SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam U    

ID / Description / Sequence
1 > lcl|XP_003431572.1|Plus1 25872633..25873178 NW_876251 ADP-ribosylation factor 1-like LOC611567 __SEG__ Chr10 {Canis lupus familiaris} MGNIFANLLKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEHKNTSFAVWDVGGQDKIRPLWRHYFQNTRGLIFVVDSNDREHVNEAREELMR
MLAEDELRDAVLLVFANKQDLRNTMNAAEITDKLGLHSLHHRNWCIQATCATSRDGLYEGLAWLSNQLRNQK*
2 > lcl|XP_003431583.1|Plus1 37770560..37771105 NW_876251 ADP-ribosylation factor 1 ARF1 __SEG__ Chr10 {Canis lupus familiaris} MGNIFANLFKGLFGKKEVRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEHKNSSFAVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMR
MLAEDELRDAVLLVFANKQDLRNTMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLAWLSNQLRNQK*
3 > lcl|XP_003431683.1|Plus1 complement(18004717..18008034) NW_876253 ran-binding protein 6 RANBP6 __SEG__ Chr11 {Canis lupus familiaris} MAAAVSAGGPATVSGKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMAAALLRRLLSSGFEEVYPNLPSDVQRDVKIELILAVKLET
HASMRKKLCDIFAVLARNLIDEDGTNHWPEGLKFLIDSIYSKNVVLWEVALHVFWHFPGIFGNQERHDLDIIKRLLDQCIQDQEHPAIRTLSARAAAAFVLANENNIALF
KDFSDLLPGILQAVSDSCYQDDDSVLESLVEIADTVPKYLGPYLEDTLQLSLKLCGDSRLSNLQRQLALEIIVTLSETATPMLKKHTNIIAQAVPHILAMMVDLQDDEDW
VNADEMEEDDFDSNAVAAESALDRLACGLGGKLVLPMTKEHIMQMLQSPDWKYRHAGLMALSAIGEGCHQQMESILDETVNSVLLFLQDPHPRVRAAACTTLGQMATDFA
PNFQKKFHETVIAALLRTMENQGNQRVQSHAASALIIFIEDCPKALLVLYLDSMVRNLHSILVIKLQELIRNGTKLALEQLVTTIASVADTIEEKFVPYYDIFMPSLKHI
VELAIQKELKLLKGKTIECISHVGLAVGKEKFMQDASNVMQLLLKTQSDLNNMEDDDPQTSYMVSAWARMCKILGSDFQQYLPLVIEPLIKTASAKPDVALLDTQDVENM
SDDDGWQFVNLGDQQSFGIKTSGLEAKATACQMLVYYAKELGEGFVEYTEQVVKLMVPLLKFYFHDNVRVAAAESMPFLLECARIRGPEYLAQMWQFICDPLIKAIGTEP
DTDVLSEVMNSFAKSIEVMGDGCLNDEHLEELGEILKAKLEGHFKNQELRQVKRQEENYDQQVEMSLQDEDECDVYILTKVSDILHSLFSTYKEKILPWFEQLLPLIVNL
ICSSRPWPDRQWGLCIFDDIIEHCSPTSFKYVEYFRWPMLLNMRDNNPEVRQAAAYGLGVMAQFGGDDYRSLCSEAVPLLVKVIKCANSKTKKNVIATENCISAVGKILR
FKPNCVNVDEVLPHWLSWLPLHEDKEEAIQSLSFLCDLIESNHPVVLGPNNSNLPKIISIIAEGKVNETINYEDPCAKRLANVVRQVQTSEELWLECISQLDDEQQEALQ
ELLNFA*
4 > lcl|XP_003431815.1|Plus1 36883342..36883548 NW_876254 protein transport protein Sec61 subunit gamma-like LOC100685926 __SEG__ Chr12 {Canis lupus familiaris} MDQVIQFVERSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG*
5 > lcl|XP_003431951.1|Plus1 27471973..27472575 NW_876258 ADP-ribosylation factor-like protein 4A-like LOC100684100 __SEG__ Chr14 {Canis lupus familiaris} MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERME
EAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR*
6 > lcl|XP_003432504.1|Plus1 4351630..4351962 NW_876266 signal recognition particle 14 kDa protein-like LOC100686408 __SEG__ Chr18 {Canis lupus familiaris} MVLLESEQFLTELTRLFQKCRLSGSMFITLKKYNGRTKPIPRKGSVEGFEPSDNKCLLRATDGKKKISTVVSSKEVNTFQMAYSNLLRANMDGLKKRDKKSKSKKSKAA
Q*
7 > lcl|XP_003432559.1|Plus1 21492259..21492528 NW_876269 mitochondrial import inner membrane translocase subunit Tim9-like LOC100683986 __SEG__ Chr1 {Canis lupus familiaris} MAAQMPESDQVKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR*
8 > lcl|XP_003432739.1|Plus1 complement(30602847..30603476) NW_876270 mitochondrial import inner membrane translocase subunit Tim23-like LOC100686615 __SEG__ Chr1 {Canis lupus familiaris} MESSQGSGNKTTGGLAGFFGAGGAGLWHTDLARVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTWGRFELAFFTMGGCCMAGAAFGTMNCLRLGLKETQNMSWS
KPRNVQILNMVTRQGALWANTLGFLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLQGVARGGLAGLTLTSLYALCNNWEYMKGSLLQQSL*
9 > lcl|XP_003432839.1|Plus1 27264901..27265467 NW_876272 trafficking protein particle complex subunit 5-like isoform 1 TRAPPC5 __SEG__ Chr20 {Canis lupus familiaris} MEARFTRGKSALLERALVRPRTEVSLSAFALLFSELVQHCQSRVFSVAELQARLAALGRQVGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQAN
DDARTFYIIEREPLINAYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHWHKGTTLMIKFEEAVIARDRALEGR*
10 > lcl|XP_003433139.1|Plus1 complement(5717231..5719705) NW_876275 zinc finger protein 828 isoform 1 ZNF828 __SEG__ Chr22 {Canis lupus familiaris} MEVFQEVRKPSSRLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAKLFHCHKCFFTSKMYSNVYYHITSKHAGPEKWNEKPKNPVSKETDPGKSP
PLPEHQKMSSNSAELPKPIPALSIETQKLGPILSPESPKPTPLTSLEPQKPGPVVSPEPQTPSLPSPEPPKSASVSSPELPKSVPFVSESQKPVPVPSPEPQKLGPISPE
PVKATLVNPKPQKHSHFTETLGPPSGSSPESPVLAASPEPWGPSPTASPESRKPARTISPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPGSWKPGPPGSPRSWKSS
PSASSGPWKPAKPAPSVSPGPWKPIPSISPGPWKPTSSVSPASWKSSSVSPGSWKSPPASPEAWKSGPPELRKTAPTLSPEHWKTVPSVSPELRKAGPPLSPELRKPGPP
LSPEIRSPAGSPELRKPSGSPELWKLSSDQRKTSPASLDFSESQKSSRGGSPDLWKSSFFIEPQKPVFPETRKPSGPSESPKAGSDIWKPVLSLDTEPRKPALFSEPTKT
APPASPEPRKRALFPEPRKHALFPELPKSAIFSESQKAVELGDELQTDAIDDQKCDILVQEELLATPKKLLEDTLFPSSKKLKKDNQENSDAELSSSEYIKADLDVIDSK
GQESSSDQEQVDVESIDFSKENKMDMTNPEQSKNVLQFTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHV
AAHGQSLLKCPRCNFESNFPRGFKKHLTHCQSRHNEEANKKLMEALEQPLEEQQI*
11 > lcl|XP_003433148.1|Plus1 15554545..15554868 NW_876276 GTP-binding nuclear protein Ran-like LOC100682756 __SEG__ Chr23 {Canis lupus familiaris} MQKSLVKYISKXNKVHIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGNPNLEFVAMPALAPPEVVMDPALAAQYQHDLEVAQTTALPDGDDDL*
12 > lcl|XP_003433295.1|Plus1 complement(22907031..22907324) NW_876277 mitochondrial import inner membrane translocase subunit Tim8 A-like LOC100686595 __SEG__ Chr24 {Canis lupus familiaris} MDSSSSSFVAGLGSVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPAFSESISD*
13 > lcl|XP_003433561.1|Plus1 complement(7376665..7377915) NW_876284 protein FAM113B-like LOC100688299 __SEG__ Chr27 {Canis lupus familiaris} MVHLQASEVQQLLHNKFVVILGDSVQRAVYKDLVLLLQKDCLLTTNQLKAKGEETFEKDELVDGGQMGPMHNGVQYREVRQFCDAHHLVRFYFLTRVYSSYLESVLQEL
QGSEHGPPDVVIMNSCLWDLSRYGPDSWRSYRENLASLFRRLGQVLPESCLLVWNTAMPVGKQITAGFLPPDHQPGDGSLIERVIEANFYSSAEAKRHGFDVLDLHFHFR
HAGQHLQRDGVHWDERAHRHLSQLLLAHLADAWGVELPRRDHVSTCVRARPGFPVRGRAPPRARCYPLLPTPPPPRPFPLPQPRPPYLCGPQDAYFSSGPSFQSDEFSSN
YFHSDVPFPAQMGFSFEDDFMMDARPPGPPGPPGPPGPPFPLPYLQRAPVVHRGVPRYAPRGPYGPWGGRPRPSRRRAHSRPQPRPQ*
14 > lcl|XP_003433649.1|Plus1 10329294..10333034 NW_876285 uncharacterized protein C10orf12-like LOC100688247 __SEG__ Chr28 {Canis lupus familiaris} MQSSALVESLIAVKVATENSEESNSCIVSQRNSFKALSEEAWDSGFMENSPRTADKENALLCSSKTSMRQELESSEQDSRPKQENHLHSLGRNKVSYHLHPSDKGQFDH
SKDGWLAPSPMPAVHKASNGHSRTKMISTSIKTARKSKRASGLRINDYDNQCDVVYISQPITECHFENQRSILSSRKTARKSTRGYFFNGDCCELPTVRTLARNLHSQEK
AGCSTVEPETVVTPKQTLTLSAPAPVVDMQDPREDNQEEPSKETTSLKEGEGEASSDKESQESEVCPMTNKPSPSSSPKSEEMTAPSLVSALPAHLPEEDRPEGSSTVSI
PTASGIASPEQDQQQVELLGIKDVKEGTLIQDGHLVSSTENISEGGSEDVVSRPHSSPEEANREEDPPCSESPPVGPEPPLSLGKAEDNQSISTEATTKDTQELDTDPLL
KESSTFTNENPSEIEDSEAAGGTGKLEGQGSDIKHSSEKDVCDQNIDSPEENVDKKKKGKKTPEASDRCLRSQLSDPSSVDRCLRSQSSDSSSACPEIKVSKNPGTKRSK
KEGCPGEMAPESLLADSFHTKGLEDTENPDVNENPYEKDAEQEGEGGGIITRQTFKNMLAKQVKGEEGDIFPSSDPISTVGQPLPGERLEIYVQSKLGEKNAHDPSESIP
YTFPEQSKEKPEPIPAQDTEEVVNEVGTANTQDKDDNSDAPSSALGLSSSGSGDTAGPPKWVPRLTRLTSSTYNLRHAHSLDSLDTAKVTSEKEAAQGNPMPKENEASES
GDPLDDDDVDTVVDDQPKFVEWCAEEENQELIANFNAQYMRVQKGWIQLEKEAQPTPRSRNKSDKLKEIWKSKKRSRKCRGSLEVQKFSPVQMLFMTHFKLSNVCKWFLE
TTETRSLVIVKKLNTRLPGDIPPVKHSLQKYSPSSLYPSSLQAERLKKHLKKFPGATPARNNWKTQKLWAKFRENPDQVEPEDGSDVSLSLNSEDSIEEVKEGRNSHPPT
