SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr T    

ID / Description / Sequence
1 >lcl|NP_001001617.1|Plus1156770..157822 NW_003301029 chemokine C-C motif receptor-like 2 CCRL2 __SEG__ Chr13 {Sus scrofa} MANYTSAPEDDYDVFIEDDLSNDERELCSPYDPQALLAQLVPYLFITVFLVGLLDNILVVLIMVKYKGLKQVENIYLLNLAVCNLCFLCTLPFWVHMAWHEGDPGEPLCK
ILLVLYSVGLFSEAFFNVLLTVQRYQKFFQMRGFFSATRMVAGSIFPSALVWVIAVLVMLPELAFYKPQMENQKYKCFFGRPLFLPADETFWKHFLTLKMNILGFLLPLF
VFVFCYVRMRRTLKFGERGYDLFKLVFTIMVVFLLMWGPYNIALFLSAFNEHFSLHGCESSHNLDRSTLITKIIATTHCCVNPLLYVFFDEAFRKHLYHFCHLCNDTAPQ
PTEEPAQGTSREEPCLSTKM*
2 >lcl|NP_001001618.1|Plus1138199..139257 NW_003301029 C-C chemokine receptor type 5 CCR5 __SEG__ Chr13 {Sus scrofa} MDYQTTSPFYDIDYGMSEPCQKTNVRQIAARLLPPLYSLVFIFGFVGNLLVVLILINCKKLKSMTDIYLLNLAISDLLFLFTIPFWAHYAADQWVFGNTMCQFLTGFYFI
GFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSGVTWVVAIFASLPGIIFTKSQKEGSRYTCSPHFPSSQYHFWKNFQTLKMVILGLVLPLLVMVVCYSGILKT
LLRCRNEKKKHKAVRLIFAIMIVYFLFWAPYNIVLLLSTFQEFFGLNNCSGSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRSYLLGFFRKHIVRRFCKGCPVFQAE
APDRVSSVYTRSTGEQEISVGL*
3 >lcl|NP_001001619.1|Plus1125914..127035 NW_003301029 C-C chemokine receptor type 2 CCR2 __SEG__ Chr13 {Sus scrofa} MDGNDTLSRFSHNVLPTSHSLLTMNIKGNDEEPTTSYDYDYSEPCQKTSVGQIEALLLPPLYSLVFIFGFVGNLLVVLILINCKKLKSMTDIYLLNLAISDLLFLFTIPF
WAHYAADQWVFGNIMCKFFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSGVTWVVAIFASLPGIIFIRSQEEHSGYACAPYFPLAWKNFHTIMRS
ILGLVLPLLVMVVCYSGILKTLLRCRNEKKKHKAVRLIFVIMIVYFLFWAPYNIVLLLSTFQVFFGLSNCKNSSQLDQAMQVTETLGLTHCCINPIIYAFVGEKFRRYLS
VFFRKHIAKHLCKQCPVFYGETGDRMSSTYTPSTGEQEVSAAL*
4 >lcl|NP_001001620.1|Plus111291..12367 NW_003301029 C-C chemokine receptor type 3 CCR3 __SEG__ Chr13 {Sus scrofa} METSVNGIETGSDAVETTPYDYELATPCIKVNVKDVGAHFLPPLYSLVFGVGLLGNVAVVVILTKYKRLRIMTNIYLFNLAISDLLFLFTLPFWIHYILRKEWSFGHHIC
KFLSGLYYLGLYSEIFFIILLTIDRYLAIVHAVFALRTRTITFGIITSVFTWILAGLAALPEFIFYESQEEFGDVVCSPLYPKNGENTWKLFHALRMNILGLALPLLIMA
VCYSGIIKTLLRCPSRKKYKAIRLIFVIMVVFFIFWTPYNLVLLLLAFQINLEASCEQSKQLDLALLVTEVIANSHCCVNPVIYAFVGERFQKHLRHFFHRHVAIYLSKF
IPFIPSERMERTSSVSPSTGEQELSAVF*
5 >lcl|NP_001001620.1|Plus111291..12367 NW_003301029 C-C chemokine receptor type 3 CCR3 __SEG__ Chr13 {Sus scrofa} METSVNGIETGSDAVETTPYDYELATPCIKVNVKDVGAHFLPPLYSLVFGVGLLGNVAVVVILTKYKRLRIMTNIYLFNLAISDLLFLFTLPFWIHYILRKEWSFGHHIC
KFLSGLYYLGLYSEIFFIILLTIDRYLAIVHAVFALRTRTITFGIITSVFTWILAGLAALPEFIFYESQEEFGDVVCSPLYPKNGENTWKLFHALRMNILGLALPLLIMA
VCYSGIIKTLLRCPSRKKYKAIRLIFVIMVVFFIFWTPYNLVLLLLAFQINLEASCEQSKQLDLALLVTEVIANSHCCVNPVIYAFVGERFQKHLRHFFHRHVAIYLSKF
IPFIPSERMERTSSVSPSTGEQELSAVF*
6 >lcl|NP_001001621.1|Plus1complement(1310371..1311435) NW_003535958 C-C chemokine receptor type 1 CCR1 __SEG__ Chr13 {Sus scrofa} METSTSKGYDATTEYDYEGSTPCQKVQERAFGAQLLPPLYSLVFVIGLIGNILVVLVLLQYKRLRSMTTIYLLNLAISDLIFLFTLPFWIDYKLKDDWIFGDHMCKLLSG
LYFIGLYSEIFFIILLTIDRYLAIVHAVFALRARTITFGIITSIVVWVLAILAAVPGFHFSKTQWEFSHFTCSLHFPYENLTNWKRFQALKMNILGLVLPLLVMIICYTG
IIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTVFVSAFQESLFTDQCRQSRQLDLAIQVTEVIAYTHCCINPVIYVFVGERFRKYLRQLFHRLVAVPLGKWLPFL
STERLERVSSMSPSTGEHELSAGF*
7 >lcl|NP_001001622.1|Plus1complement(1235824..1236825) NW_003535958 chemokine XC receptor 1 XCR1 __SEG__ Chr13 {Sus scrofa} MEPSDIPESTTPFEYDPQSFLCEKKTFVFATFSTTILYCLVFFLSMVGNSLVLWVLVKYESLESLTNVFILNLCLSDLVFSCLLPVWILGYHWGWLLGDFFCKLLNMIFS
ISLYSSISFLTIMTIHRYLSVVSPISSLRVHTLRCRVLVTAAVWAASILSSIPDAVFHKVFPSGCDYSERQWFLASVYQHNVIFLLSVGIILFCYVEILRTLFRSRSNRR
HRTVRLIFTIVVAYFLSWAPYNLILFLQTLLKLGVIQSCEVSQQLDYALLICRNIAFSHCCFNPVLYVFVGVKFRRHLKSLLRHFWLCRQQVPGFPPSPHPTGAFAYEGT
SFY*
8 >lcl|NP_001001623.1|Plus11180456..1181481 NW_003535958 C-X-C chemokine receptor type 6 CXCR6 __SEG__ Chr13 {Sus scrofa} MAEYDDGDTAFFNASNDSSQGHQDFRQFSKLFLPCMYVVVFVCGLVGNSLVLVIYIFYQKLKSLTDVFLMNLPLADLVFVCTLPFWAYAGIHEWVFGSIMCKVLLGIYTL
NFYTSMLILTCITMDRFIAVVRATKAYNQQAKRMAWGKAICLSIWMVCLLVSLPQIIYGNVLYHNRLVCGYHNNATLPMVLATQMTLGFFLPLLAMIVCYSVIIKTLLQA
RGFQKHKSLKIIFLVVAVFLLTQTPFNLVKLIRSTNWEYHSMTSFYYAITVTEAIAYLRACLNPVLYAFVGLKFRKNFWKLVKDIGCLSYLDVSRQQKSSEDMSRTASAF
HNAEATSMFQL*
9 >lcl|NP_001005844.1|Plus1complement(2202247..2203368) NW_003534665 relaxin-3 receptor 2 RXFP4 __SEG__ Chr4 {Sus scrofa} MPTPNTSAPLPAFWVNASGGSVLSADDATMPVGFLALRVMVALAYGLVGAVGLLGNLAVLWVLGNCARRAPCPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGG
ALCKMILTATVLNIYASIFLITALSVARYWVVAMAGGPGTHLSLFWARVATLAVWVAAALVTVPTAVFGAEGELCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGIIT
TSYLLLLAFLRRRRQRRQDNRVVARSIRILLASFFLCWFPNHVVTFWGVLVKFDLVPWDSTFYTIHTYVFPVTTCLAHSNSCLNPVLYCLLRREPRRALEVTFRDLRARL
WPQGRGWVEQVALKEVGRRWEEITPRDGGPSAMPTNRDKGTAG*
10 >lcl|NP_001008690.1|Plus1242979..243941 NW_003300018 melanocyte-stimulating hormone receptor MC1R __SEG__ Chr6 {Sus scrofa} MPVLGPERRLLASLSSAPPAAPRLGLAANQTNQTGPQCLEVSIPDGLFLSLGLVSLVENVLVVAAIAKNRNLHSPMYYFVCCLAVSDLLVSVSNVLETAVLLLLEAGALA
AQAAVVQQLDNVMDVLICGSMVSSLCFLGAIAVDRYVSIFYALRYHSIVTLPRVGRAIAAIWAGSVLSSTLFIAYYHHTAVLLGLVSFFVAMLALMAVLYVHMLARACQH
GRHIARLHKTQHPTRQGCGLKGTATLTILLGVFLLCWAPFFLHLSLVVLCPQHPTCGCVFKNVNLFLALVICNSIVDPLIYAFRSQELRKTLQEVLQCSW*
11 >lcl|NP_001011694.1|Plus1complement(192793..193902) NW_003535856 somatostatin receptor type 2 SSTR2 __SEG__ Chr12 {Sus scrofa} MDMAYELLNGSQPWLSSPFDLNGSVATANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPF
GKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVP
LTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLV
KVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI*
12 >lcl|NP_001025705.1|Plus1complement(1501127..1503562) NW_003535349 toll-like receptor 10 TLR10 __SEG__ Chr8 {Sus scrofa} MKLIRSIYIFCGIVMSVHGRTSELPEERELTTNCSNMSLRKVPTDLTPTTTTLDLSYNLLFQLQHSDFHSFSKLKILILCHNRIQELDIKTFEFNKELQYLDVSYNRLKT
VTWYSLASLRQLDLSFNDFDSMPISEETGNMSHLEILGLSAAKIRKSDFQKIAHLHLNTVFLGLRTLSHYEEGSLPILNTTKLHIVLPINTNFWDLLRDGIKTSKILEMT
NLDGKSQFASHETQQNLILENAKTSILLLNKVDLPWDDLFLILQFVWHTSVEYFQIQHVIFGGKVYLDHNSFDYSNTVMRTINLEHVHFRVFNIPQERVYLLFTKMAIDN
LTILDAQMPHMLFPTYPTRFQYLNFASNIFTDDVFRKPVQLPHLKTLILKDNKLETLSLVSCFVRNTSLEHLDLSQNLLQYENDEKCLWPETLITMNLSFNKLADSVFRC
LPRNIQMLDLNNNNIHTVPKEIIHLTSLQELNLAFNFLTDLPGCSHFRRLSVLNIEMNLILSPSVDFFQSCQEVKTLNAGGNPFRCTCELRDFIQLEKYSEGMMVGWSDS
YICEYPLDLKGTQLKDVHLSELSCNIALLIVIIVIIMLVLGMAVALCCLRFDLPWYLRMLGQWARTWYRVRKTTQGQLKRNIQFHVFISFCEHDSAWVKHELIPNLEKED
GSVLICFHEGNSDPGKSITEDIINCMEKSSKSIFVLSPNFVQSEWCHYELYFGHHHLFHKGSDDIILILLEPIPLYCIPTRYPALKALMEKKAYLEWPKDRRKCCLFWAN
LRAAIHVNLLETREVCELQTFTELNEGSRGSAISLIKTDCL*
13 >lcl|NP_001026945.1|Plus1complement(1524097..1526487) NW_003535349 toll-like receptor 1 TLR1 __SEG__ Chr8 {Sus scrofa} MTKENLSIFHFAIIFILILEIRIQLSEESEVLVDRSKTGLTHVPKDLSLETTILDLSQNSISELQTSDILSLSKLRVFIISHNRIQYLDVSVFKFNQELEYLDLSHNKLE
KISCHPMLNLKHLDLSFNAFDALPICQEFGSMFQLEFLGLSATQLQKSSVLPIAHLHIGKVLLVLGDSYGEREDPESLQDLNTQSLHIVYPPGKEFHFMLDVSVSTAVNL
ELSNIRCVLDANGCHHFQNVLLKLQKNSKLSNLTLNNIETTWNSFITTLQFVWHTSIEYFSISSVKLQGQLDFRDFDYSDTSLKALSLHQVVSEVFSFPQSYIYKIFSNM
NIQYLTVSATHMVHMVCPSQISPFLYLDFSNNALTDMVFKNCANLANLNTLSLQMNQLKELVNVIHMTKEMQSLQQLDVSQNTLRYDENEGSCTWTGSLLSLNLSSNILT
DSVFRCLPPRIKVLDLHNNRIRSIPKDVAHLEALQELNVASNSLAHLPGCGSFSSLSILIIDYNSISNPSADFFQSCQKIRSLKAGNNPFQCTCELRDFIQSLGQVSSDV
VESWPDSYECEYPESYKGTLLKDFRVSELSCNTALLIVTIGVTGLALALTMTGLCVYFDLPWYLRMLCQWTQTRRRARNVPLEELQRTLQFHAFISYSGHDSAWVKNELL
PNVEKEGIKICLHERNFVPGKSIMENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSDNLILILLDSIPQYSIPSSYHKLKALMAQRTYLEWPKEKSKHG
LFWANLRASINIKLMEKAEEISYTQI*
14 >lcl|NP_001027525.1|Plus1622819..623466 NW_003300625 A1 adenosine receptor LOC606743 __SEG__ Chr9 {Sus scrofa} SPRYKTVVTPRRAAMAIAGCWVLSFLVGLTPLFGWNNLSEVEQDWVANGSVGEPLIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGD
PQKYYGKELKIAKSLALILFLSALTWLPLHILNCIALFCPSCHKSSILIYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDGDPPEERPDD*
15 >lcl|NP_001032225.1|Plus1complement(655104..656444) NW_003534463 alpha-2B adrenergic receptor ADRA2B __SEG__ Chr3 {Sus scrofa} MDHQEPYSVQATAAIAAVITFLILFTIFGNSLVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDR
YWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDPGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSHRRGPRAKGGPGKGESKQ
PRPVPGEVSASAKLPTLVSQLATAGETNGCSQHTGEKDEGETSEDTGTPALPPSWPALPSSGQGQKEGVCGTSPEEEAEEEEEEECEPQTLPASPASACSPPLQQPQGSR
VLATLRGQVLLGRGMGTSSGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRQ
WTQTAW*
16 >lcl|NP_001087204.1|Plus1309590..310945 NW_003299671 selenide, water dikinase 2 SEPHS2 __SEG__ Chr3 {Sus scrofa} MAEAAATGAGGEMMAAVAAGEGCSGPAGLSLGRGFSGYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQETLLKLLAGLTRPEVRPPVGRGLVGGLEEAAQEAGLPVRAE
PSPTFPTLGIGLDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQNMIEEEREKITPLMIKGFRDAAEEGGTAVTGGQTVI
NPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKIKMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQ
NLAKQQRNEVSFVIHNLPIIAKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGTAATALAP
ENSSASSEPSL*
17 >lcl|NP_001090899.1|Plus1274212..275264 NW_003536003 C-C chemokine receptor type 11 CCRL1 __SEG__ Chr13 {Sus scrofa} MALEHNQSTDYYYEENEMNDTHDYSQYEVICIKEEVRKFAKVFLPAFFTVAFIIGLAGNSIVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKI
MCKVTSALYTVNFVSGMQFLACISIDRYWAVTKGPSQPGVGKLCLLICFCVWMAAILLSIPQLVFYTVNHKARCVPIFPYQLGTSMKALIQMLEICIGFIIPFLIMGVCY
FITARTLIKMPNIKKSRPLKVLLTVVLVFIVTQLPYNIVKLCQAIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNPVLYVFMGASFKNYIMKVAKKYGSWRRQRQN
VEEIPFDSEDVTEPTSTFSI*
18 >lcl|NP_001090903.1|Plus11865852..1869001 NW_003536748 toll-like receptor 7 TLR7 __SEG__ ChrX {Sus scrofa} VFPVWTLKRQFLILFNIVLISELLGARWFPKTLPCDVSLDAPNAHVIVDCTDKHLTAIPGGIPTNATNLTLTINHIASITPASFQQLDHLVEIDFRCNCIPVRLGPKDNL
CTRRLQIKPSSFSKLTYLKALYLDGNQLLEIPRDLPPSLQLLSLEANNIFWIMKENLTELANLEMLYLGQNCYYRNPCNVSFSIEKDAFLSLRNLKLLSLKDNNISAVPT
VLPSTLTELFLYNNIIAKIQEDDFNNLSQLQVLDLSGNCPRCYNVPFPCTPCENNAPLQIHLHAFDALTELQVLRLHSNSLQYVPQRWFQNLNKLKELDLSQNFLAKEIG
DAKFLHLLPNLVKLDLSFNYELQVYHTFMNLSDSFSSLKNLKVLRIKGYVFKELKSLNLSPLRNLPNLEVLDLGTNFIKIANLSIFKQFKTLKFIDLSVNKISPSGDSSE
SGFCSGMRTSAESHGPQVLESLHYFRYDEYARSCRFKNKEPSSSLPLNEDCSMYGQTLDLSRNNIFFIRSSEFQHLTFLKCLNLSGNSISQALNGSEFQPLVELKYLDFS
NNRLDLLHSTAFEELRNLEVLDISSNSHYFQSEGITHMLDFTKNLKVLKKLMMNNNDIATSTSTTMESESLRILEFRGNHLDILWRDGDNRYLKFFKNLHKLEELDISEN
SLSFLPSGVFDGMPPNLKTLSLAKNGLKSFNWGKLQYLQNLETLDLSYNQLKTVPERLSNCSRSLKKLILKNNEIRNLTKYFLQDAFQLRHLDLSSNKIQVIQKTSFPEN
VLNNLQILFLHHNRFLCNCDAVWLVWWVNHTEVTIPFLATDVTCMGPGAHKGQSVVSLDLYTCELDLTNFVLFSLSLSAVLFLIVITIANHLYFWDVWYSYHFCKAKIKG
YQRLISPNSCYDAFIVYDTKDPAVTEWVLDELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTEKFKIAFYLSHQRLMDEKVDVIILIF
LEKPLQKSKFFQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVTYSQVFKETA*
19 >lcl|NP_001095291.1|Plus1complement(49820..51199) NW_003300233 zinc finger and BTB domain-containing protein 12 ZBTB12 __SEG__ Chr7 {Sus scrofa} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGVSDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLGIGGSVGSHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
20 >lcl|NP_001106535.1|Plus125397..26458 NW_003535298 B1 bradykinin receptor BDKRB1 __SEG__ Chr7 {Sus scrofa} MASQTLVGFQASNQSQLPPPNATLCDGAQEAWHLLHKVLPTCVVAICSGGLLGNLFVLSVFLVPRRRLNAAEIYLAHLAASDLVFALGLPFWAETIRNGFHWPFGAPLCR
VVNGVIKANLFISIFLVVAISRDRYRALVHPVASWRRRRRRHWAQATCVLIWTAGGLLSIPTFLLRSVQAVPELNVSACVLPFPHEAWAFVRTVELNVLGFLLPLAAILF
FNYHILAALRGRGQLSRTRCGGPRDGKTTALILTLVAVFLLCWTPYHVCAFLEFLLHVRAIRGCFWEDFTDLGLQYTNFFAFINSCLNPVIYVFWGQLFRTKIWELYHRC
LPRKLTAVSSSRRKEIFQIFWRH*
21 >lcl|NP_001106690.1|Plus1831754..832791 NW_003299857 proto-oncogene serine/threonine-protein kinase mos MOS __SEG__ Chr4 {Sus scrofa} MPSPFPRRRCLPGDFSPSVDSRPCSSPCELPGPTGKLFLGGTPPRALRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYHGVPVAIKQVSRCTKNRLASQRSFWAEL
NIARLRHANIVRVVAASTRTPAAFDSLGSIIMEFGGNVTLHQVIYGATGCPEEDGPPCSAGEQLNLEKCLKYSLDVVSGLLFLHSQGIVHLDLKPANILISEQDVCKISD
FGCSERLEDLRFRPRHHLGGTYTHRAPELLKGEPVTPKADIYSFAITLWQMTTRQVPYSGERQHVLYAVVAYNLRPSLSAAVFTESVPGKKLEDIIQCGWTAPAQQRPSA
QLLLLDLRALQAELG*
22 >lcl|NP_001116544.1|Plus1complement(98399..99289) NW_003536176 alpha-1A adrenergic receptor ADRA1A __SEG__ Chr14 {Sus scrofa} MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCC
TASIMGLCIISIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKS
GLKTDKSDSEQVTLRIHRKNAPVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGKS
23 >lcl|NP_001116545.1|Plus1301141..302250 NW_003536646 alpha-1D adrenergic receptor ADRA1D __SEG__ Chr17 {Sus scrofa} MTFRDLLSVNFEGSRSDGSAGGASAGGSGGGSGGAAASEGRTVDGVPGTAGSGGVVGAGSDENNRSSAGEPGAAGAGGEVNGTAAVGGLVVSAQGVGVGVFLAAFILMAV
AGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPSIMTERKAAAILALLW
AVAIVVSVGPLLGWKEPVPPDERFCGITEEAGYAVFSSLCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASEVVLRIHCRGSSTGTDRGHGAMRSTKGHTFR
SSLSLRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPL
24 >lcl|NP_001116546.1|Plus1318728..320083 NW_003536311 beta-1 adrenergic receptor ADRB1 __SEG__ Chr14 {Sus scrofa} PRAAPDGAATAARLLVPASPPASLLTPASEGSVQLSQQWTAGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGS
FFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVCTVWAISALVSFLPILMHWWRDKGAEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLC
IMAFVYLRVFREAQKQVKKIDSCERRFLGSPARPPSPAPSPGSPLPAAAAAAPVANGRTSKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDR
LFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRVARGSCAAAGDGPRASGCLAVARPPPSPGAASDDDDDEEDVGAAPPAPLLEPWAGYNGGAAADSDSSLDER
SPGGRASESKV*
25 >lcl|NP_001116570.1|Plus1complement(<47890..49656) NW_003536228 muscarinic acetylcholine receptor M3 CHRM3 __SEG__ Chr14 {Sus scrofa} MTLHNNNTTSPLFPNISSSWIHGPSDAGLPPGTVTHFGSYNISQAAGNFSSPNGTTSDPLGGHTIWQVVFIAFLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSL
ACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGE
CFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSLKRSARRKYGRCHFWFTTKSWKPSAEQMDQD
HSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGTVDLERKASKLQAQKSMDDGGSFQKSFSKLPIQLESAVDTAKA
SDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKT
FRTTFKMLLLCQCDKRKRRKQQYQQRQSVISTSGARAGL
26 >lcl|NP_001116572.1|Plus1504778..505869 NW_003536221 chemokine receptor-like 1 CMKLR1 __SEG__ Chr14 {Sus scrofa} MDFEDYNSTYEDSYTDDFDTIVALEEFSPLEGRVVRIFLVVVYSIICFLGILGNGLVIVIATFKMKKTVNTVWFLNLAVADFLFNVFLPIHIAYAAMDYHWVFGTAMCKI
SNFLLIHNMYTSVFLLTVISFDRCISVLLPVWSQNHRSIRLAYMACVVIWVLAFFLSSPSLVFRDTAHLHGKISCFNNFSLSATSSSSWPTHPQMDTVGFGRQMVVTITR
FLCGFLVPVLIISACYFTIVYKLRRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLYLLELHHRAMPGSVFSLGVPLATAIAIANSCMNPILYVFMGQDFKKFKVALFSRL
VNALSEDTGHSSYPSHRSFTKMSSMNERETSML*
27 >lcl|NP_001116580.1|Plus1973864..975204 NW_003536566 D(1A) dopamine receptor DRD1 __SEG__ Chr16 {Sus scrofa} MRTLNTSTMDGTGLVVERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTAS
ILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNVTSLGKTTHNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRI
AQKQIRRISALERAAVHAKNCQTTAGNGNPAECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGSGETKPFCIDSITFDVFVWFGWANSSLNPII
YAFNADFRKAFSTLLGCYRLCPTSTNAIETVSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPALSVILDYDTDVSLEKIQPITQ
NGQHPT*
28 >lcl|NP_001116581.1|Plus1complement(820203..821399) NW_003534273 sphingosine 1-phosphate receptor 5 S1PR5 __SEG__ Chr2 {Sus scrofa} MEPGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCALIVLENLAVLVVLGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLRLSPALWFA
REGGVFVALAASVLSLLAIALERLLTMERRGPAPAARRGRTLALAAGAWGVSLLLGLLPALGWNCLGRLEACSTVLPLYAKAYVLFCVLAFVGILAAICGLYARIYCQVR
AKAQRLRVRPGAGEGTSARARGTPRSLALLRTLSVVLVAFVACWGPLFLLLLLDVACPARACPVLLQADPFLGLAMANSLLNPIIYTFTNRDLRHALLRLICCGRRPCWG
GSGTSRSPGSTLGASGGLHRWLPPGMDRSSSRSERSSPQRDGLDTSGSTGSPAAPTAAQTLVPPPAAD*
29 >lcl|NP_001116609.1|Plus12275169..2276128 NW_003536672 melanocortin receptor 3 MC3R __SEG__ Chr17 {Sus scrofa} MNASCCLLSAPPALPNSSEHLPAPSFSNQSSSGFCEQVVIQPEVFLALGILSLLENVLVILAVARNGNLHSPMYLFLCSLAVADLLVSVSNALETIMIAVVNSDALTFED
QFVQHMDNVFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKAGALIAAIWVCCGVCGVVFIVYSESKMVIVCLVVIFFAMLLLMGTLYVHMFLFARLHVQR
IAALPPADGGPPPQRSCLKGAVTISLLLGVFIFCWAPFFLHLVLIITCPTHPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFKEILCSCNA*
30 >lcl|NP_001116625.1|Plus1complement(574435..575373) NW_003300226 olfactory receptor-like protein 42-1 OLF42-1 __SEG__ Chr7 {Sus scrofa} MVNHSSPAGFLLLGFSEHPELERILFVVVFASYLLTLAGNTLIILLSALDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPHKTISFLGCAVQLFIFLLLGTTEC
VLLTVMAFDRYVAVCQPLHYATIMHPRLCRQLAAVAWVMGLVQSIVQTPPTLRLPFCPHRQIDDFVCQVPSLIRLSCGDTTFNGIQLAVSSVVFLVVPLALILISYGAIA
RAVLRISSATAWRKALGTCSSHLAVVTLLYSSVIAVCLQPKSPYAQRRGKFFGLFYAVGTPSLNPLIYTLRNKEVKRALGRLLGQDRDARES*
31 >lcl|NP_001116626.1|Plus1complement(587666..588604) NW_003300226 olfactory receptor-like protein 42-2 OLF42-2 __SEG__ Chr7 {Sus scrofa} MVNHSSPAGFLLLGFSEHPELERILFAVVFASYLLTLAGNTLIILLSALDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPHKTISFLGCAVQLFIFLLLGTTEC
VLLTVMAFDRYVAVCQPLHYATIVHPRLCRQLAAVAWVMGLVQSIVQTPPTLRLPFCPHRQIDDFVCQVPSLIRLSCGDTTFNGIQLAVSSVVFLVVPLALILISYGAIA
RAVLRISSAAAWRKALGTCSSHLAVVTLLYSSVIAVCLQPKSPYAQRRGKFFGLFYAVGTPSLNPLIYTLRNKEVKRALGRLLGQDRDARES*
32 >lcl|NP_001116627.1|Plus1complement(599580..600518) NW_003300226 putative olfactory receptor-like protein OLF42-3 __SEG__ Chr7 {Sus scrofa} MVNRSSPAGFLLLGFSEHPELERILFAVVFASYLLTLAGNTLIILLSVLDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPHKTISFLGCAVQLFIFLLLGTTEC
VLLTVMAFDRYVAVCQPLHYATTMHPRLCRQLAAVAWVIGLVESMVQTPPTLRLPFCPHRRVDDFVCEVPSLIRLSCGDTTYNEIQMAVASVFILVVPLSLILVSYGAIA
RAVLRISSATAWRKALGTCSSHLAVVTLFYSSVIAVYLQPKSPYAQRRGKFFGLFYAVGIPSLNPLIYTLRNKEVKRALGRLLGQDRDSRES*
33 >lcl|NP_001116674.1|Plus1complement(162952..165522) NW_003300702 toll-like receptor 5 TLR5 __SEG__ Chr10 {Sus scrofa} MGDCLVLLLTLLVASPALGMPSCFFDGQRAIYRGCNLTQVPQVPSGTKSLLLSFNYIRTVTAGSFPFLEGLQLLELGTQLTPLSIDREAFRNLPNLRILDLGHSQIAFLH
