEKLLPLEEMYQFGRFHSPPLTDADFDNRPMVLLMGQYSTGKTTFISHLIEQTFPCMRIGPEPTTDAFIVLMHGEVENVMPGNVAV
VDRRFPFRNLTRFGNAFLNRFNLVQIPNEFLDSISIIDTPGILAGEKQRLSRGYDFSAVLEWFAQRVDLIILLFDAHKLDISDELSQAIKSIKNNEDKMRVVLNKSDQVG
TQQLMRVYGALMWSLGKIINTPEVMRVYIGSFWSEPYVNDENSKLFEAEALDLYKDIQQLPHYSTVRKMNDLIKRARLARVHGYIIATLKKELPLFGKENKKRELITNLQ
EIFLKVQRDYHISSGDFPNVQKMQEILVSQDFTKFQNLKPKLFDTLEDMLSKDITRLMYLMREEEAATVAAIAATEAAASIVQRS*
38 >lcl|XP_001381276.1|Plus136497350..36498066 NW_001581988 ran-specific GTPase-activating protein-like LOC100032208 __SEG__ Chr7 {Monodelphis domestica} MAAAKEVQEEHETLTENMDDANHDPLFEHLVSLPEQEIKTLEEDEDELFKMRAKLFRFASENDLPQWKERGTGDVKLLRHKEKGTIRLLMRRDKTLKICANHYITPLMEL
KPNAGSDRAWVWNTHADFADESRKPELLAIRFLNAENAQKFKTKFEECRHELEQREKKGMNQERSYDQMAKKLEDLSVKDSGQESEQEIQVEKAPETQESQEAQEIQEEQ
ETEAQEIQEIQDQDTEQQ*
39 >lcl|XP_001381498.1|Plus133781783..33784548 NW_001581894 nuclear pore complex protein Nup107-like LOC100032503 __SEG__ Chr3 {Monodelphis domestica} MDPNSGFWDMTSPVVRDVEVTRTARRQSAHKRVSTLPPQEDTLANTLPRNQGISRIPSLYRHTFTSLNRRQSDVSAILASGIRSPRLAPLTAFLGNLPSVTSLDESNWSA
AVSSPPSGLFTDVDPSNVAEDVSFSAVMLCEDDPGEAATMSIYFDFLYTFLKHASNTVFELVEEYESICDSHVNILGKIVSRATPGLQKFSKTASVLWLLQQEMVTWRLI
ASLYRDRIQSVLEEENAFEIASLNASEKTVVDTLFQRDSLIRQSQLVVDWLESIAKDDIRDISDNIEFYAKSVYWENTLHILKQQQLISFIGNSRPLVTELDPDAPIRQK
MPLDDLDREDDNRLLKFLFTLIRSGLTDEAQRLCKRCGQAWRAATLEGWKLYHDPNVNGGTELEPVEGNPYRCIWKISCWRMAEDELFNRYERAIYAALSGNLKQLLPVC
ETWEDTVWAYFRVMVDSLVEQEVRTSVVTLDETEELPREHLEANWTLEKVFEELQATDKKRVLEENQEHYHIIQKFLILGDIDSLMDEFTKWLSKGRSILPGHLLRFMIH
LILFFRTLGIQTKESVSVEVLKAYIQLLICKKHMRLIAFYTCHLPQDQGVAQYAEFLEGITEFEQRHHCLELAREAGLDVATITKTVVENTRKKDAGEFSHHDIAPCLDI
GTTEEDRLKIDVIDWLVFDPAQRAEALKQGNAIVRKFLASKKHEAAKEVFAKIPQDSIAEIYNQWEEQGMESPLPAEDDNAIREHLCIRAYLEMHEIFNEWFKHMNSAPP
KPTLLRQASFTEKVAYEHKEKKYEMDYGIWKAHLDVLTTEVKEKMYNVLLFVDGGWMVDVREDAEEDHERTHQMVLLRRLCLPMMCFLLHTILHSTDQYQECLQLADVIS
SERHKLYSVFSKEELRKLLQKLRESSLMLLDQGLDPLGYES*
40 >lcl|XP_003339592.1|Plus196537202..96539979 NW_001581837 hypothetical protein LOC100032391 LOC100032391 __SEG__ Chr1 {Monodelphis domestica} MDPSQIEKKIAEPTQAQRAKVQSLFEVPFLHKGTEEDGVLSQSQQSPKLSTATSKPSGSKTASSEENQNLTNTQEKTDHKDSKESAVINDISALIPFGEVAGCLSVHIKK
CRNFSTKISLEYYTKLFIRVSVSKEMKYTKSHFLDAEEKKPSIKFEEVKYFSIYVPRRQNDENNLIYLDLMEARDVDYPILVGSFHIHLYEVIQKGCFTEEFNLKLRNLI
ICKIEVEFMFCYGNFGYGFSHQLKPLQKMIQPTMFLCVPPPPHRTDTRANVITAQNIEYPRFLSKDLKATIGNPEELSPLVKLEKLQQKPRARLRKMKGEYRKLKTWEEK
SNYLRKILKLSPEAKDIFGPKDDNYLDVVTPEDKKKWLYPEKRQEPPVIAQKIYEPIVRSLPPKEITPLPPPVLLKSSSSITIESIYERVSIPVAEKPESKDKTPKMQTS
YSSSEEEEPIKQPLFTSKDKTPRMQTSYSSEEEVPIKQPLFTSKDKIPRMQTSFSSEEEAPIKQPLFTSKDKTPRMQTSYSSEEEVPIKQPLFTSKDKTPRMQTSYSSEE
EAPIKQPSFSSEEEAPIKRAFSSIDKTPTKHTSFSFEEKAPTKQASFSSEEEAPIKRTFSSIDKISTKQTSFSSDEEAPTKQTPFSSEEEASIKRTFSSIDKTPTKQTSF
SSEEEAPIKRTFSSIDKTPTKQASFSSEEEAPIDKTPTKQASFSSEEEAPIKRTFSSIDKTPTKQASFSSEEGAPITAQASFSSKDKTPTKQASFSSYFSQLSLDFMNEF
VPTTSFERNISDSDAPRQSLVEESKESREVPKDTETGPEGSLPPYISRSVSDEALFPLDLGEIDEVKDKPEEDEDSDIVISPAFKKDTSPFKPLRPEKLPPFQTCENLDR
DKFEPFLRDLNGDKKDRGIQDEPFHSIKKGTLSEQSIELEDQDPP*
41 >lcl|XP_003340575.1|Plus1complement(1163970..1165484) NW_001581884 signal recognition particle 54 kDa protein-like LOC100617777 __SEG__ Chr2 {Monodelphis domestica} MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKPNVIMFVGLQ
GSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYV
MDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLR
DMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL
FKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM*
42 >lcl|XP_003340722.1|Plus1complement(79397973..79398620) NW_001581902 GTP-binding nuclear protein Ran-like LOC100019911 __SEG__ Chr3 {Monodelphis domestica} MAAQGEPQVQFKLVLVGDVGTGKTTFVKCHLTGEFEKYVATLGVEVHPLVFHTNRGSIKFNIWDTAGQEKFGGLRDGYYIQAQCAIMMFDVTSRVTYKNVPNWHRDLVRV
CENIPIVLCGNKMGIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKLFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEQDLQIAQTTALPDEDDEL*
43 >lcl|XP_003340733.1|Plus1143061866..143062411 NW_001581902 ADP-ribosylation factor 1-like LOC100025867 __SEG__ Chr3 {Monodelphis domestica} MGNIFANSFKGLFGRKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNITFTVWDVGGQDKIRPLWRHYFENTQGLIFVVDSNDRERVVEARGELMRM
LAEEDLRNAILLVFANKRDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLRNQK*
44 >lcl|XP_003340989.1|Plus1331325..331750 NW_001581926 vesicle-associated membrane protein 4-like LOC100016646 __SEG__ Chr4 {Monodelphis domestica} MPPKFKRHLNDDDVTGSVKSERRNLLEEDSDEEEDFFLRGPSGPKFGPRNDKIRHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMW
WRGCKMKAIMALVAVILLLVIIIPIVLKYRS*