NSPTPASTRILRKYSNIRGKLRAQQCLIKNEKMESPFGQPVESKQSCKSVCINPLMSPKLALQVDADGFPIKPKSTDGMKGKKGKHVSEILPKAEVQNKRKRTESSTQDR
KDKGPVVKASKEKHPDGSTKTPAAKKPAARDRVSQLPKKTSLKENKVKIPKKSPGKNCPPSRREKENTSKRPTQPTASETGTKPAKQKGVGESSSRPQKATNRRQSSGKT
RARPLTKTPESSAAQRKRKLKAKLDSSHGKRRRLDAK*
15 > lcl|XP_003433703.1|Plus1 7190963..7191628 NW_876288 ras-related protein Rab-28-like LOC100686651 __SEG__ Chr29 {Canis lupus familiaris} MWDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGPDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVCDITNYQSFENLEDWYS
VMKKVSEESETQPLVALVGNKIDLEHMRMVKLEKHLRLCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCA
VQ*
16 > lcl|XP_003433728.1|Plus1 1613157..1613669 NW_876288 islet cell autoantigen 1-like LOC100684758 __SEG__ Chr29 {Canis lupus familiaris} MDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLIEKEERKKITQQESAEATMEEPSQLISLEDENQHKESSSFK
TEDGKSVLSALDKSSIHNACSDELLDMKPEGGACMGPMAGTSEPESADKDDLLLLSTVECC*
17 > lcl|XP_003433741.1|Plus1 638553..638936 NW_876289 nuclear transport factor 2-like LOC100682808 __SEG__ Chr2 {Canis lupus familiaris} MGDKPVWEQIGSTFIQHYYQLFYNDRTQLGAIYIDASCVMWEGQQFQGKAAIGEKSSSLLFQKIQHSITAQDHQPTPDSCIISMVAGQLKADEDPIMGFHQMFLLKNIN
DAWVCTNDMFRLALHNFG*
18 > lcl|XP_003433804.1|Plus1 complement(47474..50539) NW_876292 hypothetical protein LOC100688546 LOC100688546 __SEG__ Chr2 {Canis lupus familiaris} MLTALARPARPGLPGQPPAAPARRQDSSGSSGSYHTAPGSPGPPDVGPDAECRAHWPGVAPALGAGAQPRLSVSAQNSRQQPGPGSGFPRGRGSSPRPPQPQLRMLPSG
EMEVIFGAGAPFRRSDAADSEVQQLTARAFRSLSPPGPATPAPATPTPQAPDGGSRWATYLEVRPRGPSPGTPAQFECVEVALEEREAPARSRTVPKRQIELRPRPQSPP
REAGAPPRPRLLLRTGSLDESLGRLQEAAGLVQTALARKLSPAAPAPSSATFGPTGQPECASRETARSTRKVPEEARSRPPRVHYGSAPTKAPRPWPSLRERAIRRDKPA
PGTEPLGPVSSSIFLQSGEKTREAQSQELKTRSPRQTPDRAILRAQSPPFESRGPREVPSKAGRPWSSSPLWQAPNGTVRGPHCPSPQNPPPWNRAIRRVSSPSFPEASR
AWGNRDPAVEETVSRRSPSPPTVSPWNQGVARTRSSSPEAPSLWEVPQPAVGNTAEGSRSAYPPALSSWEAPDRANGTWHPSPQDTWGPTPQGSSIVSTSKALNGIGMEE
LERPRPPTPGTPELTEAQGQSSREVQDLAFRGSQPSPEAAAPELTLSRLVGPVDADVPREALGLGEAASGRPRVALPRPRDVRKMVKTTYAPSFPAGTAALRLPAPPVEP
GAEEGGASGTEALPALASPAPAHYTSVYLKDFLPVVTHPYEPPEPSPDAVPRDAPRPNGALRRRAENSTAKPFARTEIRLPAALAVGRRPEGAGAVVRGAGGESREAEAR
RLVPDGEGRTSPLGGARASPQPPPTGPGGAQPPRPPCPRSPQAHPSSSAGTAPEVETSPAAPEPATAIQSSLLRESQASAGRTGPPQPRAASAPPTDRPLEGPLHGARRP
PGTAYPGKVLVDPESGRCYFVEAPRQPRLRLLFDPESGQYVEVLLPPSPQVPPRRVYTPLALGSGLYPPAYGPLPGLSVPPSLAPAGFSGPQVPWASDAGPLDGMYYLPV
SGTPSPAPPLLLCAPPNSSSSAQPGKGSLFSV*
19 > lcl|XP_003433891.1|Plus1 complement(35407160..35407693) NW_876292 coatomer subunit zeta-1-like LOC609925 __SEG__ Chr2 {Canis lupus familiaris} MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNV
EKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR*
20 > lcl|XP_003434008.1|Plus1 complement(25484702..25484863) NW_876295 keratin-associated protein 22-1-like LOC100686676 __SEG__ Chr31 {Canis lupus familiaris} MSYYYGNYYGGLGYGLGGLGCGYGCGYGAGYGGFGYGFYRPCCYGRRWFSGCY*
21 > lcl|XP_003434285.1|Plus1 5431249..5431581 NW_876303 signal recognition particle 14 kDa protein-like LOC100687868 __SEG__ Chr36 {Canis lupus familiaris} MVLLESEQFLRELTRFFQKCQLSGSMFITLKKYDGQTKPIPRKGSVEGFEPSDNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKSKSKKSKAA
Q*
22 > lcl|XP_003434413.1|Plus1 complement(47117092..47117475) NW_876307 nuclear transport factor 2-like LOC100686918 __SEG__ Chr3 {Canis lupus familiaris} MGGQPIWEQIRSSLIQHYYQLFDNDRTQLDTMSIDASCLAWEGQQFQGKAAIAGKLSSLPFQKIQHSLMAQDHQPTPDSCIISMVVGQLTADEDPIMRFHQMFLLKNIN
DAWVCTNAVFRLALHDFS*
23 > lcl|XP_003434546.1|Plus1 28433123..28433452 NW_876311 signal recognition particle 14 kDa protein-like LOC100687486 __SEG__ Chr4 {Canis lupus familiaris} MVLLERKQFLMELTRLFQKCQLSVSMFITLKKYDGRTKPIPRKGSVEGFEPSDNKCLLRATDGKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKSKSKKSKAAQ
*
24 > lcl|XP_003435045.1|Plus1 complement(31123352..31125307) NW_876323 rab proteins geranylgeranyltransferase component A 2 CHML __SEG__ Chr7 {Canis lupus familiaris} MADSLPTEFDVVIIGTGLPESILAAACSRSGQRVLHLDSRSYYGGNWASFSFSGLLSWLKEHQQNGDNAEESTASWQGLVHETEEAIALRKKDETIEHIEVFCYASQDM
DDNIEEISALQKNPSAVTSKPLDSVCLSEETNSLHVTSSETHAKDTPKSDEEISLEVTDVEDILAEEKCCGDKTCINTASGGDKDENKPIEEDNTDQPKRNRITYSQIVK
EGRRFNIDLVSKLLYSQGLLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRILMKFLTFCLDYEQHPDQYQAFVHCSFSDYLKTKKLTPN
LQHFVLHSIAMTESSCTTIDGLKATKNFLRCLGRFGNTPFLFPLYGQGEIPQCFCRMCAVFGGIYCLRHKVQCLIVDKESGRCKAIIDHLDQRINAKYFIVEDSYLSEET
CSNVQYKQISRAVLITDQSILKKADSDQQISILIVPPMESGTCAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEIDKEELTKPRLLWALYF
NMRDSSGISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEIFPNEDFCPPPPNPEDIIFDGDDKQPEALGTNNIIMAKPDYSEENKNPESPENHLQN*
25 > lcl|XP_003435060.1|Plus1 13692515..13693114 NW_876324 charged multivesicular body protein 1b-like LOC100686812 __SEG__ Chr7 {Canis lupus familiaris} MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLE
KISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV*
26 > lcl|XP_003435127.1|Plus1 complement(19853617..19856253) NW_876327 fibrous sheath CABYR-binding protein-like LOC100684231 __SEG__ Chr8 {Canis lupus familiaris} MEESDEPDQPISAGRQEIRKRRRLSQSMVDKSQQTEVTEKKKHLPISQSSGPKSTVSIGNIPGSKVNYESLRVSSQLQQTWTKRKHVQDMTDKSLQTEAIVEEKKEEIR
SVGETVVPEEKPAAVGAAVPEFPETVQEVEIPPSRHSIQLKIDRSQQTSCTGDWSMMNIPQKEKVDKEQQTYFSETEIVVIGQPDSSFSKSNEVVQKSESSGKLFISEYP
ELLPSTSRDEEIRRISISKFLFSQQSKKGSLELSEDEQYVLGDVSPTAEEIFAEVQSLPDETTAENFPTEPQPPPIEEAPTEEGLATIEPTLSEEALSEGPPVEVQSPKV
EEAPVEVQIFPAEEISAEEAPAKVESIPAKEAFSEEVYPEVQLTTAEEPPIRETEEFQPLLAETSPEVQPPPAEKAPAEEASDEVQPPLAETSPEVQLPPSEKAPADETS
DEVQPPPAETSSEIQPPPAEKAPAEEVSDKVQPPPAEKAPADETSDEVQSPPAEKAPAEEAPDEFQPPPAEKAPAEEAPDEVQPPPAEKALADETSDEVQSPPAETSPEV
QPPPAEKALVEEAPDEVQPPPAEKAPADETSDEVQSPPAETAPEVQPPPAEKALAEEASDEVQPPPSEKAPADETSDEVQPPPAEKAPAEEAPDEVQPPPAETSPEIQPP
PSEKAPADEPSDEIQHAPAETSPEVEPPSAEEVPAEEAPIDVQSPPAETSPEVHSPLLEEAPVEEAAVEICSTPPEEAPKEDTSARVWSEPAGVALVEPQHPSAEETTLE
MVPVDKQFPAAEEDFFTQISVEDVLAEVQLPPSEHTAADEPLVDHMSTEYQHLQTADVPVVKLESLVLEDQQKPEEPLELDPVPEDLSNIKKEQAPAFEIEGVFHIEIK*

27 > lcl|XP_003435575.1|Plus1 5700913..5701269 NW_879563 BET1 homolog LOC100683074 __SEG__ ChrX {Canis lupus familiaris} MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKHQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYMLLFSLFVFF
VIYWIIKLR*
28 > lcl|XP_003435623.1|Plus1 complement(26915180..26916991) NW_879563 armadillo repeat-containing X-linked protein 2-like LOC100687956 __SEG__ ChrX {Canis lupus familiaris} MSRVRDAGCVAAGIVIGASAWYCVYKYARGRNQTKKRLAKPKTRAMAGTGARARARLRAGFTIDLGPGFGPPTPVRTQAENRAQEEASALDTDGAEAVAPAATGAEVQS
GAGHQVQEAEGAGAGPKAEPVMGATGTSSMASPLGEAEASVAAEAPTVARAPKLPEAPGTAEAPGVPTMPPSVPAPTEATAPMEAAEAPVPTPPTAVLVPSGAAEAPGTS
GSPRSVAPSKKATPGAHTGAIPKAGSATGAVPKGGAKGTRSRTGGKGKGKKNKVEVDELGLGFRPGDGAAAAAAASANGGQAFLAEVPDSEEGESGWTDTESESDSEPET
QQRGRGRRPVPMQKRPFPYEIDEILGVRDLRKVLALLQKSDDPFIQQVALLTLSNNANYSCNQDTIRKLGGLPIIANMINKTDPHIKEKALMAMNNLSENYENQGRLQVY
MNKVMDDIMASNLNSAVQVVGLKFLTNMTITNDYQHLLVNSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPSSFSSLYNSYVESEILINALTLFEIIY
DNLRAEVFNYREFNKGSLFYLCTTSGVCVKKIRALADHHDLLVKVKVIKLVDKF*
29 > lcl|XP_003435633.1|Plus1 47081151..47081693 NW_879563 prothymosin alpha-like LOC611335 __SEG__ ChrX {Canis lupus familiaris} MSEIVFLLSLTDLFCLALHSLAPTGCSEKPSLHCSQSGFQFTATTSAPLASRSFLAGVLELLLSFQSAATDHQRAPAKDTSSEITTKDLKEKKAVVEEAENGRDTPANG
NANKANGEQEADSEVDEEEEEGGEEEEEEGDGEEEDGDEDEEAEAATGKWATEDDEDDKVDTKKQKTDEDD*
30 > lcl|XP_003435662.1|Plus1 26885627..26886766 NW_879563 armadillo repeat-containing X-linked protein 3 isoform 1 ARMCX3 __SEG__ ChrX {Canis lupus familiaris} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDVGDCPGARYNDWSDDDDDNSENKGIVWYPPWARIGTEAGTRARARARARATRARRAVQKRA
SPNSDDTILSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTITSRLNSS
VQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKFQVLKLLLNLAENPAMARALLRAQVPSSLGSLFTKKENKEVILKLLVIFENINDNFKCEETEPAQDQFS
EGSLFFFLKEFQGCADKILGIESHHDFLVKVKVGKFMAKLAERMFPKSQE*
31 > lcl|XP_533988.1|Plus1 13759586..13760698 NW_876273 coiled-coil domain-containing protein 89 CCDC89 __SEG__ Chr21 {Canis lupus familiaris} MPQEEKPLRMDPAPTEEPLEKQNKKLEKPEEEMEFKELDGLREALANLRGLSAEEKSEKAMLCSRIQEQSQLICILKRRSDEALERCQILELLNTELEEKRMLEAEQLK
AKSQHAQKLEERFMTLAANHELMIRFKDEHKSQNVKLREENEKLRLENSNLFSQALKDQEAKVLQLTARSEALSKELETLKQRCAQDACQAQAREKELLELQNQQACAHT
KETEQLRSQLQSLQQQQRQAVEQMAEAERAHSSLNRELQARLQTVTREKDELLQLSMERGRVLQNKQAEIRQLEEKLETADVARRHALERFEQEAVAVDSNLRVRELQRR
VDGIQKAYDELRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
32 > lcl|XP_536284.2|Plus1 complement(73306360..73306794) NW_876311 signal recognition particle 19 kDa protein-like LOC479138 __SEG__ Chr4 {Canis lupus familiaris} MACAAARSPAEQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAA
EMIPKLKTRTQKTGGGDQSLQQGEGSKKGKGKKKK*
33 > lcl|XP_542604.1|Plus1 23953745..23954509 NW_876274 coiled-coil domain-containing protein 70-like LOC485485 __SEG__ Chr22 {Canis lupus familiaris} MAVSQSKWINRDRILHLFSSVFSCTQDQNKLKHESHEVEKNLQRDNKVSRDENKALRKENKSLWGENKALRRENKAFRMDQLIPEVNQSLREQNEVLWKFKNVILESQN
PAGEKINALNTERKFYWQQNRGLKAQIKALREQEKAFQTEAKALQEEIRSLHEEIKALKHQERAIKMEEQALMKEGIAIEMEEKALWEEAQALREENMALREENRALQEE
EKALLEEAKVLEEWNKILQFTLAGKKHKNKTKQKN*
34 > lcl|XP_542667.3|Plus1 complement(2565743..>2569843) NW_876275 insulin receptor substrate 2 IRS2 __SEG__ Chr22 {Canis lupus familiaris} GPNLNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGDEAAATAGGVPAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTRDEYFAVAAE
NEQEQEGWYRALTDLLSEGRAGDAPPAPAPANAAASCSASLPGALGGSAGAAAADDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQP
SVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFRPRSKSQSSGSSSTHPISVPGARRHHHLVNLPPSQTGLVRRSRTDS
LAATPPAAKCSSCRVRTASEGDGGAGAGAAGAGAGVGAGAGAGAGGRPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRASKVAPAPAGGALQHSRSMSMPVAHSPPAATS
PGSLSSSSGHGSGSYPPPPGPHPPLQHPLHHAASQRPSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGELYGYMTMDRPLSHCGRP
YRRVSGDGAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRATFSGSSGRLCPSCPASSPKVAYNPYPEDYGDVEIGSHRSSSSNLGADDGYMPMTPGVALMGG
GGGSCKSDDYMPMSPTSVSAPKQILQPRASAAALPPTGAAVPAPAPSAGRAFAASGSGVSYKASSPAESSPEDSGYMRMWCGSKLSMESADSKLLPNGDYLNMSPSDAGT
SGTPPDFFSAALHGSGEMLRGVPGYCYSSLPRSYKAPYTCNGDNNDQYVLMSSPVGRILEEERLEPPASPGPTAGGAFAGAGGHTQPPHPAVPSPGRPGGSSAGRPDGFL
TQRCRAVRPTRLSLEGLQTLPSMHEYPLPPEPKSPGEYINIDFGEAGARLSPPAPPLLASAASSCSLLSASSPASSLGSGTPGTSSDSRQRSPLSDYMNLDFSSPKSPKP
GAQSGDPVGSLDALLSPEAASPYPPLPPRPAAPAASLQLQPPPPPPPGELYRLPPAAPSQGPGAASSSSSEPGDNGDYTEMAFGVAATPPQPIAAPPKPEGARVTSPTSG
VKRLSLMDQVSGVEAFLQASQPPDPHRGAKVIRADPQGGRRRHSSETFASTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGSSGVLGAGDDRPMSPRQLQPPHPQQ
ARPWGPGQPGGLVGCPGGSGAPMRRETSAGFQNGLNYIAIDVRDEPGLSPAPQQHPHPQPGDKSAWGRTRSLGGLITAVGSSGGGGVCGGPSPGALPPANTYASIDFLSH
HLKEATIVKGEAFGPCEGWEDRWEDGWKHRWENRWESGGLLFFATWT*
35 > lcl|XP_543901.2|Plus1 1475485..1477071 NW_876285 vesicular acetylcholine transporter SLC18A3 __SEG__ Chr28 {Canis lupus familiaris} MEPAASAGRGRGRGRGPLRAARAAAVKLSEAAGAALQDPRRHRRLVLVIVCVALFLDNMLYMVIVPIVPDYIAGMQKARRPTPGTEVSTLQLSTPASVSANRGNTSESP
TAATENEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVLFASTLLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISF
GSLVAPPFGGFLYQFAGKHTPFLVLAAVSLLDALLLLVVAKPFSAATRARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMEHTMAASEWETGMAWLP
AFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGASSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAGHIV
HSLGFAQLSLGMGLANLLYAPVLLLLRNVGLLRRSRSERDVLLEEPPQGLYDAVRLRERPVSDPDGAPRSPSGPFEECEDVYNNYYTRS*
36 > lcl|XP_544122.1|Plus1 20818276..20818659 NW_876288 nuclear transport factor 2-like LOC486993 __SEG__ Chr29 {Canis lupus familiaris} MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGTIYIDASCLTWEGQQFQGKAAIAEKLSSLPFQKIQHSITAQDHQPKPDSCIISMVVGQLKADEDPIMGFHQMFLLKNIN
DAWVCTNDMFRLALHNSG*
37 > lcl|XP_544937.3|Plus1 complement(1438577..1440796) NW_876297 ankyrin repeat domain-containing protein 56-like LOC487815 __SEG__ Chr32 {Canis lupus familiaris} MARELSQAALLDFLCRAGGRVANAALLSHFRSFLRDPDAPPGQHQRRRELFKGFVNAVAAVRQDPDGTKYVVLKRRYRHLLGQGGLQRPRAPPAAAAPAGGAASGSGQG
AGGGPQPPGAQRRGEEPEREPEREPAGAAAPAPHAARRGPAARGAREAPPGGGPGPRAAARCAAAETRGRCRDRLASSPQALPGKQGLGAAPDAATPGDEPGAAGRGPRG
QPAAPRSPPARVEAVGGRAPPQALPSRAVSPGSAPEPLALGSLPHPTLRQRQPQTPRARDQGPVRAWSVLPDSFPRPPSERTCWVGTPTSEPADPTLPSHSALPAVPESC
PENPPLTVFRSIRCQLSFQDLDDFVDQDSHGSEESSSGPKESPGGSEGGLQVALGTPGGRKLRNPAGGLSPKEGGLRDGGDGHASQQLSTEANGLAGHPRESLPRPAPKL
RRSLRRSSPARIAKLSSSDEEYLEHDLLKRTRRPPRSRKPSKAGAVSSPRVDAVLIPKPADLKAAVAEWGWPYTSWAPAGAESTALVPQRPEHKSSVIPLDAREHEWIVK
LASGCWIRVLTLFWEDPQLALHKDFLTGYTALHWIAKHGDLRALQDFVSSAQKAGIALDVNVKSSCGYTPLHLAAIHGHQGVIKLLVQRLASRVNVRDCSGKKPWQYLTS
DTSGEIWQLLEAPRGRPIFPVYPLARSSSPTRKARSREISRNITRKTSFAALLKNQHSKWKLANQYEKFPNPREREEYSD*
38 > lcl|XP_545055.1|Plus1 complement(1727888..1728772) NW_876298 syntaxin-19 STX19 __SEG__ Chr33 {Canis lupus familiaris} MKDRLQELKQRTKEIELSKDRHVSAIEAEEQGVFLQQAVIYEREPVAERHLHEIQKLQESINNLTDDVQKFGQQQRSLLASMRRFSLLKRESSITKEIKIQAEHINRGL
DDLVKEVKKSEAENGPSSVVTRILKSQHAAMFRQFQQTMFTYNDTIAAKQEKCKTFIFRQLEVAGKEVPEEEVNDMLYQGKWEVFNESLLTEITITKAQLSEIEQRHKEL
VNLENQIKDLRDLFIQISLLVEEQGESINNIEMMVNGTKEYVNTTKEKFGLAVKYKKRNPCKVLCCWCCPCCSSK*
39 > lcl|XP_545258.1|Plus1 14215898..14216476 NW_876301 ADP-ribosylation factor-like 14 ARL14 __SEG__ Chr34 {Canis lupus familiaris} MGLLSSKNSKTKQARILLLGLDSAGKSTLLYKLKLAKNISTLPTIGFNVEMIQLEKNLSLTIWDVGGQEKMRTVWDHYCENTDGLMYVVDSTDKQRLKDSSRELEHILK
NEHIKNVPVVLLANKQDVPGALTAEDITRMFKVKKLCSDRNWYVQPCCAITGDGLMEGFRKLTGFVKSHMKSRGDALAFFKQN*
40 > lcl|XP_546091.2|Plus1 8133526..8135709 NW_876310 exocyst complex component 8 EXOC8 __SEG__ Chr4 {Canis lupus familiaris} MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAA
AAAAAGAAAASGGEEGGGGAGGRDHLRGQAGFFPAPGGASRDSSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATW
LPQRRGMYRYNALYPLDGLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSEKRRREQEEAAAPRGPPQVTSKAGNPFEDEEEDEPATPEVEE
EKVDLSVEWIQELPEDLDVCIAQRDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAA
AVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFETDFAGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLTFIIHALL
VKDIQGALHSYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVRNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQH
VDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPESTTSVV*
41 > lcl|XP_547801.1|Plus1 24294701..24295228 NW_876327 ADP-ribosylation factor 6 ARF6 __SEG__ Chr8 {Canis lupus familiaris} MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIIND
REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS*
42 > lcl|XP_548073.2|Plus1 complement(1645672..1646277) NW_876332 ADP-ribosylation factor-like 4D ARL4D __SEG__ Chr9 {Canis lupus familiaris} MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERL
EEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQPGLERLYEMILKRKKAARVGKKRR*
43 > lcl|XP_548243.1|Plus1 complement(16873097..16873519) NW_876332 mitochondrial import receptor subunit TOM22 homolog LOC491123 __SEG__ Chr9 {Canis lupus familiaris} MAAAAVGCLGAPLSPDELLPKGDAERTKEELEEEDDEELDETLSERLWGLTEMFPERVLSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQ
QQLQQRWILLGPNTGLSGGMPGALPSLPGKI*
44 > lcl|XP_548367.3|Plus1 complement(971677..974604) NW_876333 uncharacterized protein C9orf172-like LOC491246 __SEG__ Chr9 {Canis lupus familiaris} MTRTDPPDLLVSTVYQDIKVAAPGPASRRPPCERSVAPPAVPAPFNKRHCRSFDFLEALDGVAMEARMEPPPPEPAAQRSRPRDADPRRRARSKSAPRAPPGLAPAPAS
PPVLPRRGREAQRTARAEASPHREPAYPALRALANELHPIKLQPQRGVPGRIAPLCAATGRCAPPEPPAGPAPHVRCRLDIKPDDAVLQHTARGSRSCGPTETTPWARAA
PQFHGLTVPGPRHMALSRTPTPSDTYCADPRALYCDGPLPGPRDYTERRGPSFTTPPGPTQFFYTEEPEGHPGSFPASPGPPFDSYYGRPFPPEEPPVPSPRRGSSYYAG
EVRTFPVQEPPSRSYYGEATRAYGPPCGPRYAPEDPRAHPALHHFYTEDFGRYRDRDALARTYPHPRSSPAWVDWGLRPYRTLQVVPPPDPGPLLASWHGGTGTSPPRLA
TDSRHYSRSWDNILVPGLRREDPLGRGRSYENLLGRETREPRGASPEGRRAPVVVNLSTSPRRYAALSLSETSLSEKSRVGEGLGRNWYVTPEITITDNDLRAAERPTAR
GWELPGGRTRPTPPAAPEAPTGGRQRSLEQLDELITDLVIDSRPPAGQAPEPAADGPGRQLRRLLDSRPAGPGAPALAPRSPPASAGSAEEPAGSGQAADASPEPSADED
DLMTCSNARCRRTETMFNACLYFKSCHSCYTYYCSRLCRREDWDAHKARCVYGRVGSVCRHVLQFCRDSGPVHRAFSRIARVGFLSRGRGVLFLGFPSPGSADNFLRFGL
EGLLLSPTYLSLRELATHAAPLGSYARELAAAGRLYEPAECFLLSVSVAVGPGAAPPGSSARPAPAPRSPGPTVRKFAKVALAAGSPARPPPARGREPDMETLILTPPPG
TAGLDQDGEAGRRAREVAFIHIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRALDWVASANLLDDIM*
45 > lcl|XP_548423.2|Plus1 6753975..6755204 NW_876333 immediate early response gene 5-like protein-like isoform 1 IER5L __SEG__ Chr9 {Canis lupus familiaris} MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQQQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDAEAR
EPAARHQLHQLHQLHQLHLQQQLHQHQHPAPRGCAAAAAGAPAGGAGALSELPGCAALQPPHGAPHRGQPLEPLQPGPAPLPPPAPAALCPRDPRASAACSAPSAPPAAA
PQAAAGASPPASPAPASSPGFYRGAYPAPSDFGVHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEDEDDEEDAGDLGAE
PPGGAPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVAF*
46 > lcl|XP_848984.1|Plus1 20842334..20842762 NW_876267 signal recognition particle 19 kDa protein-like LOC607644 __SEG__ Chr19 {Canis lupus familiaris} MACAAVRSLAEQDRFICIYPTYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNCDVQYRGRVWVQLKQEDGSLCFVQFPSRKSVMYAAE
MIPKLKTRTQKTGGGDQSLQQGEGSKKGKGKKK*
47 > lcl|XP_849341.1|Plus1 38734275..38735864 NW_876274 importin subunit alpha-2-like isoform 1 LOC608024 __SEG__ Chr22 {Canis lupus familiaris} MSTNENANSPAARLNRFKNKGKDSTEMRRRRIEVNVELREAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSNNLESQLQATQAARKLLSREKQ
PPIDNTIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASSHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMS
SLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERNEMVVKTGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQ
VVIDAGALAVFPSLLTNPKANIQREATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILV
ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGTPGTFNF*
48 > lcl|XP_850028.2|Plus1 8777188..8777796 NW_879563 nucleophosmin-like LOC608047 __SEG__ ChrX {Canis lupus familiaris} MEDSLDMDMSPLRLQNYLFGCEVKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDKLHIVEAEAMNYEGGPIKVTLATLKMSVQPTVSLGGFEITPPVVLQLKCGSGPV
HISGQHLVAVEEDAESKDEKEEDMKLLSISGKHSAPGSGSMFPQKKVKLAANEDDDDDDDDDDDDDFDEYKHKNLQQNTIKLNLGTYKGDYMS*
49 > lcl|XP_850731.2|Plus1 5371083..5372222 NW_876332 uncharacterized protein C17orf96-like LOC608579 __SEG__ Chr9 {Canis lupus familiaris} METLCPAPRLAVPASPRGSPCSPTPRKPRRGTQEFSPLCLRALAFCALAKPRASSLDLGPGELAPRGPVLLGPRAPLCTGGWAPDGLKHLAGPAGRSSDPDSPAGQDAD
AAVCRGRGEEEEGGGGFPHLGSRSGGPPGRCPAPRRPRESPTSSASAPPRPASGLDSQPGPAASPHQEPGSPPPPPPAGLAPEPAGPGAAPEPPAPGQTAAVDGNAPQAA
PEAPAASPPTAGGAPAAPGDLRQEHFDRLIRRSKLWCYAKGFALDTPSLRRGPERPPAKGPARGTAKKRRRPPPPHRSAQPRRPAPTLPTSSTFSLLDSFPCPPALVVGE
DGDLGPASSLRLQGDAKPPPAHPLWRWQIGGPAVPEPPGLKFWGINLEEL*
50 > lcl|XP_851585.1|Plus1 complement(8860429..8865900) NW_876276 xin actin-binding repeat-containing protein 1 XIRP1 __SEG__ Chr23 {Canis lupus familiaris} MAKAQTQAAPMPTLPTAAAEDLPLPPPPALDDLPLPPPKESFSKFHQQRQASELRRLYRHIHPELRKNLAEAVAEDLADVLDSEEPTEGDVQCMRWIFENWRLDAIGDR
ERPPAREPVPGGNVQATSRKFEEGSFANSTEQEPAGPPPSGGDVRAARQLFETKPLDELTGQAEALEAAVKEPEASGDVQGTRMLFETRPLDRLGSRPSIQEQSPLELRS
EIQELKGDVKKTVKLFQTEPLCAIQDAEGAIHEVKAACREEIQSNAVRSARWLFETQPLDAINRDPSQVRVIRGISLEEGARPDVSATRWIFETQPLDAIREILVDEKDF
QPSPDLIPPGPDVQQQRHLFETRALDTLKGEEESEAQHPPKEEVVPGDVRSTLWLFETKPLDTPRDKVQVGHLQRVGPRDHEGLISEHLSRDGSSAASHSQSAAQRDGVK
GDVKAFKNLFETLPLDSIGQGEPSAHRSMNRAEGTDSTGQSQDVGSPVYAMQDGKGHLHALTSVSREQIVGGDVQGYRWMFETQPLDQLGRSPSTVDVVRGITRQEVVAG
DVGTARWLFETQPLEVIHQRERQGRQEEEGKSQAGSQPEALPKGDVQTIRWLFETCPMSELAEKQGPEVTEPTAKAKPRSCTWMFAPQPLERPEGSREQHLQVSQIQAGE
RQTDRHVFETEPLQASGRPCGRGPVRYCSRVEIPSGQVSRQKEVFQALEAGKREEQGPRVLPEPISVGSVHKFTWLFENCPMGSLAAESIRGGNLPEEQPTGPSGSRVPE
RQETGAEGTLRTLHTLPGLLHDGGILMEVRGPGELCLAKYVLPGPGEGGPRVRKEELVSGELPRIVRQVLRRPDVDQQGLLVQEDPAGQLRLKPLRLPAPGGSGNIEDTD
SEFQQLLACGLGTSVARTGLVMQETEQGLVSLTAYSLQPQPNSRAPERGSVQLLASCIDKGDLSGLHSLRWEPPADPSPVPASEGAPKLPPTENIIHVPPLDPSMGLGHL
RGPGGTSHLPQTMEKPVPLAGEKKQEDSHTGQKGMAAWGKSEETTTTPLGPGAPDLQAAMQDLRMATAEAQSLHQQVLNKHKQGINPGATSAPLEPPRPAPAVATVAAQS
HTRPMAGGNPRIPAAPRKVSGEQKAPPRGLPGGWVTIQDGIYTAHPVRTFEPPGGVQPSEREPLSVQAPSPLQEGPGRTLGPGREEPGGGTQTASGPPEKAMARDGPGGL
QAAETTLKVASLAHPPLASGPLPAGASLHSRNASVPPPPLLPAAVTGPDFPAQARLDEDSIRQDSKLLPSHGSPASQRTPGEAQTRTPILEPKMPPRKKPPLPPKPAHLS
QICPPQRLPTPSALSPSSCKESGQGEHKPGERDATTLRPANIPTTAGQGCVSLSGGPSEQNQPSPQSGPSTMASRPTESQAARCHDQSPKSPKFSALSSHPPAPQEGPHP
PRERPTAGSQQGAPENTEILQGSQQELQGLLSQVQALEREATSSVDVRALRKLFETVPQLGVARPASAAPHKPKASVVQAFGELTKVSTEVALLKQQTLARLLDIEEAVH
KALSSMSSLQPETNTSGHSQGPSKDHSACKSSDTDGSKARPHCSSQGVRGQTAVKNQTQVASQTEVQSQAKVRNHTEAGGQAASVIPSPRRPETLREDSSLPGALPSNRD
PSCSPTFISIESAVRKLPEAPSPRGIFEVSVKSTHLAQAGLHQKGLQDNAGKKEVTQCPWQPEPAPALASPLPTGQQKNVLELQTGLDGSRCYEATGTVTQQCDGVDQCR
SPVLLSSTTVTEQAEMTKGPGPHLELHASPLLRQFLRSPARLSGALAEAETVHAPCGYSQPGAQ*
51 > lcl|XP_852176.1|Plus1 complement(6625489..6625872) NW_876323 nuclear transport factor 2-like LOC609753 __SEG__ Chr7 {Canis lupus familiaris} MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPKPDSCIISMVVGQLKADEDPIMGFHQMFLLKNIN
DALVCTNDMFRLALHNFG*
52 > lcl|XP_854544.1|Plus1 35686033..35686896 NW_876269 syntaxin-11 STX11 __SEG__ Chr1 {Canis lupus familiaris} MKDRLAEMLELTKSYDQQFPARDAEFDPPHEDVVFETDHILESLYRDIQDLQEENQQLMTDVKRLGKQNTRFLTSIRRLSSIKHDTSSIAKDIKARSENIHRKLRALKA
RGEEAEEVHGAHSAVARISRAQYNALTRTFQHAMQGYNQAEVKQRDNCKIRIQRQLEIMGKDVSDDQIEDMIEQGKWDVFSENLLADVKGARAALNEIESRHRELLRLES
RIQEVRKLFVQMAVLVEEQADTLNVIELNVQKTLDYTGQAKVQVRKAVQYTRKNPCRTLCCFCCPCLN*
53 > lcl|XP_854935.2|Plus1 complement(38547010..38547675) NW_876292 TMF-regulated nuclear protein 1-like TRNP1 __SEG__ Chr2 {Canis lupus familiaris} MPGCRISACGPGAQEGTAEPGSPPPPPRELLSSPQPPPPTPTLTPTPAQVSSPADAAPADGQELQRWRQGANGGAGGTGPAGGAAAAAGAGGRALELAEARRRLLEVEG
RRRLVSELESRVLQLHRVFLAAELRLAHRAESLGRLSGGVAQAELYLAAHGSRLKKGQRRGRRGRPPALLASALGLGGCVPWGAGRLRRGHGPEPDSPFRRSPPRGPASP
QR*