PDAFQELPHLSELRLFSCGLSDAILKDGYFRNLASLTRLDLSKNQIQSLHLHPSFQELNSLKAIDLSLNQIPLVCEQGLKPLQGKTLSFLSLADNNLYSRVSVDWGKCMN
PFRNMALEMLDVSGNGWTADTTRNFSQAVNGSQISSLVLAHHIMGSGFGFHNIKDPDHHTFASLGRSSLIQLDLSHGFIFSLNFRLFGTLKELKVLNLAFNKINKIADQA
FHGLDNLQILNMSYNLSGGTI*F*F*RTA*ARLY*SAEESHWDHSGPNIQVPKKIKYLGSPG*CS*NNSVYSEHTYSLLGRQ*TGDFAKHQAYGQLHPLIREQARKSG*P
LLPSPGTSSPDSHFKSKSLFQL*PEARAFRESQLGTAFPRRKYVATCLGSRLLLGCF*GAFSSPSPVFE*QLPEFPSTRSLSPSDCTEGTQPQLQQANSSLSG*LTCSPR
GPGSIQKPAPLSRS*LIHLTKCRGPES*QVCL*L*T*HFYQLAQSNQCHDIWVSR*YILHVSELARWESPQHRFHGRLQ*RGSLRVPEVFPFHLVHCHPDSAFRGHPRSH
EVPGILFHLL*ESPETGVQGPQPGKGIRYIQIRCLLML*W*RL*MGAGGVAQEPGCPVQRPKQIEPLL*RKRLCAGGRSHQQHPGCRVEQQEGCLSGEQTLP*GRLVPGS
LQLRPEQVLSRPEWHPHHGGGWVPASVSTDEASVHQRICPETAVLEVA*GSPGRQLVSQQALSIHSKESQGKEERQRHSVAKRDHLL
34 >lcl|NP_001116677.1|Plus1complement(889868..890908) NW_003535879 protein Tob1 TOB1 __SEG__ Chr12 {Sus scrofa} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGSPQQPQQQQQPSQPPPPPPPPQQQQQQQKTSALSPNAKEFIFPNMQGQGSSTSGMFPGDSPLNLSPLQYSNAFDVFSAYGGLNEKSFVDGLNFSL
NNMQYSNQQFQPVMAN*
35 >lcl|NP_001121908.1|Plus1463974..465230 NW_003534384 beta-2 adrenergic receptor ADRB2 __SEG__ Chr2 {Sus scrofa} MGQPGNRSVFLLAPNGSHAPDQDVPQERNEAWVVGMAIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGSFWCEFWI
SIDVLCVTASIETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWVVSGLISFLPIKMHWYQATHREALNCYAEEACCDFFTNQPYAIASSIVSFYLPLVVMVFVYS
RVFQVARRQLQKIDKSEGRFHAQNLSQAEQDGRSGPGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHGIHDNLIPKEVYILLNWVGYVNSAFNPLIYCRSP
DFRMAFQELLCLHRSSLKAYGNGCSSNSNGRTDYTGEQSGCYLGEEKDSERLCEEPPGPEGCAHRQGTVPDDSTDSQGRNCSTNDSML*
36 >lcl|NP_001123440.1|Plus1complement(774001..774669) NW_003535202 insulin-induced gene 2 protein INSIG2 __SEG__ Chr7 {Sus scrofa} VAEGETQSPGPKKCGPSISSVTSQSVNLMIQAVVLFFIGVFLASVLNLLQIQRNVTLFPPDVIASIFSRHGGYHRAVAQLQL*LGYYTPALTGI*ENHINLKESGPV*CG
V*LSLLI*ITPALKWILITTYSCFSHSPIGLWWTCDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQYTSPDFLYVHSWLPYIFFAGGITMGNIG*QLAMYECKVIAEKSH
QE*
37 >lcl|NP_001131108.1|Plus1complement(2407..2646) NW_003535906 adapter molecule crk CRK __SEG__ Chr12 {Sus scrofa} MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
38 >lcl|NP_001135461.1|Plus1complement(<95979..96368) NW_003536001 platelet glycoprotein IX GP9 __SEG__ Chr13 {Sus scrofa} MPAWAALLLLWTAVQAAEDCPAACSCRTLGTMGLEVDCQSRGLAALPALPAHTRHLLLANNSLRSVPPGAFDHMLQLQTLQLANNPWHCDCGLTYLRLWLRDRAPGELPR
VRCASPGHASGRALSQLIGS
39 >lcl|NP_001138853.1|Plus1complement(1345551..1346573) NW_003536210 G-protein coupled receptor 81 GPR81 __SEG__ Chr14 {Sus scrofa} MDNGSCCLIQGDPISQAMPPLLILAFVLGALGNGIALCGFCFHMKTWKPSTIYLFNLAVADFLLMICLPFRTDYYRRHRQWAFGDIPCRAVLFMLAMNRAGSIVFLTVVA
VDRYFKVVHPHHMVNAISNRTAIGIVCALWTMVIVGTLYLLMENHLCVQEKTIACESFIMESANGWHDVMFQLEFFLPLGIILFCSFKVIWSLEQRQHLARQARMKRATR
FIVVVAVVFITGYLPSVSARLYFLWTVPSSVCDPSVHVALHVTLSFTYMNSMLDPLVYYFSSPSFPKFYSKLKICSLRPKHPGRSKRPEEMPISNLCHKSCISVANSFQS
QSDVQWDPQM*
40 >lcl|NP_001156361.1|Plus13960770..3962095 NW_003534075 suppressor of cytokine signaling 6 SOCS6 __SEG__ Chr1 {Sus scrofa} MAENSENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVNAIEKTEVPLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSS
RHSSGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPLSPKSDEWVSTDLSQSELRDGQLKQQRNMEEEVNCFSHTDVQPCVITTNSPSDRGSPGTGSMINLAS
NNSIEDSDMDSDDEIITLCTSSRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSR
SLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQ
C*
41 >lcl|NP_001156362.1|Plus1complement(153048..154658) NW_003534509 suppressor of cytokine signaling 5 SOCS5 __SEG__ Chr3 {Sus scrofa} MDKVGKMWNNFKYRCQNLFSHEGGSRSENVDMNSNRYLSVKEKNISIGDSAPQQQSSPLRENVALQLGLSPSKNASRRNQNCATEIPQIVEISIEKDNDSSVTPGTRLAR
RDSYSRHAPWGGKKKHSCSTKTQSSLDTDKKFGRTRSGLPRRERRYGVSSMHDMDGVASRTVGSRSLRQRLQDTVGLCFPMRTYNKQSKPLFSNKRKIHLSELMLEKCPF
PAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEINGDSSAIPQANCDLEEDTTT
LCLQSRRQKQRQVSGDSHAHVSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFD
AHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK*
42 >lcl|NP_001161100.1|Plus1complement(887902..889167) NW_003534725 somatostatin receptor subtype 3 LOC396643 __SEG__ Chr5 {Sus scrofa} MDTPGYPSLVPTTSEPGNASSAWSLDAVLGNGSSAPSAAGLAVRGILIPLVYLVVCVVGLLGNSLVIYVVLRQTASPSVTSIYILNLALADELFMLGLPFLAAQNALSYW
PFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPL
LVICLCYLLIVVKVRSAGRRVRAPSCQRRRPSERRVTRMVVAVVALFVLCWMPFYVLNIINVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLL
RPSRRVRNQEPPVGPPEKTEEEEEDGGEHEKGGAGNQGERKEMNGRVIQITQPGPSGQERPPSGTATKEHQFLPQEPSAGDKSGPLHISYL*
43 >lcl|NP_001163989.1|Plus1complement(755862..757469) NW_003299293 suppressor of cytokine signaling 6 SOCS6 __SEG__ Chr1 {Sus scrofa} MKKISLKTFRKSFNLSKSKEETDFMVVQQPSLAGDFGKEDSLFGSCYGKDMASCDINSEDEKGGKNRSKSESLMGTLKRRLSAKQKQKGKGGGPSGGSADEDTFSSASAP
LVFKDVRAQRPMRSTSLRSHHYSPTPWPLRPTASEETCIKMEVRVKALVHASSPGPALNGVRKDFHDLQADTACQEQTNSLKSSESQDGDLRLHLDEHVPVVIGLVPQDY
IQYTVPLEEGMYPLEGPRSYCLDSSSPMEVSALPPPAGGGSFPEDENQVDQDLVVAPEIFVDQSVNGLLIGTTGVVLQSPRASHDDVPPLSPLLPPLQTNQIQRNFGGLA
GTDAHVAESVRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRF
SFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY*
44 >lcl|NP_001166989.1|Plus1181637..182653 NW_003536021 purinergic receptor P2Y12 P2Y12R __SEG__ Chr13 {Sus scrofa} MDNLTSAPGNGSLCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRAFVCQVTSVIFYFTMYISIS
FLGLITIDRYQKTTRPFKTSNPNNLLGAKILSVVIWAFMFLLSLPNMILTNRRPSDNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYKSYVRTR
GVGKVPKKKVNIKVFIIIAVFLICFVPFHFARIPYTLSQTRDVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLKCSNSASSPTHRNRKKGQDGD
DPSEETPM*
45 >lcl|NP_001170959.1|Plus1complement(3266..4165) NW_003534604 thyrotropin-releasing hormone receptor TRHR __SEG__ Chr4 {Sus scrofa} MENETVSELNQTQLQPRAVVTLEYQVVTILLVLIICGLGIVGNIMVVLVVLRTKHMRTPTNCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGIN
ASSCSITAFTVERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFL
NPIPSDPKENSRTWKNDSTHQNKNSNSKTSNRYFNSTVSSRKQVSKSEPLSPPSRYGRDGIPYDMGSTLPSLADGKTRI*
46 >lcl|NP_001177099.1|Plus11186381..1189647 NW_003536609 FAT tumor suppressor homolog 1 FAT1 __SEG__ Chr17 {Sus scrofa} MGRHLASRLLLLLLLQHFRDSDGSQTLDHSPIQFTHFQYNVTVHENSAAKTYVGHPVKMGIYITNPLWELRYKIVSGDNENLFKAEEYILGDFCFLRIRTKGGNTAILNR
EVKDHYTLIVKAVEKTTNAEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDMFAIHPTSGAVVLTGRLDYTEAKLYEL
EILAVDRGMKLYGSSGISSMAKLTVHIEQANACPPVITAVTLAPSELDKDPTYAIVTVEDCDQGANGEIASLSIVAGDLLQQFRTVRASPGSKEYKLKAVGGIDWDSHPF
GYNLTLQAKDKGTPPQFSSVKVIHVASPQFKAGPVRFEKEVYRAEISEFAPSSTPVVMVKATPSYSHLRYVFKSTPGKAKFSINPNTGLISILEPIKRQQASHFELEVTT
SDRKASTRVLVKVLSANSHPPEFTQTAYRASFDENVPIGTTVMSVSAVDPDEGENGYVTYSIANVNHVPFVIDHFSGAVSTSENLDYELMPRVYTLRIRASDWGLPYRRE
VEILATVTLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFSLNPTSGVLSLKQSLMDGFGAKVSFHSLRITATDGENFATPLYIN
ITVAALRKPVNLQCEETGVAKMLAEKLLQANKLHSQGEAEDVFFDSHSVNAHAPQFRSTLPAGIEVKENRPVGSSVIFMNATDLDTGFNGKLVYAISGGNEDSCFIIDME
TGVLKILSPLDRETTDRYSLNITVSDLGLPQKAAWRLLEIRVLDANDNPPEFLQESYFVEVSEDKEINSEIIPVEATDKDLGPNGHVMYSIPTDTDKFFNRQHDGSG*NR
EPLGSRRAARALLKD*SQGPSPRRTPAAFHGASESIIRGC**QPTQVHSP*LPCESS*GPFQKEP*SCVRGL*T*FRSV*SSEV*SSGRWRRNF*GG*AQWSS*NRTAVG
L*EEASI*SHCEGQRQRQAHFSVFHLLR*SRGHRCE*ELTPTRVSQLCGEGCRERKCPNWFIGDEGISS**GHRKRWGDPLFHSRWFRCWCFQNR*RNR
47 >lcl|NP_001177112.1|Plus1complement(505022..506149) NW_003534696 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr4 {Sus scrofa} MSQPKKRKLESGGGGEGGEGTEEEDGGEQEAALPRPRRTRRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPICDQMLELRLSFWSQMKQLYGVDMS
CLESFATRCLMGHSEIVVQGLSGEDVLARPQCFAQLDLARAGLEQELEAGVGGRFRFSSYGSAHMHGFAIWFQVTFPSGDWRNPLVLSTSPFHPVTHWKQALSXPERARA
SGARYGRFRRDYAPALPGQPPSPARAAALQSGRPGGKDQRLCHGGL
48 >lcl|NP_001177160.1|Plus1complement(527763..528935) NW_003535212 somatostatin receptor type 1 SSTR1 __SEG__ Chr7 {Sus scrofa} MFPNGTASSPSSPSPCPGSCGEGSGSRGPGAGTADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSV
PFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLV
GFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFK
RSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL*
49 >lcl|NP_001177173.1|Plus1complement(398362..399429) NW_003536472 probable G-protein coupled receptor 1 GPR1 __SEG__ Chr15 {Sus scrofa} MEDLEETLFEEFENYSYALEYYSPGTDLEEKAHLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMSFHWPFGICLC
KANAFIAQLNMFASVFFLTVISLDRYIYLIHPVLSHRYRTLRNSLVIVIVVWLLASLMGGPALFFRETLESNNRTVCYNNFHEQDPDLVLMRHHVLTWVKVIVGYLFPLL
TMSICYLSLIFKVKKRSILASSKHFWTILAVVLAFLICWTPYHLFSIWELTIHHNSYFHQVLQAGIPLSTGLAFLNSCLNPILYVLISKKFQVRFRASVAEILKYTLWEV
SCSGTVSEPLRNSETKNLCLLETAQ*
50 >lcl|NP_001177852.1|Plus1660752..661774 NW_003535224 probable G-protein coupled receptor 33 GPR33 __SEG__ Chr7 {Sus scrofa} MDLLNSTDYLLNVSTLIRNSIHIPTSASKMTVVLLLLTSSIIGTITNGFYLWVLKFKMRKTVNTLLYFHLILSYFISTLFLPFLAISHLQDDHWSFGMATCKMVYGILYT
GMFASVFFLSAISVDRYLLTLHPVWSQLHRTPHWASSIILGVWISATALSIPYMVFRETHDDHKGMVTCQNNYAISTNWESKKMQTLRQWIHVACFSSRFLLSFLLPFFI
ITFCYERVAKKMKARGLFKSNKPFKVMMTAIISFFVCWMPYHVYQGLILTKNKSQFFQLTLILTMITISFNTLFSPTLYLFIGENFRKVFKKSVLNLFELTFNEDSSTER
TQNLNSEGYI*
51 >lcl|NP_001182268.1|Plus1complement(227991..228956) NW_003535872 frizzled-2 FZD2 __SEG__ Chr12 {Sus scrofa} FAGSGFTLAELCALHLLHRHYVPGGHAAVPLPGAAHHLSVRLLHYGVVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFL
AAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGV
FSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV*
52 >lcl|NP_001182270.1|Plus1313767..314093 NW_003299342 high mobility group protein HMGI-C HMGA2 __SEG__ Chr1 {Sus scrofa} MSTRSKGAEQKSTSAQGKPAAPAPQKRGPGRPRKQQQEPTSEPSSKRPRGRPKGSKNKSPSKAAQKKPEATGQRRPRGRPRKWPQQVVQKTSAQETEETSSQKSAEED*
53 >lcl|NP_001191324.1|Plus1<993180..994706 NW_003536280 interferon-induced protein with tetratricopeptide repeats 3 IFIT3 __SEG__ Chr14 {Sus scrofa} SEVNKNSLEKILPQLKCHFTWNLPKEEHVWHDLEDRVCNQTELLNSEFKATMYNLLAYIKHLNGQNEAALEYLQQAEEFIQQEHTDQAEIRSLVTWGNYAWVYYHLGRLS
EAQIYVDKVKQVCEKFSNPYSIECPELDCEEGWTLLKCGGKQIEKAKVYFEKALEEKPDNPEFSSGLAIAMYFLNGKPAQQSSVDILKEAIELSPDNQYIKVLLALTLQK
MNEEAEGEELVVEALEKAPRQTDVLRSAAKFYRVKGDLDKAIELFLTALESTPNNGYLYHQIACCYRAKVKQLLDAGESEASRNREIIEELRKYAKDYVNKAIEKGLNPL
YAYSDSTELLEIGECHQTAFSKELPSTEAQQLHQRSCNSQEYHEKSEDTAAQQSLENLSINTKSTEKEKMKYQLQNGAANQLPQSAPNSWYLRGLIHKMNGDLLQAAACY
EKELGYLLRNSPSGIGSIFQPASELEEGTEEMDQGADGSTLRELPDPGADRDRKERKGTESQGAWNSG*
54 >lcl|NP_001191697.1|Plus1complement(600381..601043) NW_003534444 suppressor of cytokine signaling 1 SOCS1 __SEG__ Chr3 {Sus scrofa} MVAHNQVAADNAISTAAEPRRRPEHSSSSSSSSSSSSSSSSPGVPARPRPCPAAPAPAPGDTHFRTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTF
LVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
*
55 >lcl|NP_001191974.1|Plus1255104..256726 NW_003299749 probable G-protein coupled receptor 75 GPR75 __SEG__ Chr3 {Sus scrofa} MNSTDHLQDASNTTLLHVPRSQGGNSTVLQGDLQDLIHTATLVTCTFLLAIIFCLGSYGNFIVFLSFFDPAFRKFRTNFDFMILNLSFCDLFICCVTAPMFTFVLFFSSA
SGIPDAFCFTFHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTLLLTLLLWATSFTLATLATLKTSKSHLCLPMSSLIAREGKAILSLYVVDFTFCVAVVSV
SYIMIAQTLRKNAHVRKCPPVITVDASRPQPFMGASGKGGGDPIQCTMPALYRNQNYNKLQHVQTHGYTKSPNQLPTPVASRLQLVSAVNLSTAKDSKAVVTCVIIVLSV
LVCCLPLGISLVQVVLSSNGSFILYQFELFGFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLQYIGLSFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKK
FVDQACGPSHSKESVVSPRMSAGQQHYGQSSSTPINTRIEPYYSIYNSSPSQEESIPHNLQPVNSFGFATSYIAMHYHTTNDLMQEYDSTSAKQIPVPSV*
56 >lcl|NP_001193310.1|Plus1138611..140425 NW_003300013 kelch domain-containing protein 7B KLHDC7B __SEG__ Chr5 {Sus scrofa} MVLRSHPFPRQERPQGRAPRAALGSSTSRASEDRRAGSPPEEAVPNCEDRRGSARLFTGADAGALAEAGGHSQQSSTEASEAPVTGPPSGPKGVRTEEEHPASLPPAAAV
PGALSRPPEQTRSASSSPARRGSLPVPRPRKRSMCEIAQSAEREVSRVAPGQHQGQAPGERPSPAGSGAALTEKQKEARKLMVFLQRPGAWGGVEGPRKLRSPARELASA
VALPPWGLDLGSCLDVLAFAQQHGEPRLAQEIYALMSDNLLHVLGDPSLYRQLSGADRERILSLRTGRGQAVLGVLVLPSLYQVSRSGLTRDPGGAGAPGVGPGPLPPCP
SLHVLHPGENTWQPLTQVPQEVPLRGCGLCTLHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMLQARAQLKLVALDGLLYAIGGECLYSMERYDPRTDAWTS
RAPLPAGSFPVAHEAVACQGDIYVTGGHLFYRLLRYSPEKDVWDECPYSASHRRSSDMVALGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLPDPAPLRCAVLGNT
IYCLNHRVTATFTVSEGTAQFQAKELQPFPLGAKGVLCPFTLTLPAADPLQTAL*
57 >lcl|NP_998904.1|Plus1complement(320456..321508) NW_003534995 membrane progestin receptor alpha PAQR7 __SEG__ Chr6 {Sus scrofa} MATMVAQKLSHLLPSLRQVHPEPQPSVHPEPVFTVDRAEVPPLFWKPYIYVGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFVGTVDFWGDPHALPLF
IIVLASFTYLSLSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEVPSALAYALDI
SPVAHRILASPEPATDDPALLYHKCQVVFFLLAAAFFSAFMPERWFPGSCHIFGQGHQLFHVFLVLCTLAQLEAVALDYEARRPIYEPLHTRWPHNFSGLFLLTVGSSIL
TAFLLSQLVRRKLDLDRKTQ*
58 >lcl|NP_998905.1|Plus1896449..897513 NW_003535192 membrane progestin receptor beta PAQR8 __SEG__ Chr7 {Sus scrofa} MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFLPAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FILDISPVAHRVALCHLSGCQEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYKGRQEIFLHRHSPLSIYAACLSFFFL
VACSGATAALLREKIKARLSKKDS*
59 >lcl|NP_998925.1|Plus1complement(1538420..1540807) NW_003535349 toll-like receptor 6 TLR6 __SEG__ Chr8 {Sus scrofa} MSKDKEPTVISLHSVYVMTLVWGTLIQFSEESEFVVDKSKIGLTRVPKDLPPQTKVLDVSQNFITELHLSDISFLSQLTVLRLSQNRMQCLDISVFKFNQDLEYLDLSHN
QLQTILCHPITSLKHLDLSFNDFEALPICKEFGNLTQLNFLGLSATKLQQLDLLPIAHLHLSCILLDLERYYMKENEKESLQILNTKKLHLVFHPNSFFSVQVNISVKSV
GCLQLANIKLSDDNCQVFITFLLELTQGPTLLNFTLNHVETTWKCLVGIFQFLWPKPVEYLSIYNLTIVESIDEEDFIYYETTLKGVKIEHITKRVFIFSQTALYRVFSD
MNIRMLTIADTHFIHMLCPQVPSTFNFLNFTQNVFTDSVFQNCKTLARLETLILQKNKLEDLFKISLMTKDMLSLEILDVSSNSLEYDRHGENCTWVGSIVVLNLSSNIL
TDSVFRCLPPRIKVLDLHSNRIRSIPKDVAHLEALQELNVASNSLAHLPGCGSFSSLSILTIDYNSISNPSADFFQSCQKIRSLKAGNNPFQCTCELRDFIQSLGQVSSD
VVESWPDSYECEYPESYKGTLLKDFRVSELSCNTALLIVTIGVTGLALALTMTGLCVYFDLPWYLRMLCQWTQTRRRARNVPLEELQRTLQFHAFISYSEHDSAWVKNEL
VPCLEKEGIKICLHERNFVPGKSIMENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSDNLILILLDPIPQNSIPGKYHKLKALMAQRTYLEWPKEKSKH
GLFWANIRAAFNIKLKLVAEEDDVKT
60 >lcl|NP_998926.1|Plus1complement(147839..150196) NW_003300393 toll-like receptor 2 TLR2 __SEG__ Chr8 {Sus scrofa} MPCALWTAWVLGIVISLSKEGAPHQASSLSCDPAGVCDGRSRSLSSIPSGLTAAVKSLDLSNNRIAYVGSSDLRKCVNLRALRLGANSIHTVEEDSFSSLGSLEHLDLSY
NHLSNLSSSWFKSLSTLKFLNLLGNPYKTLGETPLFSHLPNLRILKIGNNDTFAEIQAKDFQGLTFLQELEIGASHLQRYAPKSLRSIQNISHLILHMRRPALLPKIFVD
LLSSLEYLELRNTDFSTFNFSDVSINEPSTVMKKFTFRKAEITDASFTEIVKLLNYVSGALEVEFDDCTLNGRGDFSTSALDTIKSLGNVETLTVRRLHIPQFFLFYDLR
SIYSLTGAVKRITIENSKVFLVPCSLSQHLKSLEYLDLSENLMSEEYLKNSACEHAWPFLHTLILRQNHLKSLEKTGEVLVTLKNLTNLDISKNNFDSMPETCQWPEKMK
YLNLSSTRIHSLTHCLPQTLEVLDISNNNLNSFSLSLPQLKELYISRNKLKTLPDASFLPMLSVLRISRNTINTFSKEQLDSFQKLKTLEAGGNNFICSCDFLSFTQGQQ
ALAQVLSDWPENYLCDSPSHVRGQRVQDTRLSLTECHRVAVVSVVCCALFLLLLLTGALCHHFHGLWYMKMMWAWLQAKRKPRKAPRRDVCYDAFVSYSEQDSYWVENLM
VQELEHFQPPFKLCLHKRDFIPGKWIIDNIIDSIEKSQKTIFVLSENFVKSEWCKYELDFSHFRLFDENDDTAILILLEPIEKKAIPQRFCKLRKIMNTRTYLEWPADET
QREGFWLNLRAAIKS*
61 >lcl|NP_999199.1|Plus1complement(269509..270891) NW_003534209 muscarinic acetylcholine receptor M1 CHRM1 __SEG__ Chr2 {Sus scrofa} MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASN
ASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRAR
ELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPT
RKGRERAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFIVTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKR
RWRKIPKRPGSVHRTPSRQC*
62 >lcl|NP_999266.1|Plus1complement(41846..42946) NW_003536105 5-hydroxytryptamine receptor 1F HTR1F __SEG__ Chr13 {Sus scrofa} MDFSNSSYQNSTSEELLNRMPAKILVSFILSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCS
ILHLSAIALDRYRAITDAVEYAQKRTPKQAGIMITIVWIISIFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLTLILILYYKIYKAAKTLYHKRQASRI
AKEELNGQVLLESGEKSSRLVSTPYMLEKSLSDPSTDFDKIHSTVKSPRSEFRHERSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSN
FLTWLGYLNSLINPMIYTIFNEDFKKAFQKLVRCRC*
63 >lcl|NP_999287.1|Plus1<1039379..1040188 NW_003300167 histamine H4 receptor HRH4 __SEG__ Chr6 {Sus scrofa} VSYRTQHTGILKIVALMVGVWVLAFLVHGPVILVSEAWKQGKQDCEPGFLKEWYVLAITLFFEFLAPVLLVAYFNLYIYWSLWKRGHLSRCQSHCGLTPVSSGSWGHSFR
CGLFSRTSLSDPKEAAASLHSERPRRKSTLWFSLRTRMSSLTASNKGFLSHSDSLALHQKEHLELLRARKLARSLAILLGVFAICWAPYSLLTITRSVYPTNPFPSTAVY
KFAFWLQWFNSCVNPFLYPLCHKRFQKAFLKIFCLKKQSTLSHNRSTSS*
64 >lcl|NP_999294.1|Plus1complement(188544..189566) NW_003536803 cysteinyl leukotriene receptor 1 CYCLT1 __SEG__ ChrX {Sus scrofa} MDGVRNLTVSSASSNTCNDTIDDFRNQVYSTLYSMITVVGFFGNGFVLYVLIKTYHEKSAYQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNL
YCSIFFMTAMSFFRCIAIVFPVQNINLITHKKAKIVCIAIWIFVILTSSPFLMSTSYKDEKNNTKCFEPPQDNQAKYHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLL
KNSMKKNISSRKKAIGMIIVVTAAFLISFMPYHIQRTIHLHFLHNDTKHCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKTSL
PEKGEEIYKE*
65 >lcl|NP_999315.1|Plus1complement(275916..277064) NW_003300392 neuropeptide Y receptor type 2 NPY2R __SEG__ Chr8 {Sus scrofa} MGPLGAEADENQTVEEMKMEPSGPGHTTPRGELAPDSEPELKDSTKLIEVQIILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLT
YTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVY
SLSSLLILYVLPLGIISFSYARIWSKLKNHVSPGGVNDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMN
SNYRKAFLSAFRCEQRLDAIHSEVSMTSKAKKNLEVTKNGGPDDSFTEATNV*
66 >lcl|NP_999323.1|Plus1complement(204305..205438) NW_003300135 5-hydroxytryptamine receptor 1D HTR1D __SEG__ Chr6 {Sus scrofa} MSPPNQSVEDLLQGTSNRSLNATETPKAWDPGTLQVLKISLAVVLSIITLATVLSNAFVLTTIFLTRKLHTPANYLIGSLAMTDLLVSILVMPISIPYTITQTWSFGQLL
CDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIYSTCGAFYIPSLLLIILYGRI
YRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSLHEEHAHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVASLVLPICRDS
CWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVVHFRKAL*
67 >lcl|NP_999338.1|Plus1167070..167930 NW_003534052 melanocortin receptor 4 MC4R __SEG__ Chr1 {Sus scrofa} LSEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQ
YHNIMTVKRVGIIISCIWAVCTVSGVLFIIYSDSSAVIICLITVFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLI
FYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSSRY*
68 >lcl|NP_999352.1|Plus11902800..1905886 NW_003536748 toll-like receptor 8 TLR8 __SEG__ ChrX {Sus scrofa} MTLHFLLLTCLFLLIPDSCEFFTGANYSRSYPCDERKENGSVIAECNNRQLQEVPRRVGNYVTELDLSDNFIRRITNESFQGLQNLTKINLNHNAKLWPQSENGMTITDG
AFLNLHHLRELLLEDNQLREIPTGLPESLRELSLIQNKIILLNTKNMFGLRKLESLYLGWNCYFTCNETFIIDEGAFENLTNLKVLSLSFNTLYRVPPKLPSSLTKLYLS
NTKIRNINQEDFKGLENLRVLDLSGNCPRCFNAPFPCNPCPGDASIQIHPLAFRYLTELRYLNLSSTSLRRIPATWFENLHHLKVLHLEFNYLMDEIASGEFLAKLPSLE
ILDLSYNYEQKKYPQYINISHYFANLTSLQILHLRAYVFQELRKEDFQPLRNLLHLKFINLGINFIKQIDFTIFSEFSNLSIIYLSENRISPLVNNTGQKNGDRPSFQSH
VLKPRSATPKFDPHSNFYHNTKPLIKPQCSRYGKALDLSLNSIFFIGPNQFEAFKDIACLNLSSNGNGQVLHGSEFSHLPGIKYLDLTNNRLDFDDDAAFSELPLLEVLD
LSYNSHYFRIAGVTHRLGFIQNLPQLRVLNLSHNSIFTLTETYLKSTSLKELVFSGNRLDLLWNAQDDRYWQIFKNLSTLTHLDLSSNNLQHIPSEAFLNLPQTLTELYI
SDNRLNFFNWSLLQQFPNLTLLDLSGNELSFLTDSLSKFTTSLQTLILRQNRISYLPSGLLSEASSLTHLDLSSNQLKMVNISKLHAKTTTNLAILKLDRNPFDCTCDIR
DFRKWMDENLKVTIPRLTDVICASPGDQRGRSIVSLELTTCVSDTIAAIICFFTFFVTSTVMLAALAHHWFYWDAWFIYHVCLAKVKGYRSLPTSQTFYDAYVSYDTKDA
SVTDWVMNELRFHLEESEGKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTIFVLTKKYAKNWNFKTAFYLALQRLMDENMDVIVFILLEPVLQHSQYLRLRQRICKSSI
LQWPDNPKAEGLFWQSLKNVVLTENDSRYNSLYVNSIK*
69 >lcl|NP_999384.1|Plus135091..35390 NW_003536258 calcium-activated potassium channel subunit alpha-1 KCNMA1 __SEG__ Chr14 {Sus scrofa} MSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSVHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTK
70 >lcl|NP_999408.1|Plus159802..60929 NW_003301271 neuropeptide Y receptor type 4 PPYR1 __SEG__ Chr14 {Sus scrofa} MNISHFLGLLFPGAPQGQNRSKAKGIPYNFSDHCQDSIDPMVFVVTSYSIETIVGVLGNLCLICVTIRQKEKANVTNLLIANLAFSDFLMCLICQPLTAIYTIMDYWVFG
EVLCKISAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSVSQAYLGIVVIWLIACFLSLPFLANSILQNVFHKNHSKAVEFLADKVVCTESWPLEHHRIIYTTFLLL
FQYCIPLAFILVCYVRIYQRLRKRGRVFHKGAYSSRAWQMKRINGILAAMVVAFAVLWLPLHVFNSLEDWYHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFK
KEVKALVLTCQQSIPVEESEHLPLSTVQTEISKGSLRLSGRSNPI*
71 >lcl|NP_999423.2|Plus1280943..281194 NW_003301032 cAMP-dependent protein kinase type II-alpha regulatory subunit PRKAR2A __SEG__ Chr13 {Sus scrofa} MSHIQIPPGLTELLQGYTVEVLRRQPPDLVDFAVDYFTRLREARSRASTPPAAPPSGSQDLEPSSGLVTDAIADSESEDDEDLD
72 >lcl|NP_999450.1|Plus1complement(252714..253277) NW_003536651 bcl-2-like protein 1 BCL2L1 __SEG__ Chr17 {Sus scrofa} MSQSNRELVVDFLSYKLSQKGYSWSQFTDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTS
QLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGW
73 >lcl|NP_999463.1|Plus1179260..180432 NW_003299239 5-hydroxytryptamine receptor 1B HTR1B __SEG__ Chr1 {Sus scrofa} MEEAGAQCAPPLPASSQTRLSQANLSAAPSQNCSAEGYIYQDSIALPWKVVLVILLALFTLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYT
VTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSDCVVNTDHILYTVYSTVGAFYFP
TLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRAPDLPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPF
FIISLAMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMFNEDFKQAFHKLIRFKCTS*
74 >lcl|NP_999565.1|Plus1626590..627942 NW_003536307 alpha-2A adrenergic receptor ADRA2A __SEG__ Chr14 {Sus scrofa} MGSLQPEAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYL
ALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGGQQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIY
QIAKRRTRVPPSRRGPDAAAALPGGAERRPNGLGPERGVGRVGAEAEPLPVQLNGAPGEPAPAGPRDADGLDLEESSSSEHAERPPGPRRSERGPRAKSKARASQVKPGD
SLPRRGPGAPGPGAPATGAGEERGGVAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKI
LCRGDRKRIV*
75 >lcl|XP_001924363.1|Plus1761619..762560 NW_003535240 olfactory receptor 11H6-like LOC100157808 __SEG__ Chr7 {Sus scrofa} MTSKARNSSHNVSEFILLGFPCRWEIQLFLFSIFFITYILTLLGNMAIVCAVRWDHQLHTPMYILLANFSFLEICYVNSDVPNMLANFLSQTKTISFAQCLLQLYFFFSL
GTTECLFLSTMAYDRFLAICRPLHYPTIMTTKFCSSLVAFCWVYGFLWFLIPGILVTQLPFCGPNVIDDFLCDLGPLLALASACVPIPGTVLICGTMSSLLIFATFFYIT
GSYTLVLKAVIQVPSFAGRKKAFSTCSSHLAVVFLFYGSVMMTYVSPGSGQAEGMQKFTTLFYSVLTPFFNPMIYSLRNKEMKDALKKVLGAS*
76 >lcl|XP_001924407.1|Plus1complement(310992..311954) NW_003534146 putative olfactory receptor ENSP00000348552-like LOC100152083 __SEG__ Chr1 {Sus scrofa} MGKTNQSSVTEFVLAGLSGYPQLEAIYFVLVLCMYLVILLGNGVIIIVSVWGSHLHTPMYFFLSNLSFLDICYTSSSIPLFLNSFLTSKKTISFSGCGVQMFLSFAMGAT
ECVLLSMMAFDRYVAICNPLRYHIIMSKTSYVPMAAGSWIAGSVDSVLQTSLAMQLPFCGDNVINHFTCEILAVLKLACADISINVVSMVVTSMIFLVVPILFIFVSYVF
ILSTILRIPSAEGRRKAFSTCSAHLAVVIIFYGTILFMYTKPKAKDSSGVDKVQVTDKIISLFYGVVTPMLNPLIYSLRNKDVKAAVKNILCRKCSSEGL*
77 >lcl|XP_001924428.1|Plus1complement(286346..287302) NW_003534146 olfactory receptor 13C2-like LOC100157310 __SEG__ Chr1 {Sus scrofa} MEWENQTILVEFFLRGLSGYPRLELLFFVLISIMYVVILLGNGTLILISIVDSHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAMQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYSVLMSKASYVPMAAGSWVAGVINSVVQTAFVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMFVATTLFTLMPLLLIIMSYSL
IISNILKIRTSEGRSKVFSTCSAHLTVVIIFYGTILFMYMKPKSKETLTSGDLNATDKLISMFYGVMTPMMNPLIYSLRNKDVKEAVTHLFNRRFFRK*
78 >lcl|XP_001924455.1|Plus1complement(275973..276929) NW_003534146 olfactory receptor 13C2-like LOC100156114 __SEG__ Chr1 {Sus scrofa} MEWENQTILVEFFLRGLSGYPRLELLFFVLISIMYVVILLGNGTLILISIVDSHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAMQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYSVLMSKASYVPMAAGSWIIGGVNSAVQTAFVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMLVATTLFILMPLLFIIISYTL
IISNILKIRTSEGRSKVFSTCSAHLTVVIIFYGTILFMYMKPKSKETLTSGDLNATDKLISMFYGVMTPMMNPLIYSLRNKDVKEAVTHLFNRRFFRK*
79 >lcl|XP_001924488.1|Plus1complement(263275..264252) NW_003534146 olfactory receptor 13C2-like LOC100154900 __SEG__ Chr1 {Sus scrofa} MEWENQTILVEFFLRGLSGYPRLELLFYVLISIMYVVILLGNGTLILISIVDSHLHTPMYFFLGNLSFLDICYTTTSIPTMLVIFLSERKTISFSGCAMQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYSVLMSKASYVPMAAGSWIIGGVNSAVQTAFVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMLVATTLFILMPLLFIIISYTL
IIVSILKIRTSEGRSKVFSTCSAHLTVVIIFYGTILFMYMKPKSKETLTSDDLNATDKLISVFYAIITPMINPLIYSLRNKDVKDAVKHLLRRKHFFISEWERNR*
80 >lcl|XP_001924510.2|Plus1complement(245818..246777) NW_003534146 olfactory receptor 13F1-like LOC100153672 __SEG__ Chr1 {Sus scrofa} MVKTNLTVISDFIFLGFSHYPNAEVIIFVLCLLMYLTTVLGNIILISVSVLDSRLHTPMYFFLSNLSFLDIWYTSSALTPMLANFVAGKNTISFSGCAAQMYFSLAMGST
ECVLLSLMAYDRYVAICNPLRYPIIMNKRVCVQIAAGSWVTGCFTALVETVSVLQLSLCGNSIINHFTCEILAVLKLVCGDTSKVEFIMLVISVLLLPMPMLLVCISYGF
IVSSIVRISSVDGRSKAFSTCAAHLTVVVLFYGTALSMYLKPSAVDSQEIDKFMALVYGGLTPMLNPIIYSLRNKEVKVAVNKLLARNSLCALFISISN*
81 >lcl|XP_001924526.1|Plus1852198..853136 NW_003535240 olfactory receptor 4F6-like LOC100155398 __SEG__ Chr7 {Sus scrofa} MDKANRSVVSEFVFLELSDSWEIQLLLFLFSSVFYVASLMGNLLIVFSVTSDPRLHSPMYFLLANLSIIDLIFCSSTVPKMIYDLLRKDKTISFEGCVVQIFFIHAVGGT
EMVLLISMAYDRYVAICKPLHYLSVMNPRRCILFLVTSWIIGLIHSVTQLAFVVDLPFCGPNELDSFFCDLPRFIKLACIETYTLGFMVTANSGFISVASFLILIISYIF
ILVTVWKRSSGGVSKAFSTLSAHVTVVVLFFGPLIFFYVWPFPISHVDKFLAIFDAVITPFLNAVIYTLRNKEMKVAMRRLCTQFVNDSKIS*
82 >lcl|XP_001924533.1|Plus1220199..221161 NW_003534146 olfactory receptor 13C8-like LOC100152489 __SEG__ Chr1 {Sus scrofa} MGKTNDSTLTEFVLVGLSAHPKLQTVFFVLVLWMYLMILLGNGVLISVIFYDPHLHTPMYFFLCNLSFLDICYTSSSVPLILDSFMTVRKRVSFSGCMVQMFLSFAMGAT
ECVLLGMMALDRYVAICYPLRYHVIMNKGAYVSMAVGSWVSGIVDSMVQTSLAMQLPFCSKNVINHFVCEILAILKLACADISINIISMAGSNLIVLVIPLLVISISYIF
IVATILRIPSTEGKCKAFSTCSAHLTVVIIFYGTIFFMYAKPKSKSSVGIDNQDITEALISLFYGVMTPMLNPLIYSLRNKDVKAAVKNMLGRKNFSDGI*
83 >lcl|XP_001924710.1|Plus1821369..822394 NW_003535289 psychosine receptor-like LOC100155711 __SEG__ Chr7 {Sus scrofa} MNSTCIEEQHDLDHYLFPVVYIFVVIVSVPANIGSLCVSFLQAKKENELGIYLFSLSLSDLLYALTLPLWIDYTWNQDNWTFSPALCKGSAFFMYMNFYSSTAFLTCIAI
DRYLAVVYPLRFSFLRSRRFAFMVSLFIWVLESFFNAIILWEDETAVEYCDTKKSNFTLCYDKYPLEKWQIKFNFFRTCVGYLIPLVVIMVCNRKVYQAVKQNQATENSE
KKRIIKLLVSITLTFILCFTPFHVMLLIRSILERDVNLDEHIFDHNKSGKQTYKIYRITVALTSLNCVADPMLYCFVTETGRSDMWNILNFFTGKFNKSERQRKSMLSMS
TRDTLELDILD*
84 >lcl|XP_001924717.3|Plus1complement(1513809..1514735) NW_003536096 olfactory receptor 5K1-like LOC100157032 __SEG__ Chr13 {Sus scrofa} MTEDNHSLTTEFILIGFTDHPELRIILFLVFLTIYLITMVGNLGLVALIFTEHRLHTPMYIFLGNLALMDSCCSSAITPKMLQNFFSKDRIISLYECMAQFYFLCFAETA
DCFLLAAMAFDRYVAICNPLQYHTMMSKKLCLQMTTGAYIAGNMHSMIHTGFLFRLAFCRFNQINHFFCDVLPLFKLSCVDTYINELMAFIFAGSVLIFSITIVIISYLF
ILFTIFTMKSNKGRGKALSTCASHFLSVSIFYGSLLFMYVRPNSRNEGDKAIPAAIFYTLMIPLLNPFIYSLRNKEVINVTKKIMKIS*
85 >lcl|XP_001924744.1|Plus1complement(146805..147734) NW_003535233 olfactory receptor 6C4-like LOC100156740 __SEG__ Chr7 {Sus scrofa} MGNLTTVTEFVLLGLSDACELQMLIFLGLLLTYLLTLLGNLLIVVVTLMDRRLHTPMYYFLRNFAVLEIWFTSVIFPKMLTNILTRHKTISLAGCFLQSFLYFSLGTTEF
FLLAVMSFDRYVAICNPLHYVTIMSKRVCVQLVFYSWMTGFLLIIVPSFITIQQPFCGPNVINHFFCDNFPLLELICADTSLIELLGFIMANVSLLGTLLVTATCYGHIL
HTILRIPLAKERQRAFSTCSSHIIVVSLFYGSCIFMYVRSGKGRQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQMSKLLS*
86 >lcl|XP_001924745.1|Plus1complement(734804..735790) NW_003535240 olfactory receptor 11H12-like LOC100156995 __SEG__ Chr7 {Sus scrofa} MRTVESNISGSVSEFILLGFPCRRDIQILLFVLFSVIYLLIIMGNTSVICAVWSSWKLHTPMYIFLANFSFLEICYVSSDVPQMLANILSQSESISYVGCLLQFYFFFSM
CAAECLFLSVMAFDRFLAICRPLHYPTIMTHHLCAWLVVFCWAGGFLWLLTPLILISQVPFCGPNTIDHFLCDLGPLLALSCAPVSGTTHICGIMSSLIIFLTFLYILGT
YYSILSVVLQMPSGSGRHKAFSTCASHLAVVSLFYGSIMMMYVSPGSGYYPGMQKFVTLFYALATPFFNPLIYNFRNKDMEEALKKILNMLLWKSLKASKVKFNIRHH*
87 >lcl|XP_001924762.1|Plus1complement(160618..161547) NW_003535233 olfactory receptor 6C4-like LOC100155532 __SEG__ Chr7 {Sus scrofa} MGNLTTVTEFVLLGLSDACELQMLIFLGLLLTYLLTLLGNLLIVVVTLMDRRLHTPMYYFLRNFAVLEIWFTSVIFPKMLTNILTRHKTISLAGCFLQSFLYFSLGTTEF
FLLAVMSFDRYVAICNPLHYVTIMSKRVCVQLVLYSWMTGFLLIVILSFIIFRQPFCGPNVINHFFCDNFPLLELICADTSLIELLGFIMANVSLLGTLLVTATCYGHIL
HTILRIPLAKERQRAFSTCSSHIIVVSLFYGSCIFMYVRSGKGRQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQVNRLFL*
88 >lcl|XP_001924787.1|Plus1768523..769467 NW_003535240 olfactory receptor 11H6-like LOC100154576 __SEG__ Chr7 {Sus scrofa} MNVSGVNKVTEFILLSFPCSREVQVLLFVLFFVSYILTLMGNGAIVCAVKLDHRLHTPMYTLLANFSFLELCYVNTTVPNMLRNFLSETKTISFTACFLQFYFFFSMGTT
ETFLLPLMAFDRYLAICRPLHYPTIMSSHLCMNLVVLCWVTAFLCYPVPIYLITQLPFCGPNTIDHFVCDSGPLLALSCIPAPGIELSCSILSSLIIFITFFFILGSYTL
VLRAVLHVPSAAGRRKAFFTCGSHLAVVSLFYGTIMVMYISPTSGHPAGTQKIVTLLYSSVTPLVNPLIYSLRNKDMKAALRKIQMCTKISQSK*
89 >lcl|XP_001924820.1|Plus1<780031..780993 NW_003535240 olfactory receptor 11G2-like LOC100153366 __SEG__ Chr7 {Sus scrofa} FDGAFTAPRRMNISNTPRNSSTITGFILLGFPCSRHGQILLFLLFAGVYLLTLMGNGSIICAVRWDQRLHTPMYILLANFSFLEISYVTSTVPNMLANLLSDNKVISFSG
CFLQFYFFFSLGSTECFFLAIMAFDRYLAICRPLLYPTLMTARLCTNLVVSCWVLGFLWFLIPIIIVSQMSFCGSRIIDHFLCDPSPLLALTCKKAPVIELLFSTLSPVP
IILFILIMVSYALALRAVLKVPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSPNPEHDAPTQKIVTLFYSVVTPLLNPVIYSLRNKDMKKALQKFLRI*
90 >lcl|XP_001924834.1|Plus150582..51511 NW_001885251 olfactory receptor 5K1-like LOC100157439 __SEG__ Chr13 {Sus scrofa} MTGENQSLSIEFILTGFTDLPELKTLLFLVFLTIFLITMVGNLGLVALICTERHLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSKDRIISLYECMAQWYFLCLAETT
DCFLLAAMAYDRYVAICNPLQYHTMMSRKHCLRMTTGAYIAGNLHSMIHVGLLFRLTFCRSHQINHFFCDVLPLFRLSCVDPYINELMILIIAGFVQIFTVTIVIISYLF
ILFTIFTMKSTKGRGKALSTCASHFLSVSIFYGSLLFMYIRPNSLNEEDKDLPLAVFYTLVIPLLNPFIYSLRNKEVINVMKKIIKKMS*
91 >lcl|XP_001924850.1|Plus1complement(299479..300531) NW_003535233 olfactory receptor 6J1-like LOC100151899 __SEG__ Chr7 {Sus scrofa} MENQTAGVTEFILLGFPLSRWMEVLFLVLLLPTFLLTLLGNLLIISIVLSYSRLHTPMYFFLCNLSILDILFTSVISPKVLANLGSGDKTISFAGCITQCYFYFFLGTVE
FLLLTVMSYDRYAAICYPLRYSSIMRPAVCTGTVVFSWMGGFLSVLFPTILISQLPFCGSNVINHFFCDSGPLLALACADTSAIELMDFMLSSIVILCCIVLVAYSYTSI
ILTIVRIPSASGRKKAFNTCASHLTIVVISSSITVFIYVTPSQKEYLEINKIPSVLSSVVAPFLNPFIYTLRNDTVLGVLKDVWVRAQGVLEKRMRTMPRSRLSSNKDRR
GGTNCSSSSLSCALCANSQY*
92 >lcl|XP_001924851.1|Plus1908765..909703 NW_003535240 olfactory receptor 4F21-like LOC100158216 __SEG__ Chr7 {Sus scrofa} MDGANHSVVSEFVFLGLTNSWEIQLLLFVFISTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFLDLGVSSVASPKMIYDLFRKRKVISFSGCITQIFFIHVIGGV
EMMLLIAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGSNVLDSFYCDLPRLIKLACTDTYQLESLVMANSGFISVGSFIILIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPLIFLYTWPSPSIPLDKFLAIFDSVLTPFLNPVIYTFRNQEMKVAMRRVCRQLVSYRKIS*
93 >lcl|XP_001924859.1|Plus11429995..1431014 NW_003299193 trace amine-associated receptor 1-like LOC100157645 __SEG__ Chr1 {Sus scrofa} MTSFCHNIINISCVKSSWSNDVHASLYSLMVLIIFTTVVGNLIVIISISHFKQLHTPTNWLLHSMATADFLLGCLVMPYSMMRSVERCWYFGEVFCKIHTSTDIMLSSAS
IFHLSFISIDRYYAVCDPLRYKAKINILVISVMIFISWSIPALFAFGMIFLELNFKGAEEMYYKHAHCIGGCSVFFSKTSGVLAFMTSFYIPGSIMLCIYCRIYFIAKGQ
ARSINDTNQKLQIGLEEKNGISRSKERKAAKTLGIVMGVFLTCWCPFFVCTVMNPFLDYAIPPTLNDALIWFGYLNSTFNPMVYACFYPWFRRALKMILFGKIFQKGSSR
CKLFLESNP*
94 >lcl|XP_001924860.1|Plus173965..74894 NW_001885251 olfactory receptor 5K3-like LOC100156225 __SEG__ Chr13 {Sus scrofa} MIQDNHSLTTEFILIGFSNHPELRTILFLVFLTIYLITMVGNLGLVALIFAESRLHTPMYIFLGNLALMDSCCSSAITPKMLQNFFSKDRIISLYECMAQFYFLCLAETT
DCFLLAAMAYDRYVAICNPLQYHTRMSNKLCLQMITGAYIAGNMHPMIQIGFLFRLTFCRFNQINHFFCDVLPLFRLSCIDPYINEMMLFILAGSILTFSITIVIISYLF
ILFTVFTMKSNKGKGKALSTCASHFLSVSIFYGSLIFMYVGPNSGNEGDKDIPVAVFYTLVIPLLNPFIYSLRNKEVINVTKKIMKKTS*
95 >lcl|XP_001924878.1|Plus1808437..809426 NW_003535240 olfactory receptor 11G2-like LOC100157400 __SEG__ Chr7 {Sus scrofa} MPVHTHLIFAHPFTAHRHMNISNTPRNSSTITGFILLGFPCSRHGQILLFLLFAGVYLLTLMGNGSIICAVHWDQRLHTPMYILLANFSFLEISYVTSTVPNMLANLLSD
NKVISFSGCFLQFYFFFSLGSTECFFLAIMAFDRYLAICRPLLYPTLMTARLCTNLVVSCWVLGFLWFLIPIIIVSQMSFCGSRIIDHFLCDPSPLLALTCRKAPVIGLV
FSILNPVPMVILFILIIGSYTLVLRVVLKVPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSPNPEHDAPTQKIVTLFYSVVTPLLNPVIYSLRNKDMKKALQKFFRL*
96 >lcl|XP_001924887.3|Plus11455185..1456105 NW_003299193 trace amine-associated receptor 2-like LOC100156428 __SEG__ Chr1 {Sus scrofa} MYSLMAGAIFITVFGNLAMIISISYFQQLHTPTNFLILSMAVTDFLLGFTIMPYSMIRSVENCWYFGLTFCKIHYSFDLMLSITSIFHLCSVAIDRFYAICYPLQYATKM
TIPVIRQLLVLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFTAGFFTPGAVMVGIYGKIFAVSRKHAHAINNLPESQNNQMRKDKKAAKTLG
IVMGVFLVCWFPCFVTILLDPFLNFSTPVVLFDALTWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKVFSSHFHTTNLFIDKETE*
97 >lcl|XP_001924899.1|Plus1864486..865424 NW_003535240 olfactory receptor 4F15-like LOC100156190 __SEG__ Chr7 {Sus scrofa} MDVRNHSIVSEFVFLGFTNSWEIQLLLFVFSFLFYSVSMMGNLTIVFTITLDSHLHSPMYFLLVNLSVIDMVFCSITAPKMIGDIFKKHKAISFCGCITQIFFSHAAGGT
EMVLLIAMAFDRYVAICRPLHYLTIMSPRICLGFLVTSWIIGLIHSMAQLFFVVDLPFCGPNVLDSFYCDLPRLLRLACTDTQELEFMVTVNSGLLSVGSFVLLIISYIF
ILFTIWKHASGGSSKALSTLSAHITVVVLYFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKEMKVAMRRLFSHLVHYRNIS*
98 >lcl|XP_001924920.1|Plus11096154..1097092 NW_003535240 olfactory receptor 4F21-like LOC100157018 __SEG__ Chr7 {Sus scrofa} MDGANHSVVSEFVFLGLTNSWEIQLILFVFTSTFYVASMMGNSLILLTVTSDPHLHSPMYFLLANLSFLDLGAASVASPKMVYDLFRKRKVISFSGCITQTFFIHVIGGV
EGVVLLAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGPNVLDSFYCDLPRLLKLACTDTYQLESMVMANSGFISVGFFFVVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWPSPSIPLDKFLAIFDSVLTPFLNPVIYTFKNQEMKVAMKRVCRQLVSYRKIS*
99 >lcl|XP_001924929.3|Plus11478049..1479092 NW_003299193 trace amine-associated receptor 4-like LOC100153998 __SEG__ Chr1 {Sus scrofa} MNSPDLWNAPEIQLCFALANNSCARNVRSGLSVGAMYIVMIGAIVMTMLGNLAVILSIAYFKQLHSPTNFLILSMAITDFLLSCVVMPFSMIRSIESCWYFGDLFCKVHS
CCDIMLCTTSIFHLCFISVDRYYAVCDPLCYVTKITIPVIGVFLLISWSVPILFAFGLVFSELNIIGAEDFVAATDCTGLCVLIFNKLWGVLASFIAFFLPGTVMVGIYA
HIFTVARKHAKQIGTGSMMNQIVSTSKRKASTIKGSKATKTLSIVMGVFVLCWLPFFILTVIDPFISFTTPEDLYNVFLWLGYFNSTFNPIIYGMFYPWFRKALRMIVSG
MIFCPDSSTLSLFPVHT*
100 >lcl|XP_001924953.2|Plus11486143..1487156 NW_003299193 trace amine-associated receptor 5-like LOC100152802 __SEG__ Chr1 {Sus scrofa} MSLVLIQDAEKHPTMFCYQVNGSCPRTVHPLGIQLAIYLACAAGVLITVLGNLFVVFAVSYFKALHTPTNFLLLSLAVADMFLGLLVLPLSTIRSVESCWFFGDFLCRLH
TYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALGYILAGWGVPAVYTAFLLYTNVVESGLRQWLEEMPCVGRCQLLFNKFWGWLNFPVFFLPCLIMISLYV
KIFVVATKQAQQIHNLSKSLAGAAKRERKATKTLGIAMGVYLLCWLPFTMDTMADSLLNFITPPLLFDIFIWLAYFNSACNPIIYVFSYRWFRKALKLILSRSIFSLQTP
TTDLYQE*
101 >lcl|XP_001924985.3|Plus1168639..>170192 NW_003535777 kelch repeat and BTB domain-containing protein 6 KBTBD6 __SEG__ Chr11 {Sus scrofa} MQSREEASRSRRLASPRGGKRPKRVHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSESNVERLYAASDMLQLEYVREACASFLARRLDLANCTAIFKFADAFGHRKLRSQAQSFIAHNFKQLSQMGSIREESLADLTLA
QLLTVLRLDSLNIEHEQTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDRNYLEELLTKPIVKKYCLDLMEGALQMRYGDMLYKSLVPKPESSSACSSSSNNNNS
SGGGSGVGCGGSSSSCSVVSVAENPPQRLGVCAKKMVIFFGHPRDPFLCCDPYSGDIYKVPSPLTCLAHTRTVTTLAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLA
DRLLCREGMDVAYLNGYIYILGGRDPITGIKLKEVECYSVQRNQWALVAPLPHSFISFDLMVIQNYLYALNSKRMFCF
102 >lcl|XP_001925028.1|Plus11506574..1507608 NW_003299193 trace amine-associated receptor 6-like LOC100155663 __SEG__ Chr1 {Sus scrofa} MNSLSPSAAVQLCYENVNGSCVKAPYSPGSRLVLYTVFGCGALLAMLGNLLVMIAILHFKQLHSPTNFLIASLACADFLVGVTVMPFSMVRSVESCWYFGRSFCTFHTCC
DVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGLCISISWVLPLVYSGAVFFTGVHEDGMEELVRALSCIGGCQPIVNQFWTLIDFLLFFLPTFVMIFLYSNIF
LVARQQAKKIEHLSSKAKGFSRSNKTRVAKRERKAARTLGVTVVAFLISWLPYMIDSFFHSFGGFITPSYVYEIFCWFGYYNSALNPLIYALFYHWFRRAIKLIITGQVL
KDSPSTINLFSKET*
103 >lcl|XP_001925043.1|Plus1complement(970918..971856) NW_003535240 olfactory receptor 4F21-like LOC100155823 __SEG__ Chr7 {Sus scrofa} MDGANHSVVSEFVFLGITNSWEIQLLLFVFTSMFYMASMMGNSLIMFTATSDPRLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKRKVISFSGCITQIFFIHVIGGV
EVVVLIAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGPNVLDSFYCDLPRFIKLACIDTDQLEFMVTANSGFISVGSFFILIISYIV
IILTVKKQSSAGSSKALSTLSAHISVVVLFFGPLIFVYTWPSPSIPLDKFLAIFDAVLTPFLNSVIYTFRNQDMKVAMRRVCQQLMSYRKIS*
104 >lcl|XP_001925044.1|Plus1885920..886858 NW_003535240 olfactory receptor 4F15-like LOC100155397 __SEG__ Chr7 {Sus scrofa} MDVRNHSIVSEFVFLGFTNSWEIQLLLFVFSFLFYSVSMMGNLTIVFTITLDSHLHSPMYFLLVNLSVIDMVFCSITAPKMIGDIFKKHKAISFCGCITQIFFSHAAGGT
EMVLLIAMAFDRYVAICRPLHYLTIMSPRICLGFLVTSWIIGLIHSMAQLFFVVDLPFCGPNVLDSFYCDLPRLLRLACTDTQELEFMVTVNSGLLSVGSFVLLIISYIF
ILFTIWKHASGGSSKALSTLSAHITVVVLYFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKEMKVAMRRLFSHLVHYRNIS*
105 >lcl|XP_001925069.2|Plus1complement(237686..238618) NW_003534164 olfactory receptor 1L1-like LOC100152475 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFALFFIMYVVTLVGNLLIILAIRSDTQLQTPMYFFLSILSFIDVCYTTTIVPKMLVNFLSKKKSISYAECMTQMYFFLAFAN
TESYLLATMAIDRYVAICDPFHYVTVMSHRRCVLLVAFSCSISHLHSLLLVLLINRLLFCDSNVIQHFLCDINPLLKLSCSSTFVNEIVINTEGLTTLVTPFICVIISYL
RILTAVLKIPSAAGKHKAFSTCGSHLTMVTLFYGSIIYVYFRPLSTYTIQDRVATVIYTVLSSMLNPFIYSLRNKDMKRGLGKLMSRRVS*
106 >lcl|XP_001925084.2|Plus1complement(274608..275552) NW_003534164 olfactory receptor 1L8-like LOC100157704 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFSLFLTIYLVTITGNLLIILAIRSDPQLQTPMYFFLTFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFIYALGNT
DSFLLAVMAFDRYVAICDPFHYVTIMNHHRCVLMVAFSCSLPHLHSLLHTLLLNQLTFCDSNIIHHFLCDLSPLMKLSCSSTFVNETVMIIEGSFILVTPFLCIAFSYIR
ILTAVLKIPSAAGKRKAFSTCGSHVTVVTLFYGSIFYVYLQPVSSYTVRDHMATIVYTVLSSMLNPFIYSLRNKDLKQGLRKLVGSRKLQAACS*
107 >lcl|XP_001925085.1|Plus1complement(1543410..1544456) NW_003299193 trace amine-associated receptor 9-like LOC100152013 __SEG__ Chr1 {Sus scrofa} MVDNFSQAEAVEFCYENVNGSCIKTPYSPGPRAILYTVLGLGAVLAVFGNLLVIISILHFKQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGERYCKFHTC
FDTSFCFASLFHLCCISIDRYVAVTDPLTYPTKFTISVSGICIVLSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGCQAPLNQSWVLLCFLLFFIPTVAMVFLYGKI
FLVAKYQARKIESTASQAQSSSESYKERVAKRERKAAKTLGIAVAAFLVSWLPYIIDAVIDAYMNFITPAYVYEILVWCVYYNSAMNPLIYAFFYPWFWKAIKLIVSGKV
LKSNSSTINLFSEEADVD*
108 >lcl|XP_001925102.1|Plus1complement(998101..999039) NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100154552 __SEG__ Chr7 {Sus scrofa} MNRDNHSVVSEFVFLGLTNSWEIQLLLFLFSSVFYVASMMGNSLILLTVTSDRHLHSPMYFLLANLSFIDLGVSSVFSPKMIYDLFRKHKVISFSGCITQIFFIHIIGGV
EMVLLVATAFDRYVTICKPLHYLAIMSPKMCILFLVAAWIIGLVHSVVQLAFVVKLPFCGPNVLDSIYCDLPRFIKLACTDTYRLEFMVTANSGFISLGSFFILTISYIF
ILITVQKHSSGSSSKALSTLSTHVMVVVLFSGPFIFVYMWPHSTSNLDKFLAVFDAVLTPFLNSVIYTLRNKEMKVAMRKVCSQFFIYGRIS*
109 >lcl|XP_001925110.1|Plus1complement(286042..286986) NW_003534164 olfactory receptor 1L8-like LOC100156488 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFSLFLTIYLVTITGNLLIILAIRSDPQLQTPMYFFLTFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFIYALGNT
DSCLLVVMAFDRYVAICDPFHYVTIMNHHRCVLMVAFSCSLPHLHSLLHTLLLNQLTFCDSNIIHHFLCDLSPLMKLSCSSTFVNETVMIIEGSFILVTPFLCIAFSYIR
ILTAVLKIPSAAGKRKAFSTCGSHVTVVTLFYGSIFYVYLQPVSSYTVRDHMATIVYTVLSSMLNPFIYSLRNKDLKRGLRKLVGSRKFKAASS*
110 >lcl|XP_001925151.1|Plus1complement(1039661..1040599) NW_003535240 olfactory receptor 4F21-like LOC100153340 __SEG__ Chr7 {Sus scrofa} MDGANHSVVSEFVFLGLTNSWEIQLLLFVFISTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFLDLGVSSVASPKMIYDLFRKHKVISFSGCITQIFFIHVIGGV
EMMLLIAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGSNVLDSFYCDLPRLIKLACTDTYQLESLVMANSGFISVGSFIIVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPLIFLYTWPSPSIPLDKFLAIFDSVLTPFLNPVIYTFRNQEMKVAMRRVCRQLVSYRKIS*
111 >lcl|XP_001925185.1|Plus11132538..1133476 NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100152147 __SEG__ Chr7 {Sus scrofa} MDGTNHSVVSEFVFLGLTNSWEIQLLLFMFSSVFYVASMMGNSLILRTVTSDRHLHSPMYFLLANLSFIDLGVSSVFSRKMIYDLFRKHKVISFSGCIAQIFFLHIIGSV
EMALLVATAFGRYVTICKPLHYLTIMSPKICILFLVAAWIIGLVHSVVQLAFVVKLPFCGPNILDSFYCDFPRFIKLACTDTYRLEFMVTANSGFISLGSFFILIISYIF
ILITVRKYSSGSSSKALSTLSTHVMVVVLFFGPCIFVYMWPHSTSHLDKFLAVFDAVLTPFLNSVIYTLRNKEMKMAMRKVCSQFFIYRRIS*
112 >lcl|XP_001925205.1|Plus1186614..187579 NW_003536326 olfactory receptor 13A1-like LOC100154185 __SEG__ Chr14 {Sus scrofa} MEWGLGAAPSQVARSNQTVVTEFVLQGFSEHPELWLPLLGCFSFLYTVALMGNAVIIAVVSYSASLRSPMYFFLCNLAIMDIICTSSVLPKVLAGLASEKNTISFPGCMA
QLFFLLWSLSSELLLLTVMAYDRYEAICHPLHYGSKMSPLLCRSLALGVWVVCALNASVHTGLMMRLSFCGSNIVTHFFCEIPPLLLLSCSPTLMNSIMTVLADAFYGVI
NFVLTLASYCCIIASILRMRSASGRQRAFSTCSSHLLVVSVYYSAVFCAYISPASSYGPERSKVSGVLYTTLSPTLNPIIYSLRNTEVKHALKRLILLSRR*
113 >lcl|XP_001925213.1|Plus1complement(958772..959731) NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100152146 __SEG__ Chr7 {Sus scrofa} MSTKPKDGENNSVVSEFVFLGVTNSWEIQLLLFVFSSMFYMASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFLDLGAASVASPKMVYDLFRKRKVISFSGCITQIFFIH
VIGGVEMELLIAMAFDRYVAICKPLHYLTIMSPKLCIFLLVAAWIIGLIHSMVQLAFVVNLPFCGPNVLDSFYCDLPRLLKLACIDTYQLESMVTANSGFISVGSFFILI
ISYIIIILTVKKQSSVGSSKALSTLSAHITVVILFFGPLIFFYMWPFPSTHLDKFLAFFDAVLTPFLNPVIYTFRNQEMKVAMRRVCRQLVNYRRSLKR*
114 >lcl|XP_001925218.1|Plus1complement(132132..133106) NW_003534151 olfactory receptor 2K2-like LOC100156374 __SEG__ Chr1 {Sus scrofa} MTAGTRREMQGGNLTNWGFFFLEGFSRYPKLEIALFVFSLVMYLTTLLGNSTLILITILDARLRTPMYLFLGNLSFMDICYTSASVPTLLVNLLSAQKTILFSGCAVQMY
LSLAMGSTECVLLAVMAYDRYVAICNPLRYPVIMNRQVCVQMATASWATGSLTALLETSFALQVPLCGNLIDHFTCEILAVLKLACTSSLLMDMILLVVSVLLLPIPMLL
ICISYVFILSTILRISSAEGRSKAFSTCGAHLTVVILYYGAALSMYLKPSSSGSQERDKIIAFLYGMITPTLNPIIYSLRNKEVKDAVKKMLGKMSSHHTQEHL*
115 >lcl|XP_001925305.1|Plus1245829..246962 NW_003301225 sphingosine 1-phosphate receptor 3-like LOC100154607 __SEG__ Chr14 {Sus scrofa} MAVVLTSSARPYTSNETLHEHYNYVGKLEGRLKDAPEGSTLTTVLFLIICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTLSLSLTV
WFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKKHRVFLLIGMCWLIAFSLGALPILGWNCLHNLPDCSTILPLYSKRYIAFCVSIFTAILVAIVILYARIYF
LVKSSSRRVASPHNSERSMALLRTVVIVVSVFIACWSPLFILFLVDVACKVKECAILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRLVCTCLVRGRAARSLPSQP
ALDPSRSKSSGSNNSSPSPKSKEDPQMAASPCITDRNKTLQNGIFCK*
116 >lcl|XP_001925321.1|Plus1complement(1062574..1063512) NW_003535240 olfactory receptor 4F15-like LOC100153735 __SEG__ Chr7 {Sus scrofa} MDVRNHSIVSEFVFLGFTNSWEIQLLLFVFSFLFYSSSMMGNLVIVFTVTLDSHLHSPMYFLLANLPAIDMVFCSITAPKMIGNIFKKHKAISFCGCITQIFFTHAAGGT
EMVLLIAMAFDRYVAKCRPHHYLTIINPRICLCFLVTSWIIGLIHSMAQLFFVVDLPFCDLNVLDSFYCDLPRLLRLACTDTQELQFMVTVNSGLLSMGSFVLLIISYIF
ILFTIWKHASGGSSKALSTLSAHITMVVLYFGPLIFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTLRNKEMKVAMRRLFSHLVHYRNIS*
117 >lcl|XP_001925443.2|Plus1complement(122290..123231) NW_001886053 olfactory receptor 1J4-like LOC100153627 __SEG__ Chr1 {Sus scrofa} MKRENQSSMSNFQLLGLPIVPEQQGLYFALFLGMYLTTVLGNLLIILLIRLDPHLHTPMYFFLSHLALTDVSFSSVTVPKMLMDMQTQDQSIPYAGCLTQTYFFIFFGCT
DNFLLVVMAYDRYVAICHPLHYTIIMREELCLCLLAGSWLLSCAYALTHTLLLAQLSFCADNIIPHFFCDLDALLKLSCSDTSLSELVIFTAGSAVVIFPLSGILVSCGR
IGFSLLRVPSTKRLCKAWSTCGSHLSVVSMFYGTMIALYLSSSSGQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGILFRNIHIFVK*
118 >lcl|XP_001925538.1|Plus1complement(847072..850170) NW_003535797 protocadherin-9 PCDH9 __SEG__ Chr11 {Sus scrofa} MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECF
FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVM
KIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTV
LASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIV
ASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTP
PLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAK
VTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAADIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLV
FLYVNDTAGNASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIVAGAMVVIVVIFVTVLVRCRHASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSS
LLNFVTIEESKPDDAVHEPINGTISLPAELEEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTLSKRSSTSSDH
FSASECSSQGGFKTKGPLHTRQVNEHFYWSISTAYKCPVNQY*
119 >lcl|XP_001925664.1|Plus1complement(136802..137728) NW_001886080 olfactory receptor 4A47-like LOC100154969 __SEG__ Chr1 {Sus scrofa} MEPRNNVTYFVLLSLTQNPNEQKFLSVMFLLFYMLTVVGNTLIVVTVTFSKTLGSPMYFFLASLSFMDVIYSSSISPKLISSLFIGKNTITFQSCMIQLFIEHFFGGSEV
FLLLVMAYDRYVAICKPLHYLVIMRQWVCIVLLMLSWVGGFLHSVIQLGTIYGLPFCGPNVIDHFICDMYPLLKLVCTDTSVIGILVVVNGGLICSIVFLLLLISYGVIL
HSLKNLSQDGRQKALQTCGSHITVVVFFFVPCIFMYARPAKTFSIDKSLSVFYTIITPMLNPLIYGLRNSELTNAMKKLCRRNMRRII*
120 >lcl|XP_001925688.1|Plus1complement(607341..608324) NW_003534138 olfactory receptor 2S2-like LOC100152003 __SEG__ Chr1 {Sus scrofa} MGQANQTAVAEYVLLGLHEHHNLELVLFVLCLGIYSINVLGNTLLFGLNLLDPRLHSPMYFFLSNLSLMDLCGTSSFVPLMLVNFLKTQSTISFPGCALQMYLTLALGST
ECLLLAVMACDRYVAICQPLRYSALMSRQTCAWMAALSWGTGFANSLLHSIVTWSLPFCGHNVINHFFCEILAVLKLACEDISLNALLTLTTTVLTLAPLLLICLSYVFI
LAAILQVPSAAGRRKAFSTCSAHLTVVVVFYGTICFMYFKSRSKDPTMDKILALFYGLVTPSLNPIIYSLRNAEVKAATIALLRGDLLSRKMSHFSCRSLTLLGRTG*
121 >lcl|XP_001925696.3|Plus1complement(1463150..1464088) NW_003536265 olfactory receptor 6C2-like LOC100152956 __SEG__ Chr14 {Sus scrofa} MEVKNETTIQEFILEGFPAVRHLGSLLFLVHLLAYLASMTGNMVIIIITWVDRRLQTPMYILLSTFSFCECCFITTVIPKLLSIFLSGRQTIPFTACLVQAFLFLFLGAV
IFFLMAVMSLDRYLAICKPLHYPSIMNLRVSFLLVFFCYTLSFIFFTCLMLKVSQLWFCGPNVISHFFCDLGSLIHLSCSDTRSVEIYFFFLTSFVLLLSLFITIIVYSN
IIVTVMGLPSAKERQKAFSTCSSHLIVLFLMYGSCVFIYLKPKQTNRLDSNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDTVSRKRLQK*
122 >lcl|XP_001925800.1|Plus1complement(928143..929738) NW_003536750 retinoic acid-induced protein 2 RAI2 __SEG__ ChrX {Sus scrofa} MDDLQSQNLSMDMTDSAPALASNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNA
TYVMTTQGPVQLPVVLEQHVFQHLNSPLVLPQEAPCSSGAVHSNLFQGAEDPEAQPQLLDLRIPSQPQEPSLPFEAVLQNLFPSQGALGPPPCQPPPGYAPVPPQPFNAP
LSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSPGCPKAPSSFGLQPFRGGPPAVQKEELKPFELLQPREYFQLSRHTVIKMGSENEALDLSMKSVPWLKAG
DVSAPACQEDAALDLSLATHRRSEPPPPPETLCDSSGAVDGPGHAAMETPPGGGVEVPFAPATPHEAAAAAAMERHLGGSDAAEPPRQPSGEVKAENNIELGSESQAAKV
IVSVEDTVPTIFCGKIKGLSGVSTKNFSFKREDAMLQGYDISSQAEESAGSAEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
123 >lcl|XP_001925811.2|Plus14315..5247 NW_003534190 olfactory receptor 140-like LOC100154169 __SEG__ Chr1 {Sus scrofa} MPPNNVTEFILLGLTQDPHLKKMLFIVFLLIFLVTLLANLFIVITISLSPTLSSPMYFFLTHLSFIDASFTSVTTPKITIDLLYQRTTISWGGCLSQLFLEHFLAGSEII
VLIAMAYDRYVAICKPLHYTTIMRPGLCHFLVVVAWIGGVIHATVQILFVLDLPFCGANVIDHFMCDFFSLLELACTDTYWHGIVISANTGGMCLLIFFMLLISYVVILN
SLKSHGSEGRHKAFSTCGSHFTVVVLFFFPCIFTHVHPVATYPVDKLVILFCGTFTPMLNPIVYTVRNTEVKNAVKTLLKRRVSETVLDS*
124 >lcl|XP_001925852.1|Plus1complement(32405..33331) NW_003534190 olfactory receptor 4A47-like LOC100158212 __SEG__ Chr1 {Sus scrofa} MEPRNNVTYFVLLSLTQNPNEQKFLSVMFLLFYMLTVVGNTLIVVTVTFSKTLGSPMYFFLGSLSFMDVIYSSSITPKLISSLFIGKNTITFQSCMIQLFIEHFFGGSEV
FLLLVMAYDRYVAICKPLHYLVIMRQWVCIVLLMVSWVGGFLHSIIQLGTIYGLPFCGPNVIDHFICDMYPLLKLVCTDTSVIGILVVVNGGLICSIVFLLLLISYGVIL
HSLKNLSQDGRQKALQTCGSHVTVVVFFFVPCIFMYARPAKTFSIDKSLSVFYTIITPMLNPLIYGLRNSELTNAMKKLCRRNMRRII*
125 >lcl|XP_001925862.1|Plus1complement(1521170..1522108) NW_003536265 olfactory receptor 6C2-like LOC100157415 __SEG__ Chr14 {Sus scrofa} MEVKNETTIQEFILEGFPAVRHLGSLLFLVHLLAYLASMTGNMVIIIITWVDRRLQTPMYILLSTFSFCECCFITTVIPKLLSIFLSGRQTIPFTACLVQAFLFLFLGAV
IFFLMAVMSLDRYLAICKPLHYPSIMNLRVSFLLVFFCYTLSFIFFTCLMLKVSQLWFCGPNVISHFFCDLGSLIHLSCSDTRSVEIYFFSLTSFVILLPLFITIIVYSN
IIVIVMGLPSAKERQKAFSTCSSHLIVFFLMYGSCVFIYLKPKQTNRLDSNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDTVSRKRLQK*
126 >lcl|XP_001925923.3|Plus187159..88103 NW_003299423 olfactory receptor 1L8-like LOC100154066 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFSLFLTIYLVMIIGNLLIILAIRSDPQLQTPMYFFLAFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFLYALGNT
DSFLLAVKAFDRYVAICDPFHYVTIMSHHRCVLMVALSCSLPHLHSLLHTLLLNQLTFCDSNIIHHFLCDISPLMKLSCSSTFVNETVMMTEGSFILVTPFLCITFSYIR
ILTVVLKIPSAAGKRKAFSTCGSHVTVVTLFYGSIFYVYLQPVSSYTIRDHMATIVYTVLTSTLNPFIYSLRNKDLKQGLRKLVGRRKFQATSP*
127 >lcl|XP_001926040.1|Plus121846..22790 NW_003534750 olfactory receptor 6C6-like LOC100156296 __SEG__ Chr5 {Sus scrofa} MKNQSMEIEFILLGLTDDPQLQIVIFLFLFVNYTLSLMGNVIIILLTLLDPRLKTPMYFFLRNFSFLEIIFTTVCIPRFLVTIVTKEKTISYNNCAAQLFFILLLGVTEF
YLLAAMSYDRYVAICKPLHYPILMNSKVCYQLVFSSWVTGFLIIFPPLVMGLRLDFCASRVIDHFMCETSPILQISCTDTRVLELMSFILAVVTLVVTLILVILSYTYII
RNILKFPSAQQRTKAFSTCTSHMIVVSLTYGSCIFMYLKPSARERVTVSKGVALLYTSVAPLLNPFIYTLRNQQVKEVFWDMLQKVVCFPKKQL*
128 >lcl|XP_001926071.2|Plus16686..7624 NW_003534191 olfactory receptor 1052-like LOC100153732 __SEG__ Chr1 {Sus scrofa} MAGWNHTGVKEFLLVGLTENPNLLIPLFLLFTLIYFITLVGNGGMIMLIWLNAQLHTPMYFFLSNLSFCDICYATVFAPKMLVNFLAKHKSSTFSGCVLQSFFFAVYITT
EGILLSVMAYDRYVAIASPLLYSVIMTQKVCIQMVLASYLGGLINSLTHTIGLLKLDFCGPNTVNHYFCDIPPLLRLSCSDAHNNELLLLLFSGIIAMFTLIIIMVSYIC
IIIAIQRIHSAEGRRKAFSTCASHLTTVTLLYGSVTFSYIQPSSKYSLEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAKWSIWRKRTSA*
129 >lcl|XP_001926072.1|Plus11497546..1498574 NW_003299193 trace amine-associated receptor 8a-like LOC100156866 __SEG__ Chr1 {Sus scrofa} MTSSNLSQADVVQLCFENVTRSCLKTPYSSGSRVILYLVLGFGSLLAVFGNVLVMTSVLHFKQLHSPANFLIASLACTDFLVGVTVMPFSMVRSVESCWYFGATFCALHS
FCDAAFCYSSLFHLCFISIDRYVAVTDPLVYPTKFTASVSGLCISISWVLPLVYSGAVFYTGVSDDGVEEFVSALNCVGGCQIVVNQDWVLIDFLLFFIPTLVMITLYSK
IFLVAKQQAIKIEHTGRRAESESYKARVAKRERKAAKTLGFTVMAFMISWLPYTIDTLIDAYMGFITPAYIYEICCWCAYYNSAINPLIYASFYPWFRKAIKVILSGGLF
QNSSSTMSLFSE*
130 >lcl|XP_001926086.1|Plus1complement(45066..46025) NW_003534750 olfactory receptor 6C75-like LOC100153881 __SEG__ Chr5 {Sus scrofa} MKNQSMEIDFTLLGLSNDPQLQIGIFLFLFFNYILSLMGNFVIILLTLLDPHLKTPMYFFLRNFSFLEISFTTVCIPRFLISILTGDKSISYSGCVTQLFFFLLLGVTEF
FLLAAMSYDRYVAICKPLHYPVIMNSRVCHQLVLSSWVAGFLIIFPPLVLGLQLDFCASKIIDHFLCDSSPVLQLSCTDTSFIELMAFVLAVVTLVVTLLLVVLSYTYII
KTILKFPSAQQRTKAFSTCSSHMVVVSLTYGSCIFTYMKPSAKERVTITKGVAVLNTSVAPLLNPFIYTLRNQQVKDALKDMLQRFCYLQNNETKCRHK*
131 >lcl|XP_001926094.1|Plus11512545..1513576 NW_003299193 trace amine-associated receptor 7a-like LOC100154406 __SEG__ Chr1 {Sus scrofa} MSSDSPPPEAVQLCYENLNGSCVKSPYSPGPRLILYTVFGFGVVLTVCGNLLVMIAILHFKQLHSPANFLTASLACADFLVGVTVMPFSTVRTVESCWYFGQRYCQLHSC
FDASFCYASIYHLCFISLDRYAAVTDPLIYPIRFTSSVSGMCIAFAWLFSMIYSFSLFGTGTNAAGLEDLVSALSCVGGCQFTVNQSWVLVNFLLFFIPTLVMIILYSKI
FLIAKHQARKIESMSKETGRSSDTYRDRVAKRERKAAKTLGIAVVAFLISWLPYFLDSIIDAYLGFITPTYIYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKV
LREDSSTINLFSE*
132 >lcl|XP_001926105.2|Plus1complement(61846..62784) NW_003534750 olfactory receptor 6C3-like LOC100152670 __SEG__ Chr5 {Sus scrofa} MGNHTRVTVFILAGLTDDPQVKVALFIFLLLTYLLSITGNLIIIILTLVDIHLKTPMYFFLRNFSFLEISFTTTCIPKCLVMMVTGDQTISYNNCIAQLFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTAIMNSKICIQLVLSCWIAGFFTIFVPLLLVLKLDFCASNIVDHFGCDPTPLLQISCSETHLIETMGFSSAVVTLVVTLAVVIISYTYIA
LTILKIPSANQRKKAFSTCSSHMIVISLSYGSCIFMYVKPSVKQRVSFYKGIALLNTSVAPLLNPFIYSLRNQQVKKAFMNIIHRVASFLNR*
133 >lcl|XP_001926113.1|Plus139260..40207 NW_003534191 olfactory receptor 8H3-like LOC100157785 __SEG__ Chr1 {Sus scrofa} MATRNDTHVSDFILMGLTDSEAIQRILFMLFLLIYLITVLGNAGMILIIHLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLGNLLTSTKYISYMNCFTQTYFFVFLAGA
ECCLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFTGFLDSFVNVLCMSRLDFCDSNVIHHFFCDISPILALSCTDTQITEIVIFILGGSTLVVSLTTIVVSYVS
ILSTILKITSTSGKQKAFSTCASHLLGVTIFYGTMIFTYLKPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVMQKTVGSRQLK*
134 >lcl|XP_001926122.2|Plus1complement(437497..438441) NW_003299872 olfactory receptor 5V1-like LOC100156169 __SEG__ Chr4 {Sus scrofa} MNNQTDVTELIFLGFSNHPNLQGLFFLVFLVIYLITLLGNVLIIMATRISSALHTPMYYFLGNLSFLDICYTSTTIPVMLVNFFREKKTISYRGCLSQIFFLVTGAGTEG
VLLAAMAYDRYVAICHPLQYPVLMGVKVCVCLVTGSWLCGLVNSVTHTVLAATLTLCGPNQISHFLCDVPLLLKLSCSDTSLNEFVLHVASATIGLSPCLLTAASYVLII
SAVLRIPSAQGRSKAFSTCASHLTVVVVFFGTANFNYDRPNVGYSLDMDILISVLFCVITPMLNPIIYSLRNKEIKSALKKLARECCFSSETSD*
135 >lcl|XP_001926123.1|Plus182260..83207 NW_003534750 olfactory receptor 6C2-like LOC100157908 __SEG__ Chr5 {Sus scrofa} MKSVTRNHSAITTFIILGLTSDPQLEILFFFFLLITYMLSVIGNLTIISLVLVDSHLKTAMYFFLQNFSFLEISFTTACVPTYLHIISSGDKTITINACFSQIFFIVLFG
ATEFFLLAVMSYDRYVAICKPLHYMSIMNSRVCRNLILCCWVSGLLIILPPLGLSLHLEFCDSVIDHFVCDASPILKNSCSDTWFIEQLVIVCAVLTFIVTLVCVVLSYI
YIIRTILRFPSAKQRKKAFSTCSSHMIVVSMTYGSCIFMYIKPSAKDEVAINKGVSLLTTSVAPLLNPFISTLRNKQVRQSFYDTFKRLMFNSKK*
136 >lcl|XP_001926136.1|Plus1complement(46784..47584) NW_003534191 olfactory receptor 5T2-like LOC100156571 __SEG__ Chr1 {Sus scrofa} MSLKLPHFLGVLSCVDASISSVIIPNMLVEFTSKNKVISFLGCGTQMFLVVTFGTTECFLLAAMAYDRYVAIYNPLLYSVTMSPRVCVTLVIASYVGGLLNASVHTVATF
SLSFCVTNEIRHVFCDIPPLLAISCSDTYTSQLLLFYCVGPVELVTILIVLISYAFILLAILRMHSAEGRRKIFSTCGSHLTGVSVYHGTILFTYVRPSSSYALDHDMIV
SIFYSIAIPMLNPIIYSLRNKDVKEAMKRVFGENGCVNKVYFHTNR*
137 >lcl|XP_001926137.1|Plus11464910..1465938 NW_003299193 trace amine-associated receptor 3-like LOC100155640 __SEG__ Chr1 {Sus scrofa} MDLTYIPEDLSSCPKFGNKSCPPTNRHFHVRVIMYSVMTGAMFITIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGLVIMPYSMVRSVESCWYFGDGFCKFHASF
DMMLSLTSIFHLCSIAIDRFYAVCYPLHYTTTMTTSLIKQLLAFCWLAPALFSFSLVLSEANVSGLRSYEILVACFNFCALTFNKFWGTILFTTCFFTPGSIMIGLYGKI
FIVSKRHAQVISNLPANTKGEVKNLSKKKDQKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDNSTPIIVLDFLVWLGYFNSTCNPLIHGFFYPWFQKALQYIVSGKIFSS
HSESANLFPEAH*
138 >lcl|XP_001926165.1|Plus174283..75254 NW_003534191 olfactory receptor 8K3-like LOC100155372 __SEG__ Chr1 {Sus scrofa} MVWVDKYNLTLLNKFILMGIMDIPKLKAPLFGLFLIVYLISVMGNLGLSILIKIDHRLQTLMYFFLRHLAFTDFGYSTAVGPKMLANFAVDKPTISYHWCATQLMFFSMF
ITSEIFILSAMAYDRYMAICHPLLYMGLTSPRLCQVLVTIPYLYSLFLSLLTIIKIFCSSFCGYYVIRHFYCDSLPLIALLCSDTQEIKLIILIFSAFNLLSSVLIVLGS
YIFILATILRMNSAERRLKAFSTCGSHLTVIVIFYGTLFFMYVKPNSSDSFDVDQVASLFYTLVIPMLNPMIYSWRNKEVKNALPRAWRMCANILFKTHCRIH*
139 >lcl|XP_001926174.1|Plus1complement(575149..576066) NW_003534833 olfactory receptor 8S1-like LOC100156793 __SEG__ Chr5 {Sus scrofa} MGNHSVVSEFILLGLSADPQIQALLFVLFLVIYILTLMGNLMLLLVIWVDSQLHIPMYFFLGQLSFLDLCHSSVTVPKLLENLLSEKKTISVEGCLAQVFFVFATGGTES
CLLTVMAYDRFVAISSPLLYGQVMNRQLCMGLVWGSWSLAFLDALINILVALNLDFCEGQNIHHFSCELPSLYPLSCSDVSASFTALLCSSLLHFTGNFLLIFFSYVRIL
FTILSISSTKGRSKAFSTCSSHLTAVVFFYGSGLLRYLMPNSGSTQELIFSLQYSVVTPMLNPLIYSLKNKEVKAAVRRTLRKRF*
140 >lcl|XP_001926192.2|Plus1656940..657869 NW_003534833 olfactory receptor 8S1-like LOC100155591 __SEG__ Chr5 {Sus scrofa} MENRSMISEFILLGFSADPQTQILLFVLFLVIYLLTLMGNLVMLLVIRIDPHLHTPMYFFLRQLSFLDLCHSSVTVPKMLENLLSESKTIFVESCLAQAFFVFATGGTEA
CLLAVMAYDRYVAISSPLLYGQVMSNQLCVGLVWGSWGLAFVDALINILLAVNLDYCEDHTIPHFSCELSSLFPLSCSDTATNFTLLLCSSVLHFFGTFIMIVSSYARIV
STILSISSTSGRSKAFSTCSSHLTTVILFYGSGFLSYLLPASGSPLEMVFSLQYSVVTPMLNPLIYSLQNKEVKAAMRRMLRRYVNIFT*
141 >lcl|XP_001926245.1|Plus1145524..146465 NW_003534191 olfactory receptor 8K5-like LOC100156990 __SEG__ Chr1 {Sus scrofa} MGQQNLSLLTEFTLMGVTRLPELQAPLFGIFLIIYTITVVGNLGMIILTQMDSHLHTPMYFFIKHLAFIDLGNSTVICPKMLVNFVVDANTISYYACATQLTFFLMFIIS
EFFILAAMACDRYVAICNPLLYNVIMSQRLCHMLVGIPYLYGTFQALMFTIKIFTLTFCGSNVISHFYCDDGPLVLMLCSNAQEIELLIILFSAFNLISSLLVILVSYLL
ILIAIFRMHSTKGRKKAFSTCGSHLTVVVVFYGSLLFMYMQPKSTHSFNTDKMASVFYTLVIPMLNPLIYSLRNKEVKNGFYRVFKNQCKLCI*
142 >lcl|XP_001926287.1|Plus1107446..108384 NW_003534751 olfactory receptor 6C2-like LOC100155932 __SEG__ Chr5 {Sus scrofa} MRNHSAIRTFVILGLTGDPQLEILAFIFLLIAYMFSVIGNLTIISLVLVDSHLKTAMYFFLQNFSFLEISFTTACVPTYLHIISSGDKTITISACFSQIFFIILFGATEF
FLLAVMSYDRYVAICKPLHYMSIMNSRVCRNLILCCWVSGLLIILPPFGLSLRLEFCDTVIDQFFCDASPILKNSCSDTWFIEQLIVFSGVLTLIVTLVCVVLSYIYIIG
TVLRFPSAQQRKKAFLTCSSHMIVVSMTYSSCIFMYIKPSAKDEVAINKGVSLLPTSVAPLLNPFIYTLRNKQVRQSFYDTFKRLANVSKKF*
143 >lcl|XP_001926303.3|Plus1156516..157307 NW_003534191 olfactory receptor 8J3-like LOC100154572 __SEG__ Chr1 {Sus scrofa} MARGNFMWVSELILTGFSEHPDLQLPLFFVVLVMYGLTMAGNLIIITLTSVDPRLQTPMYFFLRHLAIINLGNSTVIAPKMLTNVLVKRHTTSYYECATQVGGFLVFIVA
EVFMLAVMAYDRHVAIGNPLLYMVVVSQRICLLLDSLTYFYSFSTSVVTSSSVFSVAHCSSNVINHFCCDTGPLLALSCSDTSFPERVVFISAATNLVSSIIIVVVFYFN
IVLSILRICSTEGRKKGFSTCVSHMMAVSVFYGTLKGSFKIHF*
144 >lcl|XP_001926317.1|Plus1complement(114937..115884) NW_003534751 olfactory receptor 6C2-like LOC100154719 __SEG__ Chr5 {Sus scrofa} MKNHTAVTTFILLGLTDDPQLQVLIFIFLFLTYMLSVTGNVTIISLTLVDSHLKTPMYFFLRNFSFLEVSFTTVCIPRFLYSISTGDNTITYNACASQIFFVILFGATEF
FLLAAMSYDRYVAICKPLHYMSIMNSRVCTLLVLSCWMSGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAGPLLKISCSDTWVIEQMVILVAVFALIITLVCVFLSYTYII
RTILRFPSVQQRKKAFSTCSSHMIVVSMTYGSCIFIYVRPSAKEEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFNNSIKRITFLSKKSKF*
145 >lcl|XP_001926339.1|Plus1complement(129469..130410) NW_003534751 olfactory receptor 6C76-like LOC100153491 __SEG__ Chr5 {Sus scrofa} MRNRTSVTEFILLGLTDNPELQAVIFFFLLLTYVLSVTGNLTIIVLTLLHSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTGDKSISYNACAAQLFFFILLGSTEF
FLLASMSYDRYVAICKPLHYPTIMSHKVCYQLVGSSWLAGFLVIFPPLTMGLQLDFCDTNVIDHFTCDSAPLLHISCTDTSTLELMSFALAVLTLMSTLTLVILSYCYIL
RTMLRIPSAQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALTKGVAVLNTSVAPMLNPFIYTLRNQQVKQAFKDLTRKILSSKTLT*
146 >lcl|XP_001926373.1|Plus124164..25132 NW_003534167 olfactory receptor 1J4-like LOC100156904 __SEG__ Chr1 {Sus scrofa} MTTRNRTEVTEFVLLGLSIWPEMQPFIFGIVLIMYLVAVMGNSLLVIVALSDPKLQTPMYFLLSHLSFIDIFLTSITVPQMLAHMLSGNRTISFNCCMIQLFFFMAVGSM
EGHLLAAMAYDRYVAICDPLRYSAIISHRLCLRITLTSWVVVSLNSLLYSVLVTRLTFCGNQVTHFFCDITPLLKLSCTRPVVNEMLIFTEGVAVVVSPFFFILGSYTRI
GIAIAHMHSVAVLRKALSTCSSHILVVLLLYGSVIRMYLRPSSSYDLDQDCQVAIFYTVVTPMLNPLIYSLRNQEVKGALQRLFRKFCISGNFQLGSQAKRK*
147 >lcl|XP_001926389.1|Plus1complement(145727..146662) NW_003534751 olfactory receptor 6C76-like LOC100157543 __SEG__ Chr5 {Sus scrofa} MKNQTSVNEFILLGLTDDPELNVLIFLFLFFTYILSITGNLTIITLTLIDSHLKTPMYFFLRNFSFLEISFTTVCIPRFLVSIVTGDRAISYHSCMAQVFFFILLGATEF
FLLTAMSYDRYVAIWKPLHYMTIMNSRICNQLVVSSWLVGFLIIFPPVIMGLQLDFCDSNIIDHFTCDTSPMLLISCTDTAFLELMAFFLATFTLMVTITLVILSYAFIL
KTILRIPSAEQRKKAFSTCSSHIIVVSISYGSCIFMYVKTSAKEGMVMTKGIAVLNTSVAPMLNPFIYSLRNQQVKESFKKLVKKCFLDKF*
148 >lcl|XP_001926423.1|Plus1complement(1522577..1523611) NW_003299193 trace amine-associated receptor 6-like LOC100154422 __SEG__ Chr1 {Sus scrofa} MNSLSPSAAVQLCYENVNGSCVKAPYSPGSRLVLYTVFGCGALLAMLGNLLVMIAILHFKQLHSPTNFLIASLACADFLVGVTVMPFSMVRSVESCWYFGRSFCTFHTCC
DVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGLCISISWVLPLLYSGAVFYTGAYDDGLEELSSAVNCLGGCQTVVNQNWVLIDFLSFFIPTLVMIILYSNIF
LVARQQAKKIENTGGKTESSSDSYKSRVAKRERKAAKTLSITVITFMISWIPYSIDSLIDAFMGFITPAYIYEICCWCAYYNSAINPLIYALFYPWFRKAIKIIVSGQIF
KNDSASMNLFSGQM*
149 >lcl|XP_001926460.3|Plus1complement(172117..173052) NW_003534750 olfactory receptor 6C2-like LOC100153908 __SEG__ Chr5 {Sus scrofa} MRNHTTTTFILLGLTDDPRIKVLIFIFLFFTYMLSAAGNLTIISLTFIDCHLRTAMYFFLQNFSFLEISFTTACIPRFLYNIATGDKIITYAACAAQIFFTYLFGIMEFF
LLAIMSFDRYVAICKPLHYVTIMNNRVCNRLIISCWMAGLCIIIPPLSLGLNLEFCDSNVIDHFFCDATPLLKISCSDTRFIERMILVCAVLTFIMTLVCVVLSYIYIIM
TILRFSSSQQRKKAFLTCSSHMIVVSITYGSCIFIYIKPSAKKEVVLNKGVSLLISSISPTLNPFIYTLRNEQVKKALNDLIKRITFFFKK*
150 >lcl|XP_001926474.1|Plus1complement(294834..295772) NW_003534191 olfactory receptor 5M8-like LOC100152560 __SEG__ Chr1 {Sus scrofa} MRRNYTSLAEFILLGLTSRLELQVLFFVLFLGIYMVTVAGNLGMIVLIRVNVRLHTPMYFFLSHLSFVDLCFSSNVTPKMLGIFLAERKTISYPACLVQCYFFIALVHVE
IYILAVMAFDRYMAICNPLLYGSRMSKGVCTSLVMVPYVYGALTGLMETMWTYSLVFCGPNEINHFYCADPPLIKLACSDTYNKELSMFVVAGFNFTYSLLIILISYIYI
FPAILRVRSTEGRRKALSTCGSHLTAVTIFYVALFFMYLRPPSEESVEQGKIMAVFYTTVTPMLNPMIYSLRNKDVKEALIKELLNRRLFSK*
151 >lcl|XP_001926487.2|Plus1complement(29835..30779) NW_003534751 olfactory receptor 6C2-like LOC100152702 __SEG__ Chr5 {Sus scrofa} MRNQTITTFILLGLTDDPKLQVLIFAFLFVAYMLSLTGNLTIITLTFVDSHLKTPMYFFLKNFSFLEVSFISSCIPRYLYSIATGDKVITYNACAIQVFFTDLCGVTEFF
LLAAMSYDRYVAICKPLHYVTIMSSRVCGILISSCWMAGLCVLIPPLSLGLNLKFCDSNRIDHFGCDAFPLVKISCSDTWLMEQSVIICAVLTLNMTLTCVVLSYAYIIK
TIFRFPSVQQRKKAFSTCSSHMIVVSITYGTCIFIYMNPTAKGEVTIKKVVSLLIFSVSPTLNPFIYTLRNNQVKKAFKDSFKRIALLSTKQNK*
152 >lcl|XP_001926506.2|Plus1complement(40629..41567) NW_003534751 olfactory receptor 6C2-like LOC100157941 __SEG__ Chr5 {Sus scrofa} MRNHTSLSTFILLGLTDDPQMQLLIFLFLFVSYTLSITGNMTIIILTLVDSHLKTAMYFFLKHFSFLETLFTTVCIPRFLYSLSTGDKTISYNACAAQLFFVFLFGATEF
FLLAAMSYDRYVAICKPLHYATIMNSRVCGWLVSCCWIAGWLVIFPPLCLGLNLEFCDSNIIDHFVCDASPVLKISCSDTWFIEQMAVALAVLTDIMTLLCVVMSYTYII
KTIIKFPSAQQKMKAFSTCSSHLIVVSITYGSCIFIYVKPSAKDEVAINKCVSLLTTSVAPMLNPFIYTLRNKQVKRAFTDLIKRISLISKK*
153 >lcl|XP_001926540.2|Plus1complement(91847..92863) NW_003536326 olfactory receptor 13A1-like LOC100157349 __SEG__ Chr14 {Sus scrofa} MPPWAGLAVSQRLQGLTPQRTANNGTAVEEFVLQSFSEEPGPRILFLAMFLLLYLGALAGNALIVTAISLHPGLHTPMYFFLTNLAILDIVCTSTVVPKLLENLALKGGT
ITYQGCMTQLFFLTWCLGAELLLLTVMAYDRYVAICRPLHYSRLMGRPVCALLAGSVWAASVVSTSVHTGLMTRLTFCSHNQIQHFLCEIPTLLLLSCSPTTLNNVMMVL
ADVYFGVVNFLLTLASYAYIIASIVRMRSATGRQRAFSTCSSHLLVVTLYYSTVIYTYILPGSGSSLENGKVVAVLYTAVSPTLNPLIYSLRNKDVKVALGKVFSCIRGR
HGPCRLTG*
154 >lcl|XP_001926548.1|Plus1complement(161016..162485) NW_003301845 probable G-protein coupled receptor 101 GPR101 __SEG__ ChrX {Sus scrofa} MASTCTNSTRENNSSHACLPLSKMPISLAHGIIRSSVLLIFLTASFVGNIVLALVLQRKPQLLQVTNRFIFNLLVTDLLQISLVAPWVVATSMPLFWPLNSHFCTALVSL
THLFAFASVNTIVVVSVDRYLSIIHPLSYPAKMTPRRGYMLLYGTWIVAILQSTPPLYGWGQAAFDERNALCSMIWGASPSYTVLSVVSFIIIPLSVMIACYSVVFGAAR
RQHALLYNVKSHSLEVRAKDRVENENEKEGGKDAFQGESEFHGQGEGDVKAKEGSVEAEGSEEAREGSLAAGKGSTEGKEGGPTIESSKKADQGRAEVSQCSIDLGEDDV
EFGEEDINFNEEDIEAVNIPESLPASRRNSNGDPPLPRCYQCKAAKVIFLIIFSYVLSLGPYCFLAVLAVWVDVQTKVPQWVITIIIWLFFLQCCIHPYIYGYMHKTIKK
EIQDMLRKFFCKEKPRKEDSHPDLPGTEAGTEPGTEGKTVPSHDSATSP*
155 >lcl|XP_001926585.1|Plus195726..96667 NW_001886053 olfactory receptor 1J4-like LOC100152864 __SEG__ Chr1 {Sus scrofa} MRRENQSSISEFLLLGLPIQTEQQGLFFALFLGMYLTTMLGNLLIILLIRLDTRLHTPMYFFLSHLAFSDISFSSVTVPKMLMNMQTQDQSISYAGCIAQMYFFIFFTVL
DDFLLTSMAYDRYVAICHPLHYTTIMREGLCTLLVTVSWIHSSANALCHTLLLTQLSFCADNTIPHFFCDFGALLKLFCSDTSLNELVIFTVGLAVITLPLTCFLVSYGR
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFVPSSSASSPKDTISSVMYTVVTPLLNPFIYSLRNRDMKGALEKLFHKAAVLSQ*
156 >lcl|XP_001926600.2|Plus1194810..195748 NW_003534751 olfactory receptor 6C68-like LOC100151917 __SEG__ Chr5 {Sus scrofa} MGNHTAITTFILLGLTEDPQLQLLLFLFLFLTYILCVTGNLAIIILTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYNISTGDRTITYNACFIQLFFTDLFGITEF
FLLATMAYDRYVAICKPLHYTTIMSNTLCKTMVVCCWGAALLIILPPLSLDFQLEFCDSNLIDHFACDVSPLLKISCSDTWLIEQMVMACAVLTLIITLVGVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPMLNPFIYTLRNKQVKQAFQDSLKKTVFLLRK*
157 >lcl|XP_001926609.1|Plus116337..17275 NW_001886053 olfactory receptor 1J4-like LOC100158065 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPVPPEQKHVFFALFLGMYLTTMLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDQSIPYAGCVTQTYFFLIFTGL
DDFLLTSMAYDRYVAICHPLRYTSIMRGGLCTILVTVSWILSCANALCHTLLLAQLSFCSENTIPNFFCDLGALLKLSCSDTSLNDLVIFIAGVATIMLPLLCILVSYGH
IGATILKVPSTKGICKALSTCGSHLSVVLLYYGTIIGLYLVPSSSTSSNKDIVASVMYTVVTPLLNPFIYSLRNRDMKGALEKLFHKAPVLS*
158 >lcl|XP_001926616.1|Plus1complement(9213..10229) NW_001885567 olfactory receptor 13A1-like LOC100152524 __SEG__ Chr14 {Sus scrofa} MPPWAGLAVSQRLQGLTPQRTANNGTAVEEFVLQSFSEEPGPRILFLAMFLLLYLGALAGNALIVTAISLHPGLHTPMYFFLTNLAILDIVCTSTVVPKLLENLALKGGT
ITYQGCMTQLFFLTWCLGAELLLLTVMAYDRYVAICRPLHYSRLMGRPVCALLAGSVWAASVVSTSVHTGLMTRLTFCSHNQIQHFLCEIPTLLLLSCSPTTLNNVMMVL
ADVYFGVVNFLLTLASYAYIIASIVRMRSATGRQRAFSTCSSHLLVVTLYYSTVIYTYILPGSGSSLENGKVVAVLYTAVSPTLNPLIYSLRNKDVKVALGKVFSCIRGR
HGPCRLTG*
159 >lcl|XP_001926645.1|Plus176149..77090 NW_001886053 olfactory receptor 1J4-like LOC100156887 __SEG__ Chr1 {Sus scrofa} MRRENQSHVSELLLLGLPIQPEQQGVFFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTIPKMLKNMQTKKLSISYPGCISQVYFYILFGCV
DNLLLAVMAYDRYVAICHPLHYTSIMREGLCALLVTGCWIISCSSGLLHTLLLAQRSFCADNIIPHFFCSLPNLLKLSCSDTSLNELVIYTVGAAVVIFPLSGILISYGR
IGVSILRVPSTKGICKALSTCGSHLSVVSLFYGTVMAVYFSSSSDQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGLLFRNSNILAK*
160 >lcl|XP_001926655.2|Plus1209596..210534 NW_003534751 olfactory receptor 6C68-like LOC100154754 __SEG__ Chr5 {Sus scrofa} MRNHTAITTFILLGLTEDPQLQLLLFLFLFLTYILCVTGNLTIITLTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYDISTGDRTITYNACFTQLFFTYLFGITEF
FLLATMACDRYVAICKPLHYMTIMSNTLCKTMVVCCWGAALLIILPPLSLDFQLEFCDSNLIDHFACDVSPLLKISCSDTWLIEQMVIACAVLTFIITLVGVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPMLNPFIYTLRNKQVKQAFQDSLKKTALLLRK*
161 >lcl|XP_001926681.1|Plus127769..28860 NW_001885567 olfactory receptor 226-like LOC100154128 __SEG__ Chr14 {Sus scrofa} MSPGTNSSEVTEFILGGFPGSRGLHGGLLGLFLLAYLLTVTENLLIAAVICTSPLLHKPMYIFLGNLSFLEVGYVSVTVPKMLLSLAAPEFRRISFAGCMAQLYFFLALA
CTECTLLGVMAYDRYVAICRPLRYPAVMSPSLCSLLATGSWLSGFTVSMGKVFFISRLGYCGPNVVNHFFCDVSPLLNLACSDMSLAELVDFLLALLILLGPLLLTVSSY
CAIISAVLGIPSTAGRRKAFSTCASHLAVVLIFYSASLFIYARPRAVSSFDLHKLVSVVYTVLTPLLNPIIYCLRNREVKAALHRAGQRAAGALGTSSWDALWASSRPSP
GPPPGPTPGPLSYAPPARHPCTSSAADRPCADR*
162 >lcl|XP_001926789.1|Plus144872..45813 NW_001886057 olfactory receptor 1J2-like LOC100157267 __SEG__ Chr1 {Sus scrofa} MRWENQSSVSEFLLLGLPIQTEQQGVFFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYIFLSHLALTDVSFSSVTVPKMLMNIQTQNQSIPYAGCVTQMYFFIFFCCI
DNLLLAMMAYDRYVAICHPLHYTIIMREELCMCLLAGSWLFSCAYALTHTILLAQLSFCDDNIILQFFCDLAALLKLSCSDSSINELIIFSAGAAVVIFSLSCILLSYGQ
IVVSIRRVPSTKGICKALSTCGSHLSVVCLFYGTSTAVYFFSSSGQSHDEDIISSVMYTVVTPMLNPFIYSLRNRDMKLALGSIFRNNNLFVN*
163 >lcl|XP_001926821.1|Plus1953924..955039 NW_001885356 p2Y purinoceptor 1 P2RY1 __SEG__ Chr13 {Sus scrofa} MTEVLWQAVPNGTDAAFLAGLGPPWGNSTAASTAAVPFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYF
NKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAVYISVLVWLIVVVAISPILFYSGTGIRKNKTITCYDTTSDEYLRSYFIYSMCTT
VAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCVFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFR
RRLSRATRKASRRSEANLQSKSEDMTLNILSEFKQNGDTSL*
164 >lcl|XP_001926900.1|Plus1259004..259417 NW_003534672 bolA-like protein 1-like isoform 1 LOC100152975 __SEG__ Chr4 {Sus scrofa} MLSGQLVGRLFSMAGRVCLSRSSTGAGTIGPVEAAIRMKLEQALNPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHTALSEELAGPVHALAIQART
PAQWRENPQLDTSPPCLGGSKKTRGTP*
165 >lcl|XP_001926901.2|Plus1130922..131857 NW_003299923 olfactory receptor 6C2-like LOC100155931 __SEG__ Chr5 {Sus scrofa} MRNHTVTTFILLGLTDEPQLKTLVFIFLFLTYMLSVTGNLTIISLTSTDSHLKTAMYFFLQNFSFLEIAFTSACIPQYLYNIATGDKTITYNSCATQLFFTDLFAVTEFF
LLAAMSYDRYVAICKPLHYVTIVNHMVCRKLIIGSWLAGLLIIITPLSLGLKLEFCDSNVIDYFFCDLAPLLKISCSETWLIEQMVIVCAVLTFIMTLVCVVLSYVHILK
TILQFPSAQQRKKAFSTCSSHMIVVSISYGSCIFIYVKPSPKDSLAVNKGVTILTTSIAPMLNPFIYTLRNKQVKQAFNDAIKRIALFKKD*
166 >lcl|XP_001926928.2|Plus1240229..241143 NW_001886084 olfactory receptor 4C11-like LOC100153360 __SEG__ Chr1 {Sus scrofa} MQVNNSVNEFILSGLTQDALKEKLIFVIFLFLYLATLLANFLIVMTIRYSQTLRSPMYFFLFYLSFADACFSTTTAPRLIVDSISEKKIISYNECMTQIFAFHFFGCMEI
FVLILMSCDRYMAICKPLRYTTIMSQRVCGALVNLAWVGSCIHSLAQILLTLRLPFCGPNVIDHYFCDMQPLLKLACMDTYIINLHIVFNSGTICMVSFIMLFISYAFIL
HSLNKQSAEGRRKALSTCTSHIIVIILFYVPCIFTYARPLTIFPVDKMVAVFYTIGTPLLNPLVYTLRNAEVKNAMRKLWCNKF*
167 >lcl|XP_001926937.1|Plus182886..83839 NW_003534663 olfactory receptor 6N2-like LOC100157689 __SEG__ Chr4 {Sus scrofa} MEPYNLSSLAEFVLLGFPKVGHVRGWLFVLLLLAYLFTICGNMLIFLVIRLDAALHTPMYHFVSILSFLELWYTATTIPKMLANLLSDKKTISFSGCLLQTYFFHSLGAS
ECYLLTAMAYDRYLAICRPLHYPAIMTSALCAKMAAGCWTCGFLCPISEVILISQLPFCGYNEIQHIFCDFPPLLSLACKDTSINVLVDFAINAFIILITFLFIMVSYGR
IIGAVLKIKTTAGRKKAFSTCASHLSVVLIFFGSIIFMYVRLKKSYSLTLDQTLAVVYSVLTPLINPIIYSLRNKELIKAIRRTIFQKGERASPTHH*
168 >lcl|XP_001926940.3|Plus1113062..113997 NW_003299923 olfactory receptor 6C2-like LOC100153490 __SEG__ Chr5 {Sus scrofa} MRNHTIKTFILLGLTDDPRIKVLIFIFLFFTYMLSAAGNLTIISLTFIDCRLRTAMYFFLQNFSFLEISFTTACIPRFLYNIATGDKIITYAACAAQIFFTYLFGIMEFF
LLATMSFDRYVAICKPLHYVTIMNNRVCNRLIISCWMAGLCIIIPPLSLGLNLEFCDSNVIDHFFCDATPLLKISCSDTQFIERMILVCAVLTFIMTLVCVVLSYIYIIM
TVLRFSSSQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKKEVALNKGVSLLISSISPTLNPFIYTLRNKQVKKALNDLIKRITFFFKK*
169 >lcl|XP_001926957.1|Plus191817..92755 NW_003534663 olfactory receptor 6N1-like LOC100156472 __SEG__ Chr4 {Sus scrofa} MNAGNWSQVTEFIILGFPHVQGVQAYLFLLLLLIYLTTILGNLLIFLVVCLDSRLHIPMYRFVSILSLLELGYTAATVPKMLSNLLSEKKTISFSGCFLQIYFFHSLGAT
ECYLLTAMAYDRYLAICQPLHYPTRMTPALCVKIAVGCWLGGLAGPVAEISLVSQLPFCGPNRIQHIFCDFPPVLSLACTDTSINVLVDFVINACKILATFLLILSSYVQ
IIHTVLRIPSGAGKKKAFSTCASHLTVVLIFYVSILFMYVRLKKSYSLDYDRALAVVYSVLTPFLNPFIYSLRNKEIKEAVRRQAKRAGILE*
170 >lcl|XP_001926975.1|Plus1complement(103295..104326) NW_003534663 olfactory receptor 6K6-like LOC100155266 __SEG__ Chr4 {Sus scrofa} MKQFLIGNHHPNSRSFFVSFYLFPMTRLMASENQTTVTEFLFSMFPHLHEGGLLFFIPLLLIYGFIITGNLMIFIVIQLDMALHTPMYFFISVLSFLEIWYTTTTIPKML
SCLISEWKTISLAGCLMQMYFFHSLGITEGCVLTAMAIDRYIAICNPLRYPTIMTPKICIHLTAGAYLCGFLLVLPEIAWIATLPFCGSNQIQQIFCDFTPVLSLACTDT
SLVVIVDAIHAAEILASFLVIALSYIRIIMVILGMPSAEGRHKAFSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTAIAVIFVILAPFLNPIIYSLRNKDMKDAIGR
LFFCQNRAGGVQR*
171 >lcl|XP_001926988.2|Plus11385656..1390509 NW_003536227 RIMS-binding protein 3A RIMBP3 __SEG__ Chr14 {Sus scrofa} MTKDSPSPSGSGHATPKKLATPGPAAAALEEQRRELEKLRAELEAERARGRADRRRFAAEARQLKEAAERERQQLVDHLRSKWEAQRGRELRQLQEEVLREREAEIRQLL
RWKEAEMRQLQQLLHRERDGVVRQARELQRQLAEELVNRGYCSRVGAPEVAAAQCRCRLQDVLAQLRWETDGEQASRIRHLQAALDVERQLFLKYILEHFRGHPALSGAA
DPPVVPSSEEPSHETTAKSPHQLGSLDGGNAGARARSRSLDRVPAACSKSPDSLLPARASSLDSLARAHSCSLGSTLSRPKTPEASSPDTFIPGSPGPPPPPPPSEHRRP
GDMREGEESGSKPCEAPSPLPQGEDYRELVKRNSELSEALQVLARHCSVLLEENLQVRRAGFPDEAREKVKRLKVKHAELASLARRLEDRARKLQETNLRAVSAPVPGES
LAGLELCQAFARQRSRDLSEQASALLAKDKQIEELRQECHLLQARAASGLGSAPLPGGGAACAEWLSFSDLDRLQRESQREVLRLQRQLTLQQATSSGRAEAGGQSAPCE
EARRQVQALELELDARRRECEELGAQAAEARQGREDAEAQLQAALHEGAWLAKENARLQAQADWTRKVVAEDSEVHGQVGRTWQELENGGLLAGQLLQQTAQGQDRQQQL
QDDLQKALCDLQAAPEEMRTLQCQPAHPPQEPRKAPQATEPPGRNSRGTKLQSGPEDQTWSPPGRDKQEKEDFLLEKPVAPQEPARDPQEPDREPGSRARDSRPPAKKTS
STSNSSSEVESMWATVPSCPTLDTAREVEDLEPDSVSSTQEVGDSEAPATSKLRIFLARYSYNPFEGPNEHPESELPLTAGEYVFIFGDMDEDGFYEGELEDGRWGLVPS
NLVEQIPDPDILGCLPPAFPDLGPTRLLPGQGKALKEDTGKAGKAQGAVDRVPGHMARLGSKTELAREGSGTKTGDGWLGPQRSADEWGFSKPLLGARRVFCVPPMQLRL
QSVAATWAEITWVGSNHSHMVYLNDLESALTPAGVSCYTFHHLHPGTRYQAQVEVYLPQESLQGHWETMSSTITFNTPLAGPPDPPLDVLVEHHTSPGLLVVSWLPVTID
SVGSSNGVQVTGYAVYADGLKVAEVTDATAGSTLIECSQLQLPLMCQKVSVRTMSLYGESLDSVPAEIPHSCFPCDRLPKMSPFSYTCRDPSTCAVTFTLCPQRLVLSPL
SAKANPYAPGNCGEPQVKSLVAFPEEPQKRRSPMPMLNSEGECPCAGLGSQAQGPADAQGLCRKDLLFQKGPRNHGPPLPRGQEWREESHYQRHMGIKQSPSAGVIQLSP
EGGPGKEPFQEKAALDKIPKQMQNAPLPLGTSQQSVPDIYDILREEAGCFGLWGSEGQEQRKVPRRQSRRGLALGGKRERWPQEPSSSLCPALSSKVVRMSRGSAPPLGT
RADPTNIFVALSDYDPLGMSASPEAAEEELALRKGQLLRVWCSQDPHGFYRSEHDKQVGNIPGHLAAEVEADIDCTGTRWHLLGQGHPPSGAYLRDLGGLPSPQHSSPRS
QERPSLWTPKTMLAALDYDPRDGPAGGSVKGMLSLRAGDVVTVYGPVDDKGFYYGESGGHRGLIPAHLLDDMCFPRE*
172 >lcl|XP_001926995.1|Plus176038..76982 NW_003299923 olfactory receptor 6C2-like LOC100156333 __SEG__ Chr5 {Sus scrofa} MRNRTSLSTFILLGLTDDPQMQLLIFLFLFVSYTLSITGNLTIIILTLVDSRLKTAMYFFLKHFSFLETFFTTVCIPRFLYSLSTGDKTISYNACMAQLFFVFLFGATEF
FLLAAMSYDRYVAICKPLHYATIMNSRVCGWLVSCCWIAGWLVIFPPLCLGLNLEFCDSNIIDHFACDASPLLKISCSDTWFLEQMAVALAVLTGTMTFLCVVMSYTYII
KTIIKFPSAQQKMKAFSTCSSHLIVVFITFGSCIFIYVKPSAKDEVAINKGVSVLTTSVAPMLNPFIYTLRNKQVKRAFTDLIKRISLISKKEC*
173 >lcl|XP_001927079.2|Plus114527..15465 NW_003299923 olfactory receptor 6C68-like LOC100156758 __SEG__ Chr5 {Sus scrofa} MRNHTAITTFILLGLTEDPQLQLLLFLFLFLTYTLSVAGNLTIITLTLLDLRLKTPMYFFLQNFSLLEISFTTACIPRFLYNISTGDRTITYNACLTQIFSTDLFGITEF
FLLAAMAYDRYVAICKPLHYMTIMSNTLCKTMVVCCWGAALLIILPPFSLCFHLEFCDSNVIDHFTCDASTLLKISCSDTWLIEQMVIACAVLTLIITLVGVVLSYIYII
RTILKFPSAQQRKKAFSTCSSHMIVVSISYGSCIFIYIKPSAKEEVNLNKGVALLISSISPVLNPFIYTLRNKQVKLAFQDSLKKIAFLLRK*
174 >lcl|XP_001927104.3|Plus17738..8697 NW_003300307 olfactory receptor 4K14-like LOC100156196 __SEG__ Chr7 {Sus scrofa} LEQNLKPEIMDLQNYSLVSEFVLHGLCNSQHLQKLFFIFFSGIYVAMVLGNLIIVVTVISDPHLYSFPMYFLLGNLSFLNIWLASFATPKMIRDFLSDRKLISFGGCMAQ
IFFLHFVGGAEMVLLVTMAYDRYVAICKPLHYMTMMNRQTCIRLVSVSWAIGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACVDTYVLGVLMISDSGLLSMSC
FLLLLISYTVILITVQQQAAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFGWFSVDKVLSVFYTIFTPLLNPLIYTLRNKDMKIAMKRLRNQHVTFH*
175 >lcl|XP_001927118.2|Plus1complement(22146..23075) NW_003300307 olfactory receptor 4Q2-like LOC100154979 __SEG__ Chr7 {Sus scrofa} MDKNQTEVREFVLAGFSHRPYIEKGLFVLFLFFYVSTWVGNVLIMVTVASDKHLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFLDNEKLIPYDQCIMQLFFLHFVGAA
EMFLLTVMAYDRYVAICRPLHYTTIMSRGLCCALVAASWMGGFVHSTVQTILTIRLPFCGPKQVDNFFCDVPPVIKLACADTFVIELLMVSNSGLISTSSFVVLVSSYTT
ILVKIRSKEGRRKALSTCGSHLMVVTLFFGPCIFIYARPFSTFSVDKLVSVLYNVITPMLNPLIYTLRNKEVKSAMQKLWDRSGLTWKI*
176 >lcl|XP_001927132.1|Plus1complement(1072116..1073063) NW_003535812 protein sprouty homolog 2-like isoform 1 LOC100157266 __SEG__ Chr11 {Sus scrofa} MEARAQSGSGSQPLLQAPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSAQHKHERLNGLPEHRQPPRLQHSQAHVSVRASLSRS
ISTVSSGSRSSTRTSTSSNSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVC
CVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCRVPTVPPRNFEKPT*
177 >lcl|XP_001927161.2|Plus1721884..722822 NW_003299923 olfactory receptor 6C3-like LOC100154752 __SEG__ Chr5 {Sus scrofa} MENHTRVTMFILAGLNDDPQLKVVLCIFLLLTYLLSITGNLIIILLTLVDIHLKTPMYFFLRNFSFLEISFTTTSIPKFLVVMVTGDQTISYNNCIIQLFFVFLLGASEF
YLLAAMSYDRYVAICKPLHYTAIMNSKICIQLVLSCWLAGSFTIFVPLLLVLKLDFCASNIVDHFGCDITALLQISCSDTHLIETMGFVSAVVTLVVTLAVVIISYTYIV
LTILKLPSSNQRKKAFSTCSSHMIVISLSYGSCIFIYVKPSVKQRISFSKGIALLNTSVAPLLNPFIYSLRNQQVKKAFMNMIHRVASFLNK*
178 >lcl|XP_001927172.1|Plus1complement(708602..709573) NW_003299923 olfactory receptor 6C6-like LOC100153519 __SEG__ Chr5 {Sus scrofa} MKNRSIEIEFILLGLTDDPQLQIVIFLFLFVNYTLSLMGNVIIILLTLLDPRLKTPMYFFLRNFSFLEIIFTTVCIPRFLVTIVTKEKTISYNNCVAQLFFTLLLGVTEF
YLLAAMSYDRYVAICKPLHYPILMNSKVCYQLVFSSWVTGFLIIFPPLVMGLRLDFCASRVIDHFMCETSPILQISCTDTRVLELMSFILAVVTLVVTLILVILSYTYII
KNILKFPSTQQRTKAFSTCTSHMIVVSLTYGSCIFMYMKPSARERVTVSKGVALLYTSVAPLLNPFIYTLRNQQVKEVFWDMLQKMYFPKKTIIKRPKIITLP*
179 >lcl|XP_001927175.2|Plus1complement(104937..105872) NW_003300307 olfactory receptor 4K1-like LOC100155405 __SEG__ Chr7 {Sus scrofa} MAHTNESVVLEFVLLGLTNSWELQLFLFAIFSIVYVMSVLGNTMIIVIIASDSRLNSPMYFLLSNLSFIDICQSNFATPKMLVDFLVEHKTISFEGCMAQIFLLHSFVGS
EMMLLVAMAYDRFIAICKPLHYSTIMSRRLCIIFVFISWAVGILHSVSHLAFTVDLPFCGPNEVDSFFCDLPLVIELACMDTYKMEILTLTNSGLISLGCFLALIISYTV
ILISVHCRSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTVCTPLLNPIIYSLRNEDVQSAMHKWRNHHVNSWKY*
180 >lcl|XP_001927185.1|Plus1complement(116273..117241) NW_003300307 olfactory receptor 4K5-like LOC100154182 __SEG__ Chr7 {Sus scrofa} MDKVNSSVVSEFVLLGLSSSQELQLFFFVFFSVLYVVIVLGNLLIILMVTLDNRLHSPMYFLLGNLSFVDICQASFATPKMIVDFLSEHKTISFSGCIAQIFFIHLFTGG
EMVLLVSMAYDRYVAICKPLHYVIIMSQRTCIVLVMISWAVGLVHTLSQLSFTVNLPFCGPNVVDSFFCDLPRVAKLACLDSYIIEILIVVNSGILSLSTFSLLVSSYII
SLATVWFKSSAAMAKAFSTLAAHITVVILFFGPCIFIYVWPFTTYPVDKVLAIFYTIFTPILNPIIYTLRNRDMKTAMRKIMTYYLRPKKISEMPLVLRNSL*
181 >lcl|XP_001927194.2|Plus1complement(681959..682894) NW_003299923 olfactory receptor 6C2-like LOC100157581 __SEG__ Chr5 {Sus scrofa} MRNHSAVTTFIILGLTDDPQLEILVFIFLLITYLFSVIGNLTIISLVLVDYHLKTAMYFFLQNFSFLEISFTTACVPTYLHIISSGDKTITINACFSQIFFIALFGATEF
FLLTVMSYDRYVAICKPLHYMSIMNSRVCRNLILCCWVSGLLIILPPLGLSLHLEFCDSVIDHFVCDASPILKNSCSDTWFIEQLVIVCAVLTFLVTLVCVVLSYIYIIR
TILRFPSLQQRKKAFSTCSSHMIVVSMTYGSCIFMYIKPSAKDEVSINKGVSLLTTSVAPLLNPFIYTLRNKQVKQSFYDTLKRFVFHSKK*
182 >lcl|XP_001927196.2|Plus1206062..207003 NW_003299424 olfactory receptor 1J4-like LOC100154042 __SEG__ Chr1 {Sus scrofa} MRSQNQSIVSKFILLGLPIHPEQQGMFFALFLGIYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDQSIPYAGCVTQVYFFIFFACI
DNLLLAVMAYDRYVAICHPLRYTIIMREELCLCLLAGCWLLSCAYALTHTLLLAQLSFCADNIIPHFFCDLASLFKLSCSDTSLNELVIFSAGAAVFIFPLSGILVSYGR
IGISILRVPSTKGIFKALSTCGSHLSVVSLFYGTIMALYFSPSSGQSHDKGIIASVMYTVVTPMLNPFIYSLRNRDMTLALGIIFRNNNLFTT*
183 >lcl|XP_001927217.1|Plus1complement(150443..151396) NW_003300307 olfactory receptor 4K2-like LOC100156978 __SEG__ Chr7 {Sus scrofa} MDVANKSTVCEFVLLGLSNSWKLQMFFFVVFSVFYVATMVGNSLIVITVIADSHLHSPMYFLLANLSVIDMSLASFATPKMITDYLTGHRTISFDGCITQIFFLHLFTGT
EIILLMAMSFDRYIAICKPLRYASIISPQVCVALVMVSWVVGVMHSMSQVIFALTLPFCGPNEVDSFFCDLPVVFQLACVDTYLLGLFMISTSGIIALSCFILLFNSYVI
VLITIKKHSSKGSSKVLSTCTAHFIVVFMFFGPCIFIYMWPLSSFLIDKVLSVFYTIFTPILNPVTYTLRNQEVKTAMRKLKNKLLNSNKTMPLHYF*
184 >lcl|XP_001927233.1|Plus1complement(249160..250107) NW_003300307 olfactory receptor 4Q3-like LOC100155779 __SEG__ Chr7 {Sus scrofa} MRKENDSKVTEFVLLGLSSSWELQLFLFLIFVLLYMVIVLGNVLIMLTVWTDAYLLQLPMYFFLGHLSFLDLCLSCVTVPKMLGDFLQEGKVISFSGCLAQIYFLHFLGA
SEMLLLTVMAYDRYVAIGNPLHYLTVMNHQLCVQLVFACWCGGFIHSITQVTLVIQLPFCGPNELDNFYCDVPQVIKLACVDTYVIEVLMVSNSGLLSLICFLVLLFSYA
VILITLRTRFRQGRSKALSTCASHLTVVSLIFVPCVFIYLRPFCSFSVDKVFSVFYTVITPMLNPLIYTLRNADVKTAMKKLRKKHVTSCCHVKE*
185 >lcl|XP_001927243.1|Plus1<259647..260612 NW_003300307 olfactory receptor 11H12-like LOC100154563 __SEG__ Chr7 {Sus scrofa} LQVIDPMNVSEPDSSFAFVREFILLGFSCEWKIQILLFSLLLTTYALTITGNGAIVCALCCDRRLHIPMYMFLGNFSFLEIWYVSSTTPKMLINFLSDKKTISFVGCFLQ
FYFFFSLGTSESLLLAVMAFDRYLAICRPLHYPNLMTGHLCTKLVMTCWACGFLWFLIPIVLISQMSFCGSNIIDHVVCDPGPLFALACVSAPATQLLCYTLSSLVIIGN
FLFILGSYTLVLTAVLRMPSATGRHKAFSTCGSHLAVVSLFYGSLMVIYVSPGLGHSAAMQKVATLFYAMVTPLFNPFIYSFRNKEIKAALRKVLGSFSIF*
186 >lcl|XP_001927265.1|Plus1262341..263279 NW_003534663 olfactory receptor 10Z1-like LOC100154445 __SEG__ Chr4 {Sus scrofa} MGQTNATFWTGFVFLGFSSFGELQPLLFALFLSLYLVTLTSNVFIIVVIRLDSHLHTPMYLFLSFLSFSETCYTLGIIPRMLSSLVRGRQDISYVGCAVQMFFSASWACT
NCFLLAVMGFDRYVAICAPLHYASRMNPSLCAQLVGTSFLSGYLFGLGMTLVIFHLPFCRSHEIQHFFCDTPPVLSLACGDTSLSELGILLLSLLVLLVSFSFIAVSYTY
ILAAILRIPSTEGRKKAFSTCASHLTVVIVHYGCASFMYLRPKTIYSLKRDQLIAVTYTVVTPLLNPIIYSLRNRAVQTALRNAFRRRLLSK*
187 >lcl|XP_001927271.2|Plus1complement(1447245..1448333) NW_003536096 G-protein coupled receptor 15-like LOC100153787 __SEG__ Chr13 {Sus scrofa} METVMDPEATSVYLDYSYITSENPDIEEAPSHLPYTSVFLPIFYTAVFLIGVLGNLILMSALHFKRGSQRLIDIFIINLAASDFIFLITLPVWVDKERSLGLWRTGSFLC
KGSSYVISVNMHCSVFLLTCMSVDRYLAIVCPAISRKLRRRDCAYGVCASVWFISCLLGLPTLLSRELTLIDGKPYCAEKKATSIKLTWALVALIFTFFAPLVSMVTCYC
CITRKLCVRYQQSGRHNKKLRKSIKIIFIVVAAFVFSWLPFNTFKLLAIVSGLQQELHFSSAFLQWGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDF
GSSTETSDLTKALSNFIQGEDFARRRKRSVSL*
188 >lcl|XP_001927347.1|Plus1complement(440315..441970) NW_003536299 inositol 1,4,5-triphosphate receptor-interacting protein-like LOC100156217 __SEG__ Chr14 {Sus scrofa} MALGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRQMQAHQEKLQLEQLRLEEEVARLAAEKEALERVAEEGQQQNESRAAWDLWSTLCMILFLVIEVWRQDHQDG
PSPECLEEDELPGLDGAPLRGLTLPNKATLDHFYERCIRGATADAARTREFVEGFVDDLLEALRSLCSRDSDMEVEDFIGVDSMYENWQVNKPLLCDLFVPFMPPEPYHF
HPELWCSGRSVPLDRQGYGQIKVVRADEDTLGCICGKTKLGEDMLCLLHGKNSVMRRPGSEAGELLCAGDSPYLDTMRVMKWFQTALTKAWHCIAHKYEFDLAFGQLDTP
GSLKIKFRSGKFMPFNLIPVIQCDDSDLYFVSHLPREPFGNTPASSTDWLLSFAVYERHFLRMTSKALPEGSCHLSCLQIVSFLLSKQSRLTGPSGLGNYHLKTALLHLL
LARRPTDWKAGHLDARLHEMLCFLEKSLLEKKLHHFFIGNRKVPEALGLPEAVRRAEPLNLFRPFVLQRSLYRKTVDSFYEMLKNAPVLISEYSLHIPSDHSSLPQKAVI
S*
189 >lcl|XP_001927351.1|Plus1complement(373026..374015) NW_003535236 olfactory receptor 11G2-like LOC100155522 __SEG__ Chr7 {Sus scrofa} MPVHTHLIFAGPFTAPRHMNISNTPSNSSTITGFILLGFPCSRHGQILLFLLFAGVYLLTLMGNGSIICAVRWDQRLHTPMYILLANFSFLEISYVTSTVPNMLANLLSD
NKVISFSGCFLQFYFFFSLGSTECFFLAIMAFDRYLAICRPLQYPTLMTARLCTNLVVSCWVLGFLWFLIPIIIVSQMSFCGSRIIDHFLCDPSPLLALTCKKAPVIELL
FSTLNPVPMIILFTLIMGSYALVLRAVFKLPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSPTSEHGAGMQKIVTLFYSVITPLLNPMIYSLRNKDMKKAMQKFLKL*
190 >lcl|XP_001927355.1|Plus1243119..244213 NW_003301250 testis-specific serine/threonine-protein kinase 1-like LOC100157922 __SEG__ Chr14 {Sus scrofa} MDDAAVLKRRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRKKAPTDFLEKFLPREIEILAMLNHRSIVKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALQE
DDARKKFHQLSSAIKYCHDMDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLTLSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSN
IKKMLRIQKEHRVNFPRSKHLTGECKDLIYRMLQPDVNRRLHIDEVLSHCWVQPKARGLSSAAINKEGESSQGSELPWPPEPSSDKKSATKLEPREEARPDTNPEEEVLQ
MQVSRQSEATGLASEQPSKETEEGAPLQPSETHT*
191 >lcl|XP_001927425.1|Plus1113570..114493 NW_001885251 olfactory receptor 5K3-like LOC100153406 __SEG__ Chr13 {Sus scrofa} MTGENQSLSIEFILTGFTHLSELRTLLFLVFLTIYLITMVGNLGLVALICTEHHLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSKDRIISLYECMAQWYFLCLAETT
DCFLLAAMAYDRYVAICNPLQYHTMMSRKHCLRMTTGAYLAGNLHSMIHVGLLFRLTFCRSHQINHFFCDVLPLFRLSCVDPYINKLMLLIIAGFIQIFTVITVIISYLF
ILFTIFTMKSTKGRGKALSTCASHFLSVAIFYGSLLFMYIRPNSLNEEDKDLPLGVFYTVVIPLLNPFIYSLRNKEVINVMKKIIKI*
192 >lcl|XP_001927443.1|Plus1373309..374253 NW_003535164 olfactory receptor 2G6-like LOC100155751 __SEG__ Chr7 {Sus scrofa} MERANDSTFSGFILLGFSNRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCLTTCTVPQTVANFKGKDKSITYGGCVTQLFVALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGSSIVQTALTMTLPLCGKNQVDHFLCEVPAMLKLACTNTSINEAELFAVSVLFLVVPLSLILVSYGH
ITHAVLKIKSAQGRHKAFGTCGSHSMVVTVFFGTLISMYLQLPSSYSQDVNKSMALFYTLVTPLLNPLIYTLRNNEVKGALRRLVRRTPDLRQS*
193 >lcl|XP_001927452.1|Plus1383843..384781 NW_003535164 putative olfactory receptor 2B8-like LOC100154533 __SEG__ Chr7 {Sus scrofa} MEQKNGTSFTGFILLGFSDRPQLEQVLFVVLLIFYVFTLLANTAIISLSHADPHLHTPMYFFLSNLSFVDLCYTTSIVPQLLVNLRGSDKSISFGGCVVQLYISLGLGCA
ECILLGVMALDRYAAVCKPLHYTVIMHPRLCTLMACASWIIGFADSLIQTVLIFLLPLCGRNELDHFFCEVPPLLKLACVDTAMNESELFFASVITLFVPVALIMFSYSQ
IVRAVLRIKSSAGQRKAFGTCGSHLTVVSLFYGSALYAYLQPSNKDSKDQAKFISLFYTIIIPMINPLIYTLRNKEVKGAMRRVLWKDTASR*
194 >lcl|XP_001927458.1|Plus1complement(391882..392826) NW_003535164 olfactory receptor 2G6-like LOC100153320 __SEG__ Chr7 {Sus scrofa} MERANDSTFSGFILLGFSNRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCFTTCTVPQTVANFKGKDKSITYGGCVTQLFIALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGSSIVQTALTMTLPLCGKNQVDHFFCEVPAMLKLACTNTSINEAELFAVSVLFLVVPLSLILVSYGH
ITHAVLKIKSAQGRHKAFGTCGSHSMVVTVFFGTLISMYLQLPSSYSQDVNKSMALFYTLVTPLLNPLIYTLRNNEVKGALRRLVRRTPDLRQS*
195 >lcl|XP_001927467.1|Plus1411522..412460 NW_003535164 putative olfactory receptor 2B8-like LOC100152127 __SEG__ Chr7 {Sus scrofa} MEQRNGSSFTGFILLGFSDRPQLEQVLFVVLLIFYVFTLLANTAIIALSHMDSHLHTPMYFFLSNLSFVDLCYTTSIVPQLLVNLRGSDKSISFGGCVVQLYISLGLGCA
ECILLGVMALDRYAAVCKPLHYTVIMHPRLCTLMACASWITGFANSVLQTVLIFLLPLCGRNELDHFFCEVPPLLKLACVDTTVNESEIFFVSVIILFIPVAVIMFSYSQ
IVRALLRIKSSAGQRKAFGTCGSHLTVVSLFYGSALYAYLHPSSNDSQDQGKFISLFYTIVTPMINPLIYTLRNKEVKGAMRRVLWKDSASR*
196 >lcl|XP_001927471.1|Plus1752930..753799 NW_003536796 OTU domain-containing protein 6A-like LOC100153003 __SEG__ ChrX {Sus scrofa} MEDSQSEHQRMIRRHNREKKELQARIQSMKNSVPRSDKKRRKQMLLDVARLEAEMEQKHQQELEKFQESFPGNLDSVTEDLAKMDLENQPPRPSRAQRRRERRAALARER
QERIAEAEMEHLASFRKDEEEKLRAILGAKNLEMKDIPADGHCMYRAIQDQLVFSVTVESLRRRTAEYMQKHVDDFLPFFSDPETGDSYSRDDFLSYCDDIVRSASWGGQ
LELRALSHILQTPIEVIQANSPAVVIGEEYTKRPLILVYMRYACSLGEHYNSVKPLEAGAVGGAPPRLF*
197 >lcl|XP_001927473.1|Plus1101392..102336 NW_003535165 olfactory receptor 2G6-like LOC100157348 __SEG__ Chr7 {Sus scrofa} MERANDSTFSGFILLGFSSRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCLTTCTVPQTVANFKGKDKSITYGGCVTQLFVALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGNSIVQTALTMTLPLCGKNQVDHFFCEVPAMLKLACTNTSINEAELFAVSVLFLVVPLSLILVSYGH
ITHAVLKIKSAQGRRKAFGTCGSHSMVVIVFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLMNPLIYTLRNNEVKGALRRLVRRTPDLRQS*
198 >lcl|XP_001927476.1|Plus1complement(466094..467353) NW_003299234 trophoblast glycoprotein-like LOC100158028 __SEG__ Chr1 {Sus scrofa} MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSLTSSASSTSSASFPASAASALPPLPGRCPQPCECSEAARTVKCVGRNLTEVPADLPPYVRTLFLTGNQLAVLPTGAF
ARRPPLAELSALNLSGSRLTEVQAGAFEHLPSLRLLDLSHNPLANLSAFAFSGSNASVAAPSPLVDLILNHIVTSAAQRQNRSFEGMVAAALRAGHALRGLRRLELASNH
LLYLPLDVLAQLPDLRHLDLRNNSLVSLTYVFFRNLTHLESFHLEDNALKVLHNGTLAELQSLPHVRVFLDDNPWVCDCHLADMVAWLKETEVVQDKARLTCAFPEKMRH
RVLLELNSSDLDCDPDLPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
199 >lcl|XP_001927484.1|Plus1complement(106184..107122) NW_003535165 putative olfactory receptor 2B8-like LOC100156143 __SEG__ Chr7 {Sus scrofa} MEQKNESSFTGFILLGFSDRPQLEQVLFVALLIFYIFTLLGNSTIIVLSHVDPQLHTPMYFFLSNLSFVDLCYTTSIVPQLLVNLSGSDKFISFGGCVVQLYISLGLGCT
ECILLGVMALDRYAAVCKPLHYTVIMHPRLCALMACASWIIGFANSLLETVLTFLLPFCGRNELDHFFCEVPPLLKLACVDTSMNESELFFVSVIILLVPVALIMFSYSQ
IVRAVLRIRSTVGQRKAFGTCGSHLTVVSLFYGTAIYAYLQPSNNYSQDQGKFISLFYTIITPMINPFIYTLRNKEVKGAMRRVLWKDSASR*
200 >lcl|XP_001927485.1|Plus1130171..131106 NW_003535237 olfactory receptor 4N5-like LOC100152712 __SEG__ Chr7 {Sus scrofa} MERENNTVVTEFILLGLTQSQGTQLLVFTLVLIFYLIILPGNFLIILTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFFGAG
EMFLLVVMAFDRYIAICRPLHYSTIMNPRACYALLMALWLGGFTHSIVQVALILYLPFCGPNQLDNFFCDVPQVIKLACTNTFVVELLMVSNSGLLTLLCFLGLLASYAV
ILCHVKGHSSEGKNKALSTCTTHIIIVFLMFGPAIFIYTRPFRASPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRRLLSQHTVCWMQ*
201 >lcl|XP_001927495.2|Plus189813..90751 NW_003535165 putative olfactory receptor 2B8-like LOC100154932 __SEG__ Chr7 {Sus scrofa} MEQRNGSSFTGFILLGFSDRPQLEQVLFVVLLIFYVFTLLANTTIITLSQVDPQLHTPMYFFLSNLSFVDLCYTTSIVPQLLVNLRGSDKSISFGGCVVQLYISLGLGCA
ECILLGVMALDRYAAVCKPLHYTVIMHPRLCTLMACASWIIGFADSLIHTVLIFLLPLCGRNELDHFFCEVPPLLKLACVDTSMNESEIFFASVIILFIPVTLIMFSYGG
IVRAVLRIKSSAGQRKAFGTCGSHLTVVSLFYGSALYAYLHPSSNDSQDQAKFISLFYTIIIPMINPLIYTLRNKEVKGAIRRVLWRDTASR*
202 >lcl|XP_001927498.2|Plus1<113886..114743 NW_003535237 olfactory receptor 4L1-like LOC100157955 __SEG__ Chr7 {Sus scrofa} FAIFTLVYVAIIVGNLLIVISVISDNHLHSPMYFFLANLSFFDLCLSSTATPKVILDFFREHNTISWWDCMTQMFFMHFFGGGEMSLLIAMAIDRYVAICKPLHYKTIMS
HKVLIVFLLLSWAVGFIHTTSQMVFTMGLPFCGPNTVDSIFCDPPLVIRFACTDTYFLELLVIVNSGLLSLVCFVLLLISYTVMLVTIWQHSSSASSKALSTLSAHITVV
TLFFGPAIFVYAFPFNSYSVDKFLSVFYSMITPLLNPIIYTLRNQEMKAAIKRLSRQHIGSCLIH*
203 >lcl|XP_001927535.1|Plus1204012..204968 NW_003535165 olfactory receptor 2G6-like LOC100157759 __SEG__ Chr7 {Sus scrofa} MERANDSIFSGFILLGFSSRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCLTTCTVPQTVANFKGKDKSITYGGCVTQLFLALGLGGV
ECVLLSVMVYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGSSIVQTALTMTLPLCGKNQVDHFFCEVPAMLKLACTNTSINEAEVFVVSVLFLVVPLSLILVSYGH
ITHAVLKIKSAQGRRKAFGTCGSHLMVVTVFFGTLISMYLQPPSSYSQDVNKSMALFYTLVTPLLNPLIYTLRNKEVKGALRRLVRRTPGLRQMGCHC*
204 >lcl|XP_001927549.3|Plus121171..22100 NW_003534191 olfactory receptor 8I2-like LOC100155816 __SEG__ Chr1 {Sus scrofa} MTGNNFTEVTFFILSGFANRTELQIRLFLMFLFIYLFTVLGNLGLIVLIKIDSQLHTPMYFFLSNLAFIDIFYSSTVTPKALVNFLSKQKTISFIGCFVQMYFFVGLVCS
ECFLLGSMAYDRYVAICNPLLYSVVMSQKGCYWRLATTYTVGFSNSLISICVISSLAFCDISINHFFCDTTALLALSCVDIFSTERVIFVLAGFTVLSSLFIIITTYIAI
ISAILKIRSAAGRQAFSTCASHLMGVAIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNALLRVMQRKHFA*
205 >lcl|XP_001927579.2|Plus1complement(47590..48522) NW_003535238 olfactory receptor 4Q2-like LOC100155907 __SEG__ Chr7 {Sus scrofa} MDKNQTEEVREFVLAGFSHRPHIEKGLFVLFLFFYVSTWVGNVLIMVTVASDKHLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFLDNEKLIPYDQCIMQLFFLHFVGA
AEMFLLTVMAYDRYVAICRPLHYTTIMSRGLCCALVAASWMGGFVHSTVQTILTIHLPFCGPKQVDNFFCDVPPVIKLACGDTFVIELLMVSNSGLISTSSFVVLVSSYT
TILVKIRSKEGRRKALSTCGSHLMVVTLFFGPCIFIYARPFSTFSVDKLVSVLYNVITPMLNPLIYTLRNKEVKSAMQKLWDRSGLTWKI*
206 >lcl|XP_001927604.1|Plus1complement(116124..117059) NW_003535238 olfactory receptor 4K1-like LOC100157512 __SEG__ Chr7 {Sus scrofa} MAHTNESVVLEFVLLGLTNSWELQLFLFAIFSIVYVTSVLGNTMIIVIIASDSRLNSPMYFLLGNLSFIDICQSNFATPKMLVDFLVEHKTISFEGCMAQIFLLHSFVGS
EMMLLVAMAYDRFIAICKPLHYSTIMSHRLCIIFVFISWAVGILHSVSHLAFTVDLPFCGPNEVDSFFCDLPLVIELACMDTYKIEILTLTNSGLISLGCFLALIISYTV
ILITVHRWSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRHSVDKFLSVFYTVCTPLLNPIIYSLRNEDVQSAMHKWRNRHVNSWKY*
207 >lcl|XP_001927613.1|Plus1complement(126010..126978) NW_003535238 olfactory receptor 4K5-like LOC100156304 __SEG__ Chr7 {Sus scrofa} MDKVNSSVVSEFVLLGLSSSQELQLFFFVFFSVLYVVIVLGNLLIILMVTLDNSSHSPMYFLLGNLSFVDICQASFATPKMIVDFLSEHKTISFSGCIAQIFFIHLFTAG
QMVLLVSIAYDRYVAICKPLHYVIIKSQRTCIVLVMISWAVGLVHTLSQLSFTMNLPFCGPNVVDSFFCDLPRVAKLAYLDSYITEILIVVNSGILSLSTFSLLVSSYII
SLATVWFKSSAAMAKAFSTLAAHITVVILFFGPCIFIYVWPFTTYPVDKVLAIFYTIFTPILNPIIYTLRNRGMKTAMRKIMMYYLRPKKISEMPLVLRNSL*
208 >lcl|XP_001927650.1|Plus1complement(157837..158790) NW_003535238 olfactory receptor 4K2-like LOC100156728 __SEG__ Chr7 {Sus scrofa} MDVANKSTVCEFVLLGLSNSWKLQMFFFVVFSVFYVATMVGNSLIIITVIADSHLHSPMYFLLANLSIIDMSLASFAAPKMITDYLTGHRNISFDGCIIQIFFLHLFTST
EIILLMAMSFDRYTAICKPLRYASIISPQVCVALVMVSWVVGVMHSMSQVIFALTLPFCGPNEVYSFLCDLPVVFQLACVDTYVLGLFMISASGIIALSCFILLFNSYAI
VLVTIKKHSSKGSSKVLSTCTAHFIVVFMFFGPCIFIYMWSLSSFLIDKVLSVFYTIFTPILNPVTYTLRNQEVKTAMRKLKNKLLNSNKTMPLHYF*
209 >lcl|XP_001927676.3|Plus111284..13266 NW_003535285 leucine-rich repeat transmembrane protein FLRT2 FLRT2 __SEG__ Chr7 {Sus scrofa} MGRQTTRGPSQGAFFLKAWLLLSLGLSSQVSQLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHSVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRVLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKHIPA
SLNVRGFMCQGPEQVRGMAVRELNLNLLSCPTTTPGLPRVTLAPSPASPPTQPPTLSVPTLSRSSTPVTPTASKVPTHPDWDGRDRVTPPLSDRVQLSIHFVNDTSIQVS
WLSVFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
*
210 >lcl|XP_001927677.3|Plus1complement(27256..29343) NW_003535816 SLIT and NTRK-like protein 1 SLITRK1 __SEG__ Chr11 {Sus scrofa} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPSKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGGR
NKPPANSLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSRE
KFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSEV
LMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASEI
NSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
211 >lcl|XP_001927692.3|Plus162754..63701 NW_003534191 olfactory receptor 8K3-like LOC100154600 __SEG__ Chr1 {Sus scrofa} MDKWNQTVLSEFILMGITDLRELQAPFFGLFLSIYAISVVSNLGMIILTKVDSGLQTPMYFFLRHLAFIDLGYSTAVGPKMLVNFVADRNTISCHWCAIQLTFFILFIIS
ELFILSAMAYDRYVAICHPLRYTAVMSQRVCWVLVAVPYLYSVFPSLITTIKIFISSFCGYNIIRHFYCDSLPLLALLCSSTLEIELFIQICSVFNLVSSLLIVLVSYIL
ILKAILRMNTAQGRHKAFSTCGSHLTVVIVLYATLSFMYMQPKSSHSFDTDKMASVFYTLVIPMLNPMIYSLRNKEVKGALRRIWKNLHKHPIRN*
212 >lcl|XP_001927724.1|Plus1103458..104399 NW_003534191 olfactory receptor 8K3-like LOC100152197 __SEG__ Chr1 {Sus scrofa} MEKHNQTVMSEFILMGITDHPELQAPLFGLFLLIYMISVGGNLGMVILTKVDARLQTPMYFFLRHLSLTDLGYSTTVGPKMLESFVVAQNTISYYFCAIQGAFYIMFIVS
ELYILSAMSYDRYVAICHPLLYTIMMSQRVCHMLLAFPYFYSIVVSLSITVKIFNSSFCGYNVVSHFYCDCLSLLSLLCSNTYDIEMIILVFSVFNLILSFPMVLVSYFL
ILVTIFRMNSAGGRHKALSTCGSHLSAITVFYGTLLFMYLQPKSHHSFDTDKVASIFYTLITPMLNPLIYSLRNKDIKYALHKIWTKIHHIFS*
213 >lcl|XP_001927746.1|Plus1133786..134727 NW_003534191 olfactory receptor 8K3-like LOC100157368 __SEG__ Chr1 {Sus scrofa} METENLTTLNEFILMGITDRPELQAPLFGLFLLIYVISVVGNLGMVILTKVDSRLQTPMYFFVRHLAFTDLGCSTTVGPKMLVNFVVDRNAIPYYSCATQLAFFIVFIIS
EHFILSAMSYDRYVAICHPLLYPVIMSQKVCWVLVAIPYLYSTFVSLLISIKIFNLSFCGYGVIRHFYCDIFPLLSLLCSNTHEVELIILISAGFNLISSLLIVLVSYLF
ILEAILRMNSAEGRHKAFSTCGSHLTVVTVFYGTLIFMYVQPESSHSFDTDKVASIFYTLIIPMLNSLIYSLRNKDVNCAIQRMWKKLCNFFS*
214 >lcl|XP_001927754.1|Plus1354370..355308 NW_003535238 olfactory receptor 4F6-like LOC100152710 __SEG__ Chr7 {Sus scrofa} MDQTNSSVVTEFVLVGLTQSLGMQFLLFLLFSTFYVGIILGNLFIVFTVISDSHLHSPMYILLANLSLIDLGLSSTTVPRMISDLFSDCKTISFHNCMIQMFFIHVTGGV
EMVLLIVMAYDRYTAICKPLHYLTIMNPQMCMLLVVAAWITGVTHAVFQFAFVINLPFCGPNNVGSFYCDFPRVIKLACIDNYGLEFVVTANSGFISMGTFFLLIVSYIF
ILVTVRQHSSKDLSKAFFTLSNHITVVFLFFLPCMFLYVWPFPTKSLDTFFAIVDFAVTPVLNPAIYTLRNRDMKVAIRRLSRQVVSSREMT*
215 >lcl|XP_001927768.2|Plus1complement(800561..801679) NW_003535232 leukotriene B4 receptor 2-like LOC100156094 __SEG__ Chr7 {Sus scrofa} MRPMALSRPRGRRRMPLCYRPPGNETLLSWKTSRTTGTAFLLLAALLGLPGNGFVVWSLAGWRPAGGRPLAATLVLHLALADGAVLLLTPFFVAFLTGQAWPLGQAGCKA
VYYVCTLSMYASVLLTSLLSLQRCLAVTRPFLAPRLRSPVLARRLLLAVWLAALVLAIPAAVYRHLWADRVCQLCHPSPAHAAAHLSLETLTAFVLPFGLVLCCYGVTLA
RLWGARWGAGRHGARVGRLVGAIVLAFGLLWAPYHAVNVLQAVAALAPPGGTFAKLGGAGQAARAGTTALAFFSSSVNPLLYLFTAGDLLPRAGPRFLTRLFEGSGEARG
GGRSREGTLELRATPRLKVVGQGHGNGDPGGGAEKDSQGWDP*
216 >lcl|XP_001927813.1|Plus1complement(649585..650664) NW_003535758 protein mab-21-like 1 MAB21L1 __SEG__ Chr11 {Sus scrofa} MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAG
KQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALENAAKQTWRLAREILTNPKSLEKL*
217 >lcl|XP_001927821.1|Plus1complement(2204474..2206393) NW_003535175 zinc finger and BTB domain-containing protein 22 ZBTB22 __SEG__ Chr7 {Sus scrofa} MEPSPMSPGGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASATTTTVTTAAATSVTVPGAGVPPGSGGSVAPAAVGSVRSHASSRASENQSPSSSNYFSPRESTDFSS
SSQEAFAASAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPVYAPPSIVPQKHWVYVKRGGTCPAPAPLAPQDPDLEEDEEEEDLV
LTCEDDEDEELGGGSHVPPGGEPETTLSISDVRTLSEPPDKGEEQVNFCESSNDFGPYESGGPGGGLEDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFPSSSSTSSSS
SQAPGQPPGNQTEHGAVTLGGASAGALGMPGGTGGTPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCA
KKFMWRDSFMRHRGHCERRHRLGGGGAGAGAGAGPGGPTGPAVQPKRESPGRGSGDEASGTTPPPSRRVWSPPSVHKVEMGFGGGGGAN*
218 >lcl|XP_001927859.1|Plus1complement(9026..9967) NW_003535239 putative olfactory receptor GPCRLTM7-like LOC100156727 __SEG__ Chr7 {Sus scrofa} MNGANQSVVSEFVFLGLSNSWEIQLLLFCFSCLFYVSSMMGNLLIVVTVSSDPYLHSPMYFLLANLSIIDLIFCSIAAPKMICDLFRKQKVISFGGCIAQIFFSHAAGGT
EMVLLIAMSYDRYVAICKPLHYLSLMSPQTCILIVVVAWIIGLTHSLAQLAFVVSLPFCGPNVLDSFYCDLPRLIRLACTDTYNLEFMITANSGFISLGAFFLLILSYIF
ILATLQKHSSGGSSKALSTLTAHIIVVVLFFVPLIFFYMWPSPSTHLDKFLAMFDAVLTPFLNPIIYTLRNREMKTAVRRMFCQLMSFRKINK*
219 >lcl|XP_001927864.1|Plus147899..48837 NW_003535239 olfactory receptor 4F6-like LOC100155519 __SEG__ Chr7 {Sus scrofa} MDEANHSVVSEFVFLGLSDSWEIQLLLFLFSSVFYVASLMGNLLIVFSVTSDPRLHSPMYFLLANLSIIDLIFCSSTVPKMIYDLLRKDKTISFGGCVVQIFFIHAVGGT
KMVLLISMAYDRYVAICKPLHYLSIMNPRRCILFLVTSWIIGLIHSVTQLAFVVDLPFCGPNELDSFFCDLPRFTKLACIETYTLGFMVTANSGFISVASFLILIISYIF
IFVTVWKRSSGGVSKAFSTLSAHVTVVVLFFGPLIFFYMWPFPISHVDKFLAIFDAVITPFLNPIIYTLRNKEMKVAMRRLCTQFVNDSKIS*
220 >lcl|XP_001927931.1|Plus1177467..178423 NW_003535239 olfactory receptor 4F3/4F16/4F29-like LOC100156339 __SEG__ Chr7 {Sus scrofa} MSTKPKEGENNSVVSEFVFLGITNSWEIQLLLSVFTSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKRKVISFSGCITQIFFIH
VIGGVEMVLLIAMAFDRYVAICKPLHYLTIMSPRLCIFLLVAAWIIGLVHSTVQLASVVNLPFCGPNVLDSFYCDLPRFIKLACVDTDQLEFMVTANSGLISVGSFFILI
ISYIVIILTVKKQCSVGSSKALSTLSAHITVVILFFGPLIFFYMWPFPSTPLDKFLAIFDAVLTPSLNPIIYTFRNQEMKVSMRRVCRQLVNYRRSLK*
221 >lcl|XP_001927941.1|Plus18883..9824 NW_003535240 olfactory receptor 4F21-like LOC100155127 __SEG__ Chr7 {Sus scrofa} MDRVNYSVVSEFVLIGLSNSWEMNLFLFWFFLVFYVGIILGNLFIVFTVIIDSHLHSPMYFLLANLSLLDLGLSSTTVPKMISDLLTNCNVISFPKCMTQIFFIHVMGGV
EMVLLIAMAYDRYTAICKPLHYLSVMSRKMCVSFVVAAWMVEIIHAVSQFVFVINLPFCGPDKVDSFYCDFPRIMKLACVDTYKLEFVIIANSGFISMATFFSLIISYIF
ILVTVWKRSSGDLSKAFVTLSAHITVVILFFMPCMFLYVWPFPTTSLDKYFFIVDFAITPVLNPAIYTLRNKDMRVAMKRLGKQISGYRGISQ*
222 >lcl|XP_001927948.1|Plus127798..28736 NW_003535240 olfactory receptor 4F6-like LOC100152708 __SEG__ Chr7 {Sus scrofa} MDQTNSSVVTEFVLVGLTQSLGMQFLLFLLFSTFYVGIILGNLFIVFTVISDSHLHSPMYILLANLSLIDLGLSSTTVPRMISDLFSDCKTISFHNCMIQMFFIHVTGGV
EMVLLIAIAYDRYTAICKPLHYLTIMNPQMCMLLVVAAWITGVTHAVFQFAFVINLPFCGPNNVGSFYCDFPRVIKLACIDNYGLEFVVTANSGFLSTGTFFLLVVSYIF
ILVTVRQHSSKDLSKAFFTLSTHITVVFLFFLPCMFLYVWPFPTKSLDTFLAIVDFAVTPVLNPAIYTLRNRDMKVEMRRLSRQVISSREMT*
223 >lcl|XP_001927961.1|Plus1complement(70883..71833) NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100156766 __SEG__ Chr7 {Sus scrofa} MDGWNHSVVSEFVFLGLTDSWEIQLLLLVFSSVLYLASMTGNILIVFSVTTDPHLHSPMYFLLAGLSFTDLGACSVTSPKMIYDLFRKCKVISFGGCIAQIFFIHVVGGV
EMVLLIAMAFDRYVAICKPLHYQTIMSPRMCLLFLAAAWALGVSHSLFQLAFVVNLPFCGPNVLDSFYCDLPRLLRLACMDTYRLQFMVTVNSGFICVGSFFTLLISYIF
ILFTVWKHSSGGSSKALSTLSAHVTVVLLFFGPTLFVYTWPHPNSQMDKFLALSDTVLTPFLNPVIYTFRNKEMKAAMKRVCKQLVMYRKISQMLC*
224 >lcl|XP_001927999.1|Plus1complement(403192..404133) NW_003535240 olfactory receptor 4L1-like LOC100154761 __SEG__ Chr7 {Sus scrofa} MDLLNNTSSVSEFILLGLSSAQDIQMFFFAIFTLVYVAIIVGNLLIVISVISDNHLHSPMYFFLANLSFFDLCLSSTATPKVILDFLRERKTISWWGCMTQIFFMHFFGG
GEMSLLIAMAIDRYVAICKPLHYKTIMSHKVLIVFLLLSWTVGFIHTTSHMVFTVGLPFCGPNTVDSIFCDLPLVIRLACTDTYILELLVIVNSGLLSLVCFVLLLISYT
VMLVTIWQHSSSASSKALSTLSAHITVVTLFFGPAIFVCAFPFNSYSVDKFLSVFYSMITPLLNPIIYTLRNQEMKAAIKRLSRQHIDSCLIH*
225 >lcl|XP_001928010.1|Plus1complement(137468..139237) NW_003535254 ectoderm-neural cortex protein 2 KLHL25 __SEG__ Chr7 {Sus scrofa} MSVSVHETRKSRSSTGSMNITLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELEAEDERVVFEAILQWVKH
DPEQRKAHLPELLRGVRLALLPSDCLTEAVSGEALLMADERTRLIVDEALRCKTRILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYNTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA*
226 >lcl|XP_001928028.2|Plus1complement(14500..15435) NW_003299465 olfactory receptor 4K1-like LOC100153883 __SEG__ Chr2 {Sus scrofa} MAHTNESVVLEFVLLELTNSWELQLFLFAIFSIVYVTSVLGNTMIIVIIASDSHLNSPMYFLLGNLSFIDICQSNFATPKMLVDFLVEHKTISFEGCMAQIFLLHSFVGS
EMMLLVAMAYDRFIAICKPLHYSTIMNRRLCIIFVFISWAVGILHSVSHLAFTMDLPFSGPNEVDSFFCDLPLLIELACMDTYKMEILTLTNSGLISLGCFLALIISYTV
ILITVHRWSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYIVCTPLLNPIIYSLRNEDVQSAMHKWRNRHVNSWKY*
227 >lcl|XP_001928085.1|Plus1complement(497467..498438) NW_003535240 olfactory receptor 4K3-like LOC100155934 __SEG__ Chr7 {Sus scrofa} MDPVNNSRVAEFVLLGLSSSWELQYFFFMLFNVLYVTIVLGNLLIVLTVISEPALHTPMYIMLSNLSVLDVFLATYATPNMIHDFLYEPKTISFEGCIAQIFLLHIFAGG
EMMFLEAMAYDRYVAICKPLHYATIMNLCKCTGLVVGSWVIGVMHSLSQLAFTVNLPFCGPNIVDSSYCDLTLVIKLACTDPYVPEVLMLLNSGLMGVTSFVLLLISYAV
ILVTVRQRSSVHMAKDRGTLTAHIIVVTLFFGPCIFIYAWPFSNFPVDKVLSVFSTVFTPTLNPIIYTLRNKEVKSAMYKLKTTYVNSRLHSHLSLSRLGLLS*
228 >lcl|XP_001928091.1|Plus1complement(521263..522180) NW_003535240 olfactory receptor 4N2-like LOC100154723 __SEG__ Chr7 {Sus scrofa} MESENITVVTEFIFVGLTQSRNIQLLVFVLVFIFYLIILPGNFLIILTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EMLLLVVMALDRYIAICRPLHYSTVMNPRACYALSLAQWLGGFVHSIIQVALILHLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLICFLGLLASYAV
ILCRVRGSSSEGKTKAMSTCTTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKTSLKKLLINN*
229 >lcl|XP_001928096.2|Plus1547294..548229 NW_003535240 olfactory receptor 11G2-like LOC100153494 __SEG__ Chr7 {Sus scrofa} MNISNTPRNSSTITGFILLGFPCSRHGQILLFLLFAGVYLLTLMGNGSIICAVRWDQRLHTPMYILLANFSFLEISYVTSTVPNMLANLLSDNKVISFSGCFLQFYFFFS
LGSTECFFLAIMAFDRYLAICRPLRYPTLMTARLCTNLVVSCWVLGFLWFLIPIIIVSQMSFCGSRIIDHFLCDPSPLLALTCKKAPVIGLVFSTLSPVPMVILFILIMV
SYALVLRVVLKVPSAAGRRKAFSTCGSHLAVASLFYGSVLVMYGSPNPEHDAQTQKIVTLFYSVVTPLLNPVIYSLRNKDMKKALQKFIKL*
230 >lcl|XP_001928181.1|Plus1162625..163581 NW_003535168 olfactory receptor 5V1-like LOC100152920 __SEG__ Chr7 {Sus scrofa} MEGENQTVLFEFIILGFSNLKELQFLLFTIFLVTYICTLGGNSFIILVTMTNLHLHTPMYFFLENLAFLDICYTTTNVPQMMAHLLSEKKSISYLGCMAQLFAFIFFVGS
ESLLLAAMAYDRYIAICKPLRYSVIMNKVLYSQLAASCWSGGFLNSAVHTVLTFRLPFCGNNQINYFFCDIPPLLVLSCGDTSVNEVALLSIGVVIGWTPFLCIVLSYLY
IISTILRIRSSKGRQKAFSTCASHLTIVLLYYGSTIFTYGRPISTYSLEKDRLISVLYSIVTPMLNPIIYSLRNKDIQEAMQVMGRKWKASSSLSFDV*
231 >lcl|XP_001928187.1|Plus1138587..139534 NW_003535168 olfactory receptor 5V1-like LOC100158167 __SEG__ Chr7 {Sus scrofa} MERENTTLSEFIILGFSDLNDLQFLLFTIFLMIYLCTLGGNTFIILVTLADIRLNTPMYFFLRNLAFLDICYTTTNVPQMMAHLLSEKKSISYGGCVTQLFAFLFFVGVE
CLLLAAMAYDRYIAICKPLRYSVIMNKALYSQLAASCWVSGFLNSAVHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSVNELVLLFIGVFIGWAPFLGIILSYLYI
ISTILRIRSSEGRQKAFSTCASHLVIVLLYYGSSIFTYVRPISSYSLTKDRLISVLYSVVTPMLNPIIYTLRNKDIRKALRAVVVKVVVFKCHFP*
232 >lcl|XP_001928188.1|Plus1complement(115596..116534) NW_003535168 olfactory receptor 14J1-like LOC100156974 __SEG__ Chr7 {Sus scrofa} MANFTTVSGFLLMGFSAKPELEVLWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSSISLWECILQCLAFTLCGSAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVVSGVMHTSATFSIHFCGANIIHQFFCEVPQLLKLACSDEYVSELGVTGFLSLMILLCFLSIGFSYTRIF
STVLRMPSAEGRAKAFATCLPHLAVVTLFLSTGVFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKAMKAALQRVVKRRKAYLFC*
233 >lcl|XP_001928209.1|Plus1complement(142219..143505) NW_003535207 immunoglobulin superfamily containing leucine-rich repeat protein-like isoform 1 LOC100152082 __SEG__ Chr7 {Sus scrofa} MQELCLLCWVVLVGLVQACPKPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPSLPEGAFREVLLLQSLWLAHNEIRTVAAGALAPLGHLKSLDLSHNLI
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFEPLTALSHLQINDNPFDCTCSIMWFKTWALTTAVSIPEQDNITCTSPHVLKGTR
LNRLLPLPCSAPSVQLTYQPSQDGAELQPGFVLALHCDVDGQPAPQLHWHIQTPRGTVEIASPNVGADGRALPGALAASARPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDALGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRTGGPEAAATGEGVSAQQPPGLLLLGQSILLLVLTFF*
234 >lcl|XP_001928234.1|Plus1complement(92291..93229) NW_003535161 olfactory receptor 2M2-like LOC100156955 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFSVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDIAATLSFSYCGSREIPQFFCDITALLRLSCTDTSTFETLVFICCVVMLLFPLSLIIISYTR
VITTVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSKVLGKEKSRE*
235 >lcl|XP_001928243.2|Plus14589..5527 NW_003535161 olfactory receptor 2M3-like LOC100155759 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFSVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDIAATLSFSYCGSREIPQFFCDVPALLHLSCTDTSTFETLAFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSRVLGKEKSTE*
236 >lcl|XP_001928244.1|Plus1complement(41268..42272) NW_003535168 olfactory receptor 14J1-like LOC100152496 __SEG__ Chr7 {Sus scrofa} MANFTTVSGFLLMGFSAKPELEVLWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSSISLWECILQCLAFTLCGSAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVVSGVMHTSATFSIHFCGANVIHQFFCEVPQLLKLACSDEYVSELGVTGFLSLVAFLCFLSIGFSYTRIF
STVLRIPSAEGRAKVFATCLPHLAVVTLFLSTGVFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKAMKAALQKVVKEEKLLLLLNHRKLNEEVYSFLTEANH
NILE*
237 >lcl|XP_001928254.2|Plus1complement(173415..174353) NW_003535161 olfactory receptor 2M2-like LOC100154537 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVTVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFSVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDVAATLSFSYCGSREIPQFFCDITALLRLSCTDTSTFETLIFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSRVLGKEKSRE*
238 >lcl|XP_001928255.1|Plus1complement(19701..20663) NW_003535168 olfactory receptor 14J1-like LOC100156512 __SEG__ Chr7 {Sus scrofa} MANFTTVSGFLLTGFSAKPELEVLWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSNISLWECILQCLAFTLCGSAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVVSGVMHTSATFSIHFCGANIIHQFFCEVPQLLKLACSNEYVRELGVTGFVSLVAFLCFLSIGFSYTRIF
STVLRIPSAEGRAKAFATCLPHLAVVTLFLSTGVFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKAMKAALQRVVKRRKATSFAESRLSLPH*
239 >lcl|XP_001928263.1|Plus1complement(178070..180310) NW_003535207 immunoglobulin superfamily containing leucine-rich repeat protein 2 ISLR2 __SEG__ Chr7 {Sus scrofa} MVLLRALWLALALLEVVGACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFANVTQVTSLWLAHNEVRTVEPGSLAVLSQLKNLDLSHNL
ISSFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCSLVWLQTWAASTRVSLPEPDSIQCSSPPALQGV
PVRRLPALSCAPPSVHLSVEPPPEAPGSPLRSGLALTLHCVAEGHPTPRLQWQLQIPGGTVVLVPPVLSGEDDGDGAEDGEEEGDGDGPTQTEAPTPTPAPAWPAPPATP
RFLALTNGSLLVPLLSAKEAGVYTCRAHNELGANSTSVRVAVAAAGPPKHASGAGGDPDGQAPTSERKSTAKSRGNSVLPSKPEGKIKGLGPGQVSFLGETEARPEEEEA
DEGEEAENQVSADRVKEQRCGHGDPSRYVSNHAFNQSAELKPHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAAGAGRPGRRPLRLLYLCPAGGGAAVQWSRVEEG
VNAYWFRGLRPGTNYSVCLALAGEACHVQVVFATKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAADPMEKRIAADFDPRASYLESEKSYP
AGGEAGGEEPEEAPGEGLDEDVEQGDPGGDLQREESLAACSLVESQSKANQDEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG*
240 >lcl|XP_001928282.2|Plus1186314..187252 NW_003535161 olfactory receptor 2M2-like LOC100152131 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVTVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFSVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDVAGTLSFSYCGSGEIPQFFCDVPALLHLSCTDTSTFETLVFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSRVLGKEKSRE*
241 >lcl|XP_001928292.1|Plus120752..21699 NW_003535169 olfactory receptor 5V1-like LOC100157343 __SEG__ Chr7 {Sus scrofa} MERENTTLSEFIILGFSDLNDLQFLLFTIFLMIYLCTLGGNTFIILVTLADIRLNTPMYFFLRNLAFLDICYTTTNVPQMMAHLLSEKKSISYGGCVTQLFAFLFFVGVE
CLLLAAMAYDRYIAICKPLRYSVIMNKALYSQLAASCWVSGFLNSAVHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSVNELVLLFIGVFIGWVPFLGIILSYLYI
ISTILRIRSSEGRQKAFSTCASHLVIVLLYYGSSIFTYVRPISSYSLTKDRLISVLYSVVTPMLNPIIYTLRNKDIRKALRAVVVKVVVFKCHFP*
242 >lcl|XP_001928310.2|Plus169844..70800 NW_003535169 olfactory receptor 5V1-like LOC100152518 __SEG__ Chr7 {Sus scrofa} MEGENQTVLFEFIILGFSNLKELQFLLFTIFLVTYICTLGGNSFIILETMTNLHLHTPMYFFLENLAFLDICYTTTNVPQMMAHLLSEKKSISYLGCMAQLFAFIFFVGS
ESLLLAAMAYDHYIAICKPLRYSVIMNKVLYSQLAASCWSGGFLNSTVHTVLTFRLPFCGNNQINYFFCDIPPLLVLSCGDTSVNELALLSIGVVIGWTPFLCIVLSYLY
IISTILRIRSSKGRQKAFSTCASHLTIVLLYYGSAIFTYGRPISTYSLEKDRLISVLYSIVTPMLNPIIYSWRNKDIQEAMQVMGRKWKASSSLSFDV*
243 >lcl|XP_001928314.1|Plus1complement(105740..106702) NW_003535169 olfactory receptor 14J1-like LOC100157754 __SEG__ Chr7 {Sus scrofa} MVMANVTTTCGFLLMGFSNTRELQILPALLFLLMYLSALAGNVIIIAVTTPDQHLQSPMYYFLKHLSFLDLAFISVTAPQSIDTSLTGNGCISHGQCMLQVFFFTSLAWA
EVAILTVMSYDRYAAICLPLHYEAIMDPRACEWAVIAVWLSGGTSGILYTAATFSITFCRAKVIHQFFCDIPQLLKLSCSNDYLGVIGVAAFMTVLAFICFISIAHSYIH
IFSTVLRIPSAEGRSKAFSTCLPHLFVVSFFLSIGIFEFLKSTSDSPTAFDIMISLFYTVVPPTLNPIIYSLRNKTMREALRKLLLDGEFTKKKTFLSYC*
244 >lcl|XP_001928319.1|Plus1complement(130011..130955) NW_003535169 olfactory receptor 2B2-like LOC100156544 __SEG__ Chr7 {Sus scrofa} MWINNQSSLDDFILLGFSDRPWLETPFFVIFLVAYIFALLGNISIILVSHLDPQLDSPMYFFVSNLSLLDLCYTSSTVPQMLVNLQGPEKTISYGGCVAQLYIFLALGST
ECILLAIMAFDRYAAICKPLHYPVIMNQRHCIHVATGTWISGFANSLVQSTFTVLTPRCGQRVIDHFFCEVPALLKLACTDTHVNEAELNVLGALLLLVPLTLILGAYVF
IARAVMRIRSAESRWKAFNTCASHLLVVSLFYLTAISMYVQPPSSYSHDRGKIMALFYGIVTPTLNPFIYTLRNKDVKAALRRALTKEFWVRTR*
245 >lcl|XP_001928324.1|Plus1complement(159443..160381) NW_003535161 olfactory receptor 2M2-like LOC100156148 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFYVSLLGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDIAATLSFSYCGSREISQFFCDLPALLRLSCTDTSTFETLIFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDTMVSTFYTILTPMLNPLIYSLRNKDVAKASSKVLGKVKSRE*
246 >lcl|XP_001928325.1|Plus1complement(152234..153169) NW_003535169 olfactory receptor 2G3-like LOC100155347 __SEG__ Chr7 {Sus scrofa} MGTNSSIVEDNIIPVGFSDQPSLEKILFGVVLASYLLTLVGNTVIILIASIDPNLKTPMYFFLTHLSLVDICFTTSIVPQLLWNLRGPAKTITALGCAVQLYVSLALGST
ECVLLAVMAFDRHAAVCKPLHYAAVMNPRLCQALAGVAWLSGVGNTVIQSTVTLWLPRCGHRRLHHFFCEVPSMIKLACVDIHTNEVQLFIASLVLLLLPLALILTSYGH
IVKAVTRIKSVQAWRKALGTCGSHVMVVSLFYGTITAVYIQPNSSYAHTSGKFISLFYTVLTPTLNPLIYTLRNKDVKGAMRRLFRRDLGS*
247 >lcl|XP_001928331.1|Plus1complement(159551..160486) NW_003535169 olfactory receptor 2G6-like LOC100154120 __SEG__ Chr7 {Sus scrofa} MEQNNETSGGDFILLGFSDQPQLEVLLFVLVLISYLLTLLGNTAIILVSCLDCRLHTPMYFFLTNLSSLDLCFTTSIVPQLLWNLKGPAKTITPVGCAIQLYVSLSLGST
ECVLLTIMAFDRYVAVCRPLNYTSIMHPSFCKALAGVAWLSGVGNTLIQGTITLRLPRCGHRHLHHFLCEVPAMVKLACVDIQANEVQLFVATLVLLLLPVALILVSYGF
IVQAVMKIKSVQAWRKALGTCGSHLLVVFLFFGPSSAIYIQPKRSYGRSQGKFLTLFYTVVTPTLNPLIYTLRNKDVKGALRRLLRRGQSS*
248 >lcl|XP_001928341.1|Plus1complement(173052..173984) NW_003535169 olfactory receptor 2H2-like LOC100158165 __SEG__ Chr7 {Sus scrofa} MKGTNFSTPAGFVLLGFSDQPRLEMVLLLVVSVTYTLTLTGNTVIILASYLCPKLHTPMYFFLSNLSFLDLCFTTSIVPQMLWNLRGPAKTISYAGCVLQLYVALGLGST
ECVLLAVMAYDRFSAICRPLHYDVIMHPKLLQQLAALAWISGFVEATVQTILVFQLSLCSHHRVDDFVCEVPALIKSACVNTSFLENELAVASVLYVAVPLGLILVSYGG
IVRSVLRIKSAQGRRKACGTCGSHLLVVVLFFGSIISVYIQPKSKYTQNHSKFLTLFYTVVTPALNTLIYTLRNKEVKWALRGLLRRVPR*
249 >lcl|XP_001928347.1|Plus1complement(106933..107871) NW_003535161 olfactory receptor 2M2-like LOC100154937 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMACNYLSGRKSISVAGCETQIFFYVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDVAATLSFSYCGSREIPQFFCDVPALLHLSCTDTSTFETLVFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSKVLGKEKSRE*
250 >lcl|XP_001928348.1|Plus1184653..185588 NW_003535169 olfactory receptor 2G6-like LOC100155724 __SEG__ Chr7 {Sus scrofa} MEQNNETSGGDFILLGFSDQPQLEVLLFVVVLISYLLTLLGNTAIILVSCLDCRLHTPMYFFLTNLSSLDLCLTTSIVPQLLWNLKGPAKTITPVGCAIQLYVSLSLGST
ECVLLTIMAFDRYVAVCRPLNYTSIMHPSFCKALAGVAWLSGVGNTLIQGTITLRLPRCGHRHLHHFLCEVPAMVKLACVDIQANEVQLFVAMLVLLLLPVALILVSYGF
IVQAVMKIKSVQAWRKALGTCGSHLLVVFLFFGPSSAIYIQPKRSYGRSQGKFLTLFYTVVTPTLNPLIYTLRNKDVKGALRKLLRRGQSS*
251 >lcl|XP_001928361.1|Plus1complement(32263..33201) NW_003534750 olfactory receptor 6C75-like LOC100157944 __SEG__ Chr5 {Sus scrofa} MGNHTRVTVFILAGLTDDPQLKVALFIFLLLTYLLSITGNLIIIILTLVDIHLKTPMYFFLRNFSFLEISYTTTCIPKLLVMMVTGDKTISYNNCIAQLFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTAIMNSKICIQLVLSCWLAGFFTIFIPLLLGLKLDFCASNIVDHFLCDPTPLLQISCSDTHLIETMEFISAVVTLVVTLAVVIMSYTYIA
LTILKIPSANQRKKAFSTCSSHMIVISLSYGSCIFMYVKPSVKQRVSFYKGIALLNTSAAPLLNPFIYSLRNQQVKKASMSLIHRVVSSSNK*
252 >lcl|XP_001928368.1|Plus1146034..146972 NW_003535162 olfactory receptor 2M2-like LOC100156560 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFYVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDVAATLSFSYCGSREISQFFCDVPALLHLSCTDTSTFETLAFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSRVLGKEKSRE*
253 >lcl|XP_001928371.1|Plus165479..66417 NW_003535162 olfactory receptor 2M2-like LOC100152530 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMACNYLSGRKSISVAGCETQIFFYVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDVAATLSFSYCGSREIPQFFCDVPALLHLSCTDTSTFETLIFICCVVMLLFPLSLIIISYTR
VITTVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKASSKVLGKGKSRE*
254 >lcl|XP_001928372.1|Plus1complement(230375..231337) NW_003535169 olfactory receptor 10-like LOC100156119 __SEG__ Chr7 {Sus scrofa} MRRFNNTFHHSGGFVLVGFSEWPKLEMILFVAISVFYIMTLLGNSAIIILSRLDPRLHTPMYFFLANLSFLDLCYTTSTVPQMLVNIQSHWRRISYIGCVAQLFIFLGLG
STECVLLSVMAFDRYVAICQPLHYTVIMNSRLCQQLAAVAWVTGFSNSLVQTVLTFLLPRCGQYQVENFFCEVPAMLQLSCVDTWINEVEMYAAVVVIKVIPVGLILFSY
INIVRAVVRIQSSEGRKKAFNTCGSHLLVVIMFYGSAISGYAYMAPKSNSAKLKGKLLALFYGLITPMLNPLIYTLRNKDVKGAVKKLLGREQEQEWNMA*
255 >lcl|XP_001928379.1|Plus1157997..158935 NW_003535162 olfactory receptor 2M2-like LOC100157765 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFSVSLFGA
EFFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDVAGTLSFSYCGSREIPQFFCDVPALLHLSCTDTSTFETLIFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSRVLGKEKSRE*
256 >lcl|XP_001928388.1|Plus1complement(265921..266874) NW_003535169 olfactory receptor 2H2-like LOC100152495 __SEG__ Chr7 {Sus scrofa} MFTICNDSHSDFILLGFSDKPYLEKILFWVVLIFYCLTIIGNLVIILVSLKDPKLHIPMYYFLSNLSLLDLCFTSSCVPQMLVNFGGPEKTISYIGCAIQLYVFLWLGAT
ECVLLVVMAVDRYVAVCHPLQYTTIMHPKLCLELAILAWGTGLIQSLTQSPATLQLPFCSNRRLYDIVCEVPALIQVSSADTIYNEIQMSIASIILLVVPLVIILSSYGA
ITKAVLRVKSTEGQKKAFGTCTSHLLVVFLFYGTVTAVYLQPKSHYAHEQGKFLTLFYTVITPTLNPLIYTLRNKEVKGALIRLGKKTWDDLCWTIA*
257 >lcl|XP_001928393.1|Plus1288842..289846 NW_003535169 putative olfactory receptor 2B3-like LOC100157727 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILDPKLHTPMYFFFTNLSILDLCYTTSTIPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVTSFDRYVAICRPLRYVVIMKPWFCLKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTGIYMYLQPPSSTSKDWGKMVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRLELLTFSIRNVFHCDNNLLSMSLSLKM
IIVF*
258 >lcl|XP_001928399.1|Plus1299727..300671 NW_003535169 olfactory receptor 2B11-like LOC100156511 __SEG__ Chr7 {Sus scrofa} MNARNVSTPKVFILLGFSDHPWLEMPLFIIVLAAYICTLVGNISIIVVSRVDPNLDSPMYFFLSNLSFLDLCFTTTTIPQLLLNLWGPDKSISYGGCVTQFYMFHFLGAT
ECILLAVMSLDRYMAICKPLRYPVIMHQQLCIFLVVMAWLSGLVNSLLQSSLTIQLPLCGNNKVDDFLCEVPVMIKMSCTDTTFNVAMLSIVGTFYSLVPLSLILVSYGF
IVATVLRIQSSEGKKKAFNTCSSHIIVVSLFYGPVISMYVQPSAANSQDKNKLMSLFYSLVTPMLNPFIYTLRNKDMKGAMMRLLVSLYHQRRG*
259 >lcl|XP_001928403.1|Plus1complement(89617..90546) NW_003534750 olfactory receptor 6C4-like LOC100156762 __SEG__ Chr5 {Sus scrofa} MKNQTTFTEFILLGLTNQPEVQVVIFIFLFLTYLLSVLGNLTIIILTLVDPHLQTPMYFFLRNFSFLEVCFTSIFIPRFLTSLTTGNKVISFAGCLIQYFFAIFLGATEF
YLLASMSYDRYVAICKPLHYLTIMNSRVCIQLVFSSWLGGFLAIFPPIFLMSQVDFCASNVLNHYYCDYGPLLELACSDTSLLELTVIFLAVVTLVVTLVLVTLSYTFII
RTILRIPSAQQRTKAFSTCSSHMIVISRSYGSCMFMYINPSAKEEGSFNKAIAVLITSITPLLNPFIYTLRNQQVKQAFKDTIKKIVKL*
260 >lcl|XP_001928416.1|Plus1complement(102909..103844) NW_003534750 olfactory receptor 6C2-like LOC100155553 __SEG__ Chr5 {Sus scrofa} MKNHSAITSFILLGLTDDPRLQVFLSVFLFLTYIFTVVGNLVIILLTLVDSHLKTPMYFFLRNFSILEIIFTTVCVPRFLYSMTTGDKSVTYNACVIQLFFVILIGATEF
FLLTAMSCDRYVAICKPLHYTAIMNGRICTVLVLGCWLIGLIVILPPLSLGVQLDFCDSNLLDHFGCDASPLLKIVCSDTQFVEQLVLIMAVLTLMVTLVCVIVSYTYII
KSILRLPSAQQRKKAFSTCSSHIIVVSITYGSCIFIYIKPAKEGVAINKAVSLLNTSVIPLMNPFIYTLRNKQVKQAFGDLIKKMAFLSKD*
261 >lcl|XP_001928423.1|Plus1118133..119071 NW_003534750 olfactory receptor 6C2-like LOC100154329 __SEG__ Chr5 {Sus scrofa} MRNHTSLTRFILLGLTDDPHMQILIFLFLLLTYMLSLTGNLIILLLVLVDSHLKTAMYFFLQNFSFLEISFTSACIPRFLYSISTGDRAITYNACACQLFFTYVFGVTEF
FLLAAMSFDRYVAICKPLHYVTIMNQRVCRRIVFCCWMATLLIISPPFSFGLALEFCDSNVIDHFVCDVNPLLKIACSETRFIEQMTLAGSVLIFILTLVCVVLSYVYII
RTILGFPSAQQRTKAFSTCSSHIIVVSITYGSCIFVYIKPSAKDEMTINKGVTILTTSISPMLNPFIYTLRNKQVKQAFNDSVQRIISLSKN*
262 >lcl|XP_001928429.1|Plus1complement(127828..128766) NW_003534750 olfactory receptor 6C75-like LOC100153115 __SEG__ Chr5 {Sus scrofa} MRNHSVQTEFILLGLTDDPVWQIVIFLSLSVTYMLSVTGNLTIIILTLLDSHLKTPMYFFLRNFSFLEISFTTSCIPRFLMSLVTKDRTISYMSCMAQLFFYFFLGVTEF
YLLAAMSYDRYAAICKPLHYTTIMSNKVCYQLVLSSWATGFLLIFPPVILGLKLEFCDSNVIDHFICDSSPILQISCSDTHFLELMSFLLAVVTLIVTLTLVILSYGSII
KTILKFPSAQQRTKAFSTCSSHMIVVSISYGSCIFMYIKPSANDRVILSKGVAMLHTSVAPLLNPFIYTLRNQQVKQAFKDMVQKFLFASNK*
263 >lcl|XP_001928437.2|Plus1complement(139695..140630) NW_003534750 olfactory receptor 6C2-like LOC100151922 __SEG__ Chr5 {Sus scrofa} MRNQTITTFILLGLTDDPQLQIPIFMFLFLTYMLSVTGNLAIISLTLVDSHLKTPMYFFLQNFAFLEISFTSACIPRYLYNIATGDQSITYNICVIQVFFIGALGVTEFY
LLATMSYDRYVAICKPLHYVAIMNSRVCGRLVLCCWTAGMLIILPPLIMIVNLEFCDSNAIDYFFCDASPILKISCSDTWLLEQMVIACAVLAFITTLLCVVLSYIYILK
TILRFPSAQQRKRAFSTCSSHMIVVSITYGSCIFIYIKPSAKESMAINKAVTLLMTSIAPMLNPFIYTLRNKQVRRAFRDSFKRITFPSKK*
264 >lcl|XP_001928439.1|Plus1complement(132989..133927) NW_003535162 olfactory receptor 2M2-like LOC100155301 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMARNYLSGRKSISVAGCETQIFFSVSLFGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIVDIAATLSFSYCGSREIPQFFCDITALLRLSCTDTSTFETLVFICCVVMLLFPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLRNKDVAKAFSKVLGKGKSRE*
265 >lcl|XP_001928461.1|Plus1complement(83421..84389) NW_003300228 putative olfactory receptor 2B3-like LOC100154925 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNPWFCFKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTSIYMYLQPPSSTSKDWGKMVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRLELLTFSIRNKCSIVTTIF*
266 >lcl|XP_001928465.1|Plus1complement(72824..73768) NW_003300228 olfactory receptor 2B11-like LOC100153711 __SEG__ Chr7 {Sus scrofa} MNARNVSTPKVFILLGFSDHPWLEMPLFIIVLAAYICTLVGNISIIVVSRVDPNLDSPMYFFLSNLSFLDLCFTTTTIPQLLLNLWGPDKSISYGGCVTQFYMFHFWGAT
KCILLAVMSLDRYMAICKPLRYPVIMHQQLCIFLVVMAWLSGLVNSLLQSSLTIQLPLCGNNKVDDFLCEVPVMIKMSCTDTTFNVAMLSIVGTFYSLVPLSLILVSYGF
IVATVLRIQSSEGKKKAFNTCSSHIIAVSLFYGPVISMYVQPSAANSQDRNKLMSLFYSLVTPMLNPFIYTLRNKDMKGAMMRLLVSLYHQRRG*
267 >lcl|XP_001928468.1|Plus1complement(117190..118128) NW_003535162 olfactory receptor 2M3-like LOC100152873 __SEG__ Chr7 {Sus scrofa} MEWENQTASSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANIVMVLLICLDRRLHTPMYFLLSQLSLMDLMLICTTVPKMACNYLSGRKSISVAGCETQIFLYVSLLGA
ECFLLAVMAYDRYAAICYPLQYPQLMNWNVCGLLAASSWILGVFDGIIELAATLSFSYCGSREISQFFCDVPALLRLSCTDTSTFETLVFICCVVMLLFPLSLIIISYTR
VIITVICMSSGEGRHKAFTTCSSHLVVVGMYYGAAMFIYMRPTSNRSPAQDKMVSTFYTILTPMLNPLIYSLRNKDVAKAFSKVLGKEKSRE*
268 >lcl|XP_001928472.2|Plus1118639..119592 NW_003300228 olfactory receptor 2H2-like LOC100157751 __SEG__ Chr7 {Sus scrofa} MFTICNDSHSDFILLGFSDKPYLEKILFWVVLIFYCLTIIGNLVIILVSLKDPKLHIPMYYFLSNLSLLDLCFTSSCVPQMLVNFGGPEKTISYIGCAIQLYVFLWLGAT
ECVLLVVMAVDRYVAVCHPLQYTTIMHPKLCLELAILAWGTGLIQSLTQSPATLQLPFCSNRRLYDIVCEVPALIQVSSVDTIYNEIQMSIASIILLVVPLVIILSSYGA
ITKAVLRVKSTEGQKKAFGTCTSHLLVVFLFYGTVTAVYLQPKSHYAHEQGKFLTLFYTVITPTLNPLIYTLRNKEVKGALIRLGKKTWDDLCWTIA*
269 >lcl|XP_001928479.1|Plus1complement(128170..129117) NW_003300228 olfactory receptor 2W1-like LOC100156542 __SEG__ Chr7 {Sus scrofa} MINDSYFGGFILLGFPGQPQLEMIISGVVFFFYTIALMGNIAIIALPLLDERLQTPMYFFLRSLAILDLCYTSNIVPQMLVNVWGKDKKISFGGCASQLFIDVTLCTVEC
MLLAVMSYDRFNAVCKPLHYMTIMNPQLCGGLVAMTWVIGIINCMILSPYAMSLPRCGNHHLDHYFCEISAMVKIACVDTTAMEETVFALCFFIFLTPLLLVLVSYGFIA
VAVLKIKSATGRQKAFGTCSSHLIVVSIFYGTVIYMYIQPGNSPNQDEGKLLSVFYSIVTPAMNPLIYTLRNKEFRGAMKRLIGKEKDSGETIGH*
270 >lcl|XP_001928488.1|Plus1complement(5478..6440) NW_003300228 olfactory receptor 10C1-like LOC100154118 __SEG__ Chr7 {Sus scrofa} MTFNCSLWQDNSMSVKRFAFARFSEVTEQCFLLFTLILLMFLASLMGNALIATAIWSNPVLHTPMYFFLANLSLLEIGYTCSVTPKMLQNLVIEARGISREGCVTQMFFF
SFFGISECCLLAAMAFDRYMAICSPLHYATRMSRGVCVHLAMVSWGVGCMAALGQTNYIFSLDFCGPCEIDHFFCDLLPILALACGDTSHNEAAVFVAATLCISSPFLLI
IASYGRILAAVLSMPSPEGRRKALSTCSSHLLVVTLFYGSASVTYLRPKASHSPGIDKLLALSYTVVTSMLNPIIYSLRNKEVKAALRRTLGKQKVLAHS*
271 >lcl|XP_001928493.1|Plus1153853..154815 NW_003300228 olfactory receptor 10-like LOC100152917 __SEG__ Chr7 {Sus scrofa} MRRFNNTFHHSGGFVLVGFSEWPKLEMILFVAISVFYIMTLLGNSAIIILSRLDPRLHTPMYFFLANLSFLDLCYTTSTVPQMLVNIQSHWRRISYIGCVAQLFIFLGLG
STECVLLSVMAFDRYVAICQPLHYTVIMNSRLCQQLAAVAWVTGFSNSLVQTVLTFLLPRCGQYQVENFFCEVPAMLQLSCVDTWINEVEMYAAVVVIKVIPVGLILFSY
INIVRAVVRIQSSEGRKKAFNTCGSHLLVVIMFYGSAISGYAYMAPKSNSAKLKGKLLALFYGLITPMLNPLIYTLRNKDVKGAVKKLLGREQEQEWNMA*
272 >lcl|XP_001928502.1|Plus1complement(135842..136780) NW_003534751 olfactory receptor 6C65-like LOC100157163 __SEG__ Chr5 {Sus scrofa} MPNKTTIREFILLGLTDDPELQAVIFFFMLFTYLLSVGGNMTIIILTLSNVCLKTPMYFFLRNFSFLEISFTTVCIPRFLISIATGDTTISYNACMTQVFFSILLGSTEF
FLLAVMSYDRYVAICKPLHYTTIMSHKVCHQLVISSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPMLLIACTDTKFLEFMAFFLAVFTLMVTLALVILSYTLIL
RTILKIPSGQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALSKGVAVLNTSVAPMLNPFIYTLRNQQVRQALKDITQKMLLSNKH*
273 >lcl|XP_001928515.1|Plus1complement(157493..158434) NW_003534751 olfactory receptor 6C75-like LOC100155964 __SEG__ Chr5 {Sus scrofa} MRNYTEVTEFILLGLTDDPQWQAVLFTLLLVTYMLSVTGNLTIIALTLSDPHLQTPMYFFLRNFAFLEISFTSVCIPRFLVTLVTGDRTISYDGCVAQLFFLIFLGVTEF
YLLAAMSYDRYVAICKPLHYTIIMSSRVCALLVFSSWLAGFLIIFPPIILLLLQLEFCASNIIDHFICDASPILQLSCSSTRLLELMAFFLAVVTLMVTLTLVILSYTYI
VRTILRLPSTSQRKKAFSTCSSHMRVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFRNMVQRRAFSSNQ*
274 >lcl|XP_001928531.1|Plus1complement(184648..185580) NW_003534751 olfactory receptor 6C1-like LOC100153526 __SEG__ Chr5 {Sus scrofa} MKNHTEITEFILLGLSDDPQLQVMVFVFLLITYLLSITGNLTIITLTLLDPHLQTPMYFFLRNFSLLEVSFTTVTIPRFLSTIITGDKTISFNNCMAQLFFFILLGVTEF
CLLAAMSYDRYVAICKPLHYLAIMNPRLCILLIFASWLASFLIIFPSLMLFLNLDYCKSNIIDHFTCDYFPLLQLSCSDTKFLEMVGFSFAVFILLFTLALIILSYIYII
RTIVRIPSTSQRTKAFSTCSSHMIVISISYGSCIFMYIKPSAKDRVSLSKGVAVLNTSVAPMLNPFIYSLRNQQVKRAFMELARKVCIFF*
275 >lcl|XP_001928574.2|Plus1complement(78806..79741) NW_003301854 olfactory receptor 6C2-like LOC100155088 __SEG__ ChrX {Sus scrofa} MRNHTVTTFILLGLTDEPQLKTLVFIFLFLTYMLSVTGNLTIISLTSTDSHLKTAMYFFLQNFSFLEIAFTSACIPKYLYNIATGDKTITYNSCATQLFFTDLFAVTEFF
LLAAMSYDRYVAICKPLHYVTIVNHTVCRRLIIGSWLAGLLIIIPPLSLGLKLEFCDSNVIDHFVCDAAPLLKISCSETWLIEQMVIVCAVLTFIMTLVCVVLSYVHILK
TILQFPSAQQRKKAFSTCSSHMIVVSISYGSCIFTYVKPSAKKSVAVNKGVTLLTTSIAPMLNPFIYTLRNKQVKQAFDDTIKRFALFLKK*
276 >lcl|XP_001928585.1|Plus1complement(126818..127744) NW_003300307 olfactory receptor 4K3-like LOC100157384 __SEG__ Chr7 {Sus scrofa} MDQENKSGVTEFVLHGLSGPRELQLFYFAFFTLFYLPIVLGNLLIVLTVISEPALHTLMYFLLSNLSFIDVCLSTFATPKMIVDFLEEHRTISFEGCMAQIFFLHVFAGG
EMMLLVAMAYDRYVAICRPLHYATIMSERRCTSLVVGSWLIGVLHSVSQLVFTVNLPFCGPNQVDSFFCDLPLVIKLACTDTFTLEVLMLSDSGLMAMSSFVLLLISYTV
ILVTVQRRSSAGMAKARATLTAHITVVTLFFGPCIFIYAWPFNNLPVDKVLSIFYTVFTPLLNPLIYTLRNKEVISAMQKLRHREVSS*
277 >lcl|XP_001928650.1|Plus1164718..165665 NW_003300307 olfactory receptor 4K3-like LOC100154959 __SEG__ Chr7 {Sus scrofa} MAWNNQSVIREFILQGLSSAWELQIFYFLFFSIVYAATVLGNLLILLTIVSEPRLHSPMYFLLGNLSFIDMSLASFATPKMIADFLSEHKAISFEGCITQIFFLHLLGGA
EIVLLISMSFDRYVAICKPLRYLTIMSRRMCVGLVTLSWIVGIFHAMSQLAFTVNLPFCGPNEVDSFFCDLPLVIKLACVDTYILGVFMISTSGMIALVCFILLVISYTV
ILVTVRQRSSGGSSKALSTCSAHFTVVTLFFGPCIFIYVWPFTNFPIDKVLSVFYTIFTPLLNPVIYTLRNKDVKDSMRKLSSRVFKSRKTDHTP*
278 >lcl|XP_001928657.1|Plus1complement(186637..187560) NW_003300307 olfactory receptor 4N2-like LOC100152551 __SEG__ Chr7 {Sus scrofa} MENENSTVVAEFIFVGLTQSRNIQLLVFVLILIFYLIILPGNFLIILTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EGLLLVVMALDRYIAICRPLHYSTVMNPRACYALLVALWLGGFVHSIIQVALILHLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYPV
ILCRVRGSSSEGKTKAISTCTTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKTSLKRLFNQQLA*
279 >lcl|XP_001928666.1|Plus1complement(196142..197068) NW_003300307 olfactory receptor 4N2-like LOC100157798 __SEG__ Chr7 {Sus scrofa} MEIKNSTLVTEFILLGLTQSRNIQLLVFVLILIFYLIILPGNFLIILTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EGLLLVVMALDRYIAICRPLHYSTVMNPRACYALLVALWLGGFVHSIIQVALILHLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLICFLGLLASYAI
ILCHVRGSASEGKSKALSTCTTHIIIILLMFGPAIFIYTRPFRALPADKVVSFFHTVVFPLMNPVIYTLRNQEVKSSMRRILSRHVVC*
280 >lcl|XP_001928670.1|Plus1complement(212548..213489) NW_003300307 olfactory receptor 4M1-like LOC100156587 __SEG__ Chr7 {Sus scrofa} MEPANYTRVSEFVLTGLSQTREVQLVLFVIFLSFYLFILPGNILIICTIRLDPHLTSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGAS
EMFLLTVMAFDRYAAICRPLHYASIMNRRLCCILVAFSWMGGFIHSIIQVALIVRLPFCGPNELDSYFCDITQVVRIACANTFPEELVMIFSSGLISVVCFIALLMSYAF
LLAMLKKHSGSGESTSRATSTCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKTAMRKLINRYILCKEK*
281 >lcl|XP_001928675.1|Plus1complement(234118..235056) NW_003300307 olfactory receptor 4S2-like LOC100155381 __SEG__ Chr7 {Sus scrofa} MEVVNNVTEFIFLGLSQDPGMQLMFFPLFLFFYMVIMVGNLLILLMVFSDPQLQTPMYFFLSNLSFVDLAYSSATAPKMIADFVSEKKIISYWGCVTQMFTFHFFGCAEI
FVLTVMAFDRYAAICQPLRYTTIMSANACTMLASLSWLGALAHSFVQTLLTFQLPFCNAQVIDHYFCDVHPVLKLACADTTLVNMLVIANSGLISLGCFLILLASYTIIL
FSLQKRSAESRRKALSTCGSHFTVVTFFFVPCIFIYLRPSTTFPLDKAVSVFYTTITPMLNPLIYTLRNEDVKNAMRRLWCRQVSLKEKQKG*
282 >lcl|XP_001928735.1|Plus1complement(231451..232569) NW_003535292 ovarian cancer G-protein coupled receptor 1-like LOC100153615 __SEG__ Chr7 {Sus scrofa} MRGEEAPSGPKMGNITADNASLHCAIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQVKARNELGVYLCNLTVADLFYICSLPFWLQYVLQHDHWSHGDLSCQVCGI
LLYENIYISVGFLCCISIDRYLAVAHPFRFHQFRTLKAAVGVSVVIWAKELLTSIYFLMHKEVVEDGDQHRVCFEHYPLEPRQRGINYYRFLVGFLFPICLLLASYRGIL
RAVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHALLLVRSLWESSCDFAKGIFNAYHFSLLLTSFNCVADPVLYCFVSETTHRDLARLRGACRAFLACARTGRAREA
YPLGTPEVSRKSEDPELLAKLHPAFQAPHPLGAGGSPAGALN*
283 >lcl|XP_001928749.2|Plus1581491..582426 NW_003299923 olfactory receptor 6C2-like LOC100154323 __SEG__ Chr5 {Sus scrofa} MKNHSAITSFILLGLTDDPRLQVFLSVFLFLTYIFTVVGNLVIILLTLVDSHLKTPMYFFLRNFSILEIILTTVCVPRFLYSMTTGDKSVTYNACVIQLFFVILIGATEF
FLLTAMSYDRYVAICKPLHYTAIMNGRICTVLVLGCWLIGLIVILPPLSLGVQLDFCDSNLLDHFGCDASPLLKIVCSDTQYVEQLVLIMAVLTLMVTLVCVIVSYTYII
KSILRLPSAQQRKKAFSTCSSHIIVVSITYGSCIFIYIKPAKEGVAINKAVSLLNTSVIPLMNPFIYTLRNKQVKQAFRDLIKKMAFLSKN*
284 >lcl|XP_001928752.2|Plus1complement(565698..566636) NW_003299923 olfactory receptor 6C2-like LOC100153110 __SEG__ Chr5 {Sus scrofa} MRNHTSLTRFILLGLTDDPHMQILIFLFLLLTYMLSLTGNLIIILLILVDSHLKTAMYFFLQNFSFLEISFTSACIPRFLYSISTGDRAITYNACACQLFFTDVFAVTEF
FLLAAMSFDRYVAICKPLHYVTIMNQRVCQRIVFCCWMATLLIISPPFSFGLALEFCDSNVIDHFVCDVNPLLKIACSETRFIEQMTLAGTVLIFILTLVCVVLSYVYII
RTILGFPSAQQRTKAFSTCSSHIIVVSITYGSCIFVYIKPSAKDEMTINKGVTILTTSISPMLNPFIYTLRNKQVKQAFNDLVQRIISLSKN*
285 >lcl|XP_001928757.2|Plus1557254..558192 NW_003299923 olfactory receptor 6C75-like LOC100151915 __SEG__ Chr5 {Sus scrofa} MRNHSVQTEFVLLGLTDDPVWQIVIFLSLSVTYMLSVTGNLTIIILTLLDSHLKTPMYFFLRNFSFLEISFTTSCIPRFLKSLVTKDRTISYMSCMAQLFFYFFLGVTEF
YLLAAMSYDRYAAICRPLHYTTIMSSKVCYQLVLSSWATGFLLIFPPVILVLKLEFCDSNVIDHFICDSSPILQISCSDTHFLELMSFLLAVVTLMVTLTLVILSYGSII
KTILKFPSAQQRTKAFSTCSSHMIVVSISYGSCIFMYIKPSANDRVTLSKGVAMLHTSVAPLLNPFIYTLRNQQVKQAFKDMVQKFLFGSNK*
286 >lcl|XP_001928761.1|Plus1200092..201156 NW_001886576 membrane progestin receptor beta-like LOC100153743 __SEG__ Chr7 {Sus scrofa} MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFLPAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FILDISPVAHRVALCHLSGCQEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYKGRQEIFLHRHSPLSIYAACLSFFFL
VACSGATAALLREKIKARLSKKDS*
287 >lcl|XP_001928765.3|Plus1545340..546278 NW_003299923 olfactory receptor 6C2-like LOC100157159 __SEG__ Chr5 {Sus scrofa} MMRNQTITAFILLGLTDDPQLQIPIFMFLFLTYMLSVTGNLAIISLTLVDSHLKTPMYFFLQNFAFLEISFTSACIPRYLYNIATGDRSITYNICVIQVFFIDALGVTEF
YLLATMSYDRYVAICKPLHYVAIMNSRVCGRLVLCCWTAGMLIILPPLIMIVNLEFCDSNAIDYFFCDASPILKISCSDTWLLEQMVIACAVLAFITTLLCVVLSYVYIL
KTILRFPSAQQRKRAFSTCSSHMIVVSITYGSCIFIYIKPSAKESVAINKAVTVLMTSIAPMLNPFIYTLRNKQVRRAFRDSFKRITFPSKK*
288 >lcl|XP_001928794.2|Plus1505626..506561 NW_003299923 olfactory receptor 6C2-like LOC100155959 __SEG__ Chr5 {Sus scrofa} MRNYTITTFILLGLTDDPELQVLIFIFLCLTYTMSVTGNLTIITLTFVDSHLKTPMYFFLKNFSFLEISFTTACVPRYLYTIATGDNIITYNACVIQVFFTDLCAVTEFF
LLAAMSYDRYVAICKPLHYVATMSSRVCQRLVFCSWVAGLLVIISPLSLGLNLEFCDSNVVDHFLCDASPLLKISCSDTWFMEQTVFICAVLTLILTLMCVILSYMYIMK
TILGFPSAQQRRKAFSTCSSHMTVVSITYGTCMFIYMNPTAKEEVTTNKVASLLISSISPTLNPFIYTLRNKQVKKAFNDSIKRIASLFKK*
289 >lcl|XP_001928878.1|Plus1249742..250683 NW_003535165 olfactory receptor 1F12-like LOC100154909 __SEG__ Chr7 {Sus scrofa} MKEENQTSVSEFLLLGFSSWREQQALLFALFLCLYLTGLFGNLLILLAIASDHHLHTPMYFFLANLSIVDLCLPSSTVPKMLMNIQTQTESISYPGCLVQMYFCMMFANM
DNFLLTVMAYDRYVAICHPLYYSIIMTQHLCISLVGIPWIIAILNPLLHTLMMTRLHFCSNNVIHHFFCDINSLLPLSCSDTSLNQFLVLAVVGLIFVVPSVCILASYGL
IISAVMKIPSAEGKLKAFSTCGSHLALVILFYGAITGVYMSSSSNQSSEKDSAASVIFMVIAPVVNPFIYