SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab U    

ID / Description / Sequence
1 >lcl|XP_001488955.1|Plus11792698..1793276 NW_001867417 ADP-ribosylation factor-like protein 14-like LOC100049824 __SEG__ Chr5 {Equus caballus} MGLLSSKNFKSKQAQILLLGLDSAGKSTLLYKLKLAKDIVTIPTIGFNVEMIELEKNLSLTIWDVGGQEKMRTLWGCYCEGTDGLVYVVDSTDKQRLEDSRREFEHILKN
EHIKNVPVVLLANKQDVPGALTAEDITRMFKVQKLCSDRAWHVQPCCAITGDGLTEAFRRLTGFVKSHMKSRGDTLAFFKQN*
2 >lcl|XP_001491397.1|Plus13057292..3059253 NW_001867406 rab proteins geranylgeranyltransferase component A 2 CHML __SEG__ Chr30 {Equus caballus} MADSLPTEFDVIVIGTGLPESILAAACSRSGQRVLHLDSRSYYGGNWASFSFSALLSWLECQQNSDPGEEGSAAWQDLIHETEEAITLCSKDKTIQHTEVFCYASQDVDD
NIEETDALQRTPSWVAPTPLTNPLVPACLSEETPSLCVTRHEMPAKDTPENDGEISPEVTDVEETLAKENNRGDKTCTHAVSDGAKDENKPIVEDSTDQPKRNRITYSQI
VKEGRRFNIDLVSKLLYSQGLLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKALTMVEKRMLMKFLTFCLDYEQHPEEYQAFMQCSFSEYLKTKKLT
PNLQHFVLHSIAMTESSCTTIDGLKATKNFLQCLGRFGNTPFLFPLYGQGEVPQCFCRMCAVFGGIYCLRHKIQCLVVDKESGRCQAIIDHFGQRINAKYFIVEDSYLSE
DTCSNVQYKQISRAVLITDQSVLKTDSDQQISILIVPPAEPGMCAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVRKLFIPYAETETDREGLRKPRLLWALY
FNMRDSSEISRSSYNGLPSNVYVCSGPDCGLGNEHAVRQAQTLFQEIFPTEEFCPPPPNPEDIIFDGDDKQPEVPGTTNRIIAKLESSEDCKNLENHENHLQN*
3 >lcl|XP_001491891.1|Plus1complement(18721815..18722420) NW_001867366 ADP-ribosylation factor-like protein 4D-like LOC100051867 __SEG__ Chr11 {Equus caballus} MGNHLTEMAPTASSFLPHFQALHVVVVGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEVERLE
EAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVNGLGLQPGLERLYEMILKRKKAARVGKKRR*
4 >lcl|XP_001492392.2|Plus1complement(3489679..3491268) NW_001877046 importin subunit alpha-2-like LOC100054910 __SEG__ ChrX {Equus caballus} MSSNENANSPAARLNRFKNKGKDSTEMRRRQIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENHNNQGTVNWSVEDTVKGINSNNLESQLQATQAARKLLSREKQP
PIDNIIQAGLIPKFVSFLGRTDCSPIQFESAWALTNIASETSEQTKAVVEGGAIPAFISLLASPHAHISEQAVWALGNIAGDGLVFRDLVIKYGGVDPLLALLAVPDMSS
LACGYLCNLTWTLSNLCLNKNPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYPTDGPNERIEMVVKTGVVPQLVKLLGSTELPIVTPALRAIGNIVTGTDEQTQV
VIDAGALAICPSLLTNPKTNIQKEATWTMSNITAGRQDRIQQVVNHGLVPFLVGVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVI
LDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESMYKASLNLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGPPGTFNF*
5 >lcl|XP_001492970.1|Plus1complement(5671460..5673256) NW_001877045 armadillo repeat-containing X-linked protein 2-like LOC100060746 __SEG__ ChrX {Equus caballus} MSRVRDAGCVAAGIVIGASAWYCVYKYARGRNQTKKRLAKPKTRAVAGTGARARAGLRAGFTIDLGPGFGPPTPVRTKAKNRAQDEATALNVAGSEAVAQAASSAGAQSG
GGSQAQRAEGAGVGSKTESVVGATAASAMAPPPREAEAPTAVETPTMAGAPKLAEVPGTAEASGVPAVLPGAPVPTEAAEAPVLAAPSGAAAPTGAAEAPGTSGSPRTVA
AAKKATPGAHTGAIPKAGSATGAVPKGGAKGGTRSRTGGKGKGKKNKVEVDELGLGFRPGDGAAAAAAASANGGQAFLAEVPDSEEGESGWTDTESESDSEPETQQRGRG
RRPVAVQKRPFPYEIDEILGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCNQDTIRKLGGLPIIANMINKSDPHIKEKALMAMNNLSENYENQGRLQVYMNKVMD
DIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPSSFSSLYNSYVESEILINALTLFEIIYDNLRAE
VFNYREFNKGSLFYLCTTSGVCVKKIRALADHHDLLVKVKVIKLVDKF*
6 >lcl|XP_001493410.3|Plus1complement(27294518..27297835) NW_001867394 ran-binding protein 6 RANBP6 __SEG__ Chr23 {Equus caballus} MAATGSAGIPATVSGKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSDVQRDVKIELILAVKLETH
ASMRKKLCDIFAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGNQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALFK
DFADLLPGILQAVNDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEVIVTLSETATPMLKKHTNIIAQAIPHILAMMVDLQDDEDWV
NADEMEEDDFDSNAVAAESALDRLACGLGGKLVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFAP
NFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKSLLVLYLDSMVRNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIEEKFVPYYDIFMPSLKHIV
ELAVQKELKLLKGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMISAWARMCKILGNDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENMS
DDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELREGFVEYTEQVVKLMVPLLKFYFHDNVRVAAAESMPFLLECARTRGPEYLAQMWQFICDPLIKAIGTEPD
TDVLSEIMNSFAKSIEVMGDGCLNDEHLEELGEILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNLI
CSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAVGKILRF
KPNCVNVDEVLPHWLSWLPLHEDKEEAIQTLSFLCDLIESNHPVVLGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQVQTSEELWLECVSQLDNEQQEALQE
LLNFA*
7 >lcl|XP_001494088.2|Plus112560875..12563052 NW_001867387 exocyst complex component 8 EXOC8 __SEG__ Chr1 {Equus caballus} MVMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAA
AAGAAAASGGEEGGGGARGRDPLRGQAGFFPAPGGASRDSSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMNDCLLVATWLPQ
RRGMYRYDALYALDGLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSEKRRREQEEAAAPRGPPQVASKASNPFEDEDDDEPAAPEVEEEKV
DLSMEWIQELPEDLDVSIAQRDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAAAVH
TAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFETDFAGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLTFIIHALLVKD
IQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDY
SLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPESTTSVV*
8 >lcl|XP_001494124.1|Plus15647140..5648279 NW_001877045 armadillo repeat-containing X-linked protein 3-like isoform 1 LOC100057749 __SEG__ ChrX {Equus caballus} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDVGDCPGPRYNDWSDDDDDNSENKGIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTILSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTITSRLNSSV
QLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKFQVLKLLLNLAENPAMSRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWQENEPTQNQFSE
GSLFSFLKEFQACADKILGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE*
9 >lcl|XP_001495316.1|Plus119896938..19897540 NW_001867413 ADP-ribosylation factor-like protein 4A-like LOC100052666 __SEG__ Chr4 {Equus caballus} MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLRFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEE
AKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMSELSSLTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR*
10 >lcl|XP_001498606.2|Plus126855100..26856689 NW_001867435 importin subunit alpha-2-like isoform 1 LOC100057745 __SEG__ Chr9 {Equus caballus} MSSNENANSPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENCNNQGTVNWSVEDIVKGVNSNNLESQLQATQAARKLLSREKQP
PIDNIIRAGLIPKFVSFLGRTDCSPIQFESTWALTNIASGTSEQTKAVVEGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS
LACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIEMVVKTGLVPQLVKLLGSTELPIVTPALRAIGNIVTGTDEQTQV
VIDAGALAIFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLIGVLSKADFKTQKEAVWAVTNYTSGRTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVI
LDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKALLNLIEKYFSVEEEEDENVVPETTSEGYTFQVQDGPPGTFNF*
11 >lcl|XP_001499029.2|Plus1complement(27817798..27818112) NW_001867397 hypothetical protein LOC100052871 LOC100052871 __SEG__ Chr26 {Equus caballus} MCCNYYGNSCGYGCRYGYGCGFGPHYGCSYGTGYGYGYSPLYGCGYGTRYGCGYGCGYSPHYGCSYGTGYGCGYGSSYGCGYSSGSGYCGYRPLCYRRCYSSCC*
12 >lcl|XP_001502039.1|Plus122820536..22826067 NW_001867381 xin actin-binding repeat-containing protein 1 XIRP1 __SEG__ Chr16 {Equus caballus} MAKAQTQAAPTSTIPMATAEDLPLPPPPALEDLPPPPPKESFSKFHQQRQASELRRLYKHIHPELRKNLAEAVAEDLAEVLGSEEPTEGDVQCMRWIFENWRLDAIGDHE
KPPAREPVPGGNVQATSRKFEEGSFANSIDQEPAGPRPSGGDVRAARWLFETKPLDELTGQTGAPEATVREPAASGDVRGTRMLFETRPLDRLGSRPSIQEQSPLELRSE
IQELKGDVKKTVKLFQTEPLCAIQDAEGAIHEVKAACREEIQSNAVRTARWLFETQPLDAINRDPSQVRVIRGISLEEGVRPDVSAARWIFETQPLDAIREILVDEKDFQ
PSPDLIPPGPDVQHQRHLFETRALDTLKGEEEAGTEVPPKEEVVPGDVRSTLWLFETKPLDTPRDKVQVGHLQRVGPRKGEGLMYEHPSSDGSSALSLSQSAPQRDGVKG
DVKTFKNLFETLPLDSIGQGEPLAHGSVNRAEGTDSAGQSQDIGSPVYAMQDGKGHLHALTSVSREQVVGGDVKGYRWMFETQPLDQLGRNPSTVDVVRGITRQEVVAGD
VGTARWLFETQPLEVIHQREQQERQEEEGKSQAGPEPDAPLKGDVQTIRWLFETCPMSELAEKQGSEVTDPTTKAKERSCTWMFTPQALDRPEGSREKHLQVSQVQDGER
QTDRHVFETEPLQTSGRPCGKGPVRYCSRVEIPSGQVSRQNEVFQALEAGKREDQGSRVIPEPIPEGSVHKFTWLFENCPMGSLAAESIRGDNLQEEQPVGISDNGVLER
QKTIAEGTLWTLHATPGILHHGGILMEARGPGELCLAKYMLPSPGQGGPYIRKEELVSGELPRIVRQMLRRPDVDQQGLLVQEDPTGQLRLKPLRLPAPGSGGNVEDMDP
EFQQLLACGLGTSVARTGVVMQETDQGLVSLTAYSLQPRLTSRAPERSSVQLLASCIDKGDLSGLHSLRWEPPADSSPVPTSEGAQKLPLTESIIHVPPLDPSMGMGHLR
GPGATSCPPRAIGKAVPPAGEEKQEDICSGQKGKAALRQSGATSTAPGPRIPDLQASRQSLRMATAEAQSLQQQVLNKHKQGPTPGSTSTPFQDGLWQAPAVATVEAQGN
TRPMAGGDPRIPAAPRKVSGEQKALPRGLPEGWVTIQDGIYTAHPVRTFDPPGGVQPSMREPLPRGKETALSAQAPSPLLEGPSQSLGPGREEPGDCTQRAWEAPEKVMV
GIGPRGLQAAETTLKAAPLAHHTLASGSQAAGASLHSHNASVPPPPPLPAAVTGPDFPAHAHHDEDSIRQASEPLQDTLLHSHNSPAGQRTPGGSRTKTSKLEPTMPPRK
KPQLPPKPAHLSQIRPPQRPPKPLALSPGSSKEVGQGEHKQGERDAAILPSAKVPTTAGQGRVPLAGCPGGQSQPGSQHGHSTMATKPTRGQAAGSNTQSPEPPKVSALS
SDPTSPQKGPSPPGEKPMDSSQQGAPESPEVLQGSQQELQGLLNQVQALEKEAAGSVDVRALQRLFEAVPQLREASQTPAAPCQPEASVEQAFGELTKVSTEVARLKEQT
LARLLDIEEAVHKALSSMSSLQPEVNAKGHSQGHPRDHNAHKVSVTDSSRARPNCSSQEVRGQTAVKSQTKVLCDPEVQSQAKVKNHTEAGGQAASTAPSTRGLETLRDN
SDLPRVLRVLRSSRNSPSSPTIISIESATRKLPEAPSLRGSPGVSVKSTHLAQDVGHALLHQKGVQDKAEKKEATQCSGQPETAPASASPLPTGQQKSLLELQTGPGGSH
HYGAMRSMTEQCEGVDHCRNTVLSSSTSVTEQAEPPRGPGPHLGLHACPLLRQFLRSPAGLSGGLAEAEMAHVPCSHSQPAAQ*
13 >lcl|XP_001502482.1|Plus1complement(11129646..11130509) NW_001867409 syntaxin-11-like LOC100066798 __SEG__ Chr31 {Equus caballus} MKDRLPELLDLTRQCDQQFPGEDDDFDAPHEDIVFETDHLLESLYRDVKDLQNENQQLIADVKRLGKQNARFLTSMRRLSSIKRDTSSIAKAIKARIEAIYRKLCAMKAQ
CEAAEAQHGEHSAVARIWRAHYCALTRTFESAMHEYNQAEMKQRDNCKIRIQRQLDIMGKDVSGDQIEDMFEQGKWDVFSENLLADVKGARAALNEIESRHRELLQLESR
IRDLHDLYKQMARLVEQQGDTIDTIELNVQKTLDYTGQAKVQVRKAVQYQKKNPCRTLCCCCCPCLK*
14 >lcl|XP_001502524.2|Plus137280867..37283926 NW_001867377 hypothetical protein LOC100072515 LOC100072515 __SEG__ Chr14 {Equus caballus} MLTALSPPALPGLPGRLPAAPARRQDSSGSSGSYYTAPGSPEPPDVGPDAEGRANWPGVAPALGAGVQPRLSVSAQNSRQQLGPGSDFPRGPRSGPRPPQPQLRMLPSGE
MEVIFGAGPLFSRSDTADSEVEQLTARAFGSLSPPGAASPTPAAPQPQAPDGGSRWATYLELRPSPATPAQFECVEVALEERAAPARPRTVPKRQIELRPRPRSPPREAD
APRPRLLLRTGSLDESLGRLQAAAGLVQTVLARKLSPTTTAAPNSATFRPTGRPEPATQETARSTRVAPEEAKSRPPRVHYSSTSARTPRPWPSLRERAIRRDKPAPGTE
PLGPVSSSIFLQSGEKTQEAHNQEPKTQFPRVTLDRTVLRAESPPLESRTPWEVPSKAVRPRSPSPLWQAPNGTVQGPHCPSPQNLSPWNRAIRRANSPSFPKASSAWEN
QDPAVKETVSRRSPSPPTPSQWTQDVDRARSPSPEAPSQWEVPHPAVKATVEGSRSPSPPALSSWEAPDRPIGTWSPSPQETWDPTVQGSSVVSTRETVNGLAQEELAPP
TPSAPGTLELTEAQSPSTREMPAIAIRGSQPSPQVAAPELPLSCLMGTMDANARRKALGPGDAASGRPRVAIPRPRDVRKMVKTTYAPSFPAGTPGSGLPAPPADPRGEE
GSASKTQELRELGSPAPAHYTSVLLKDFLPVVSHPYEPPELSPDTVSRDSSQPNGVLRRRAENSTAKPFARTEIRLPGALALGRRPEGTRRVLVRGPGGENREAEAQRLV
PDGEGRTSPLGSARLSPQQSPIGPAGAPPPRPPRPSSPQAHPTSSPGIAPKLETTPSAPEPATAVQSPLPREPQASAGRTAPPQARAASAPPMDRYSEGPSQRARRLPGA
ARPGKVLVDPESGRYYFVEAPRQPRLRLLFDPESGQYVEVLLPPSPQGPTRRVYTPLALGPNLYPPAYGPIPGLSLPPSPGPPSFSGPQLPWASEASPLEGMYYLPVSGT
PSPAPPLLLCAPPSSFGPAQPGKGSLFPG*
15 >lcl|XP_001503337.1|Plus136276065..36277177 NW_001867405 translocating chain-associated membrane protein 1-like 1-like LOC100064147 __SEG__ Chr2 {Equus caballus} MAFRKKSPRNPPVLSHEFILQNHADLVACVGMFFVLGLMFEGAAEASIVFITLQHSVTFPAAEEPATDLKVLYHYGIKDLATVFFYMLVAIIIHATLQEYVLDKINRRMQ
FPKAKQSRFNESGQLSAFYLVSCIWGTFILISENCLSDPTLLWEAHYHNVMTFQMKFFYISQLAYWFHAFPELYFQRTKKQDIPRQLVYIGLHLFHIAGAYLLYLNHLGL
VLLMMHYFVELLSHICDLFYFSDEKYQKDISLWAIVFILGRLVTLIVSVLAVGFHLAGGQNRNPDAVTGNVNVLAAKIAVLSSSCTIQAYITWNLFNVQLQRWMEEDATL
QAPSVKKKRTKGRSSRKGTENGVATSSRVDSPHKRKEKSS*
16 >lcl|XP_001504483.1|Plus159861168..59862052 NW_001867385 syntaxin-19-like LOC100062397 __SEG__ Chr19 {Equus caballus} MKDRLQELKQRTKEVELSGNRPVSTTAAEEHEALPQQAVLYEREPVAERHLHEIQKLRESINNLTDDVQRFGQQQKSLVASMRRFSLLKRESSITKEIKIQAEHINRGLD
DLVKEVKKSEAENGPSSVVTRILKSQHAAMFRHFQQTMFVYNDTIAAKQEKCKTFIFRQLEVAGKEVPEEEVNDMLHQGKWEVFNESLLMEITITKAQLSEIEQRHKELV
NLENQMKDLRDLFIQISLLVEEQGESINNIEMIVNSTKEYVNTTKEKFGLAVKYKKRNPCRVLCCWCCPCCGSK*
17 >lcl|XP_001915377.1|Plus1complement(130940..132517) NW_001867407 uncharacterized protein C1orf65-like LOC100070594 __SEG__ Chr30 {Equus caballus} MPGPQLTDQAPGRLGAGQPSPAWQQQVRAATTNSFGPARFYPRDQGDLTLALTPRGSYTPLSETVRGRKAQSGDQWAVPVCGGLGRWSFSSVPTERSSAPSQEFRTQSAC
MYTRKRDSSGPVESVASQYSQPSVSSREVQGQHTQILKDKLEEAVTSSRDEKIVALVLVRLKKAQRMRELQQQAALAWEELKRSDQKVQMTLERERKLLLQQGREQWQPE
KERRKTRQSREQRVRRQDSHAKNTIQQQNRCKAPLDDQENPRREKLETARAVAEHRKQCQVQRLQEQERVLQNLREQNGLQLQKRLEQACKKKRLYTVESQKKVQETNLS
SLVNYQARKVLMDCQAKAEELLRKLSLEQSSQRSQEIQQSLMKERHRELREKAQKEGAQLQQVKWRAEASEEQRQVHKRLLAELRDQKIQQTRSHVHSNMRDKVQHIREL
SVLREKNHHILKLKAEKEEKCHIEGIKEAIRKKERRMEQISREKDAILEEFQKISRATRRNTERVLANSGFSGLAPRAGRQGGGY*
18 >lcl|XP_001916100.1|Plus121422236..21422763 NW_001867388 ADP-ribosylation factor 6-like LOC100065920 __SEG__ Chr1 {Equus caballus} MRKVLFSFFGNKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDR
EMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS*
19 >lcl|XP_001916561.2|Plus1complement(31204203..31205930) NW_001867385 LOW QUALITY PROTEIN: platelet glycoprotein V GP5 __SEG__ Chr19 {Equus caballus} MLRSALLCAVLGLLRARAPARPALPLPTSLQVCLPGRCAMLRGRRGAHRRARPARQPHAHPALPNEPRRLAE*QLQWYDRPAAPDAVRQPHFRHCPRHLR*PDKTKNPEI
VPQQDHSSSRRAIG*DGPPRAVVFGPQ*TKGH*PKHVSETG*PAGALFEPKSTRFPSS*PLHNSGEPEIVGFIGKQFDSPAQGIAWGTG*A*ETSAPLEPARLSGFGVVE
QPARPDRAAARQKSHPFHRTRCLRPAPKPELFDSFQKPPRIPALCSLSSFAQFDSIDPVREPAGRAPGGALRGDGRPAGAVAERHPAAHPASRRLPQPEPPAGVGGDSEP
ASERAPRGRLPRPRRAPGARAALQQPGLPPRRLAARPPQAAPSVAAPQPAAGPAPRALPQPQQPGGGPARPQPAGEPGWRRV*GSAPADGGPAGAQSLALRLWPRAIPGV
AAAAPGPREPSGAPALSRPGAARRPAALGPGGR*PGVPEHPGPASLLSR*QLLRSPHPAGPARGLHPPCLGA*ELRTLGTGPAACPGQASRP*PVLGSLFSAFSYSGHNN
WHHCVCYD*TRRALSKTNQR*SS*VL
20 >lcl|XP_003365187.1|Plus1complement(13650201..13650779) NW_001867422 ADP-ribosylation factor-like protein 4C-like LOC100057460 __SEG__ Chr6 {Equus caballus} MGNISSNISPFQSLHIVMLDWDSAGKNAVLYRLKFTEFVITVRTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHK
VTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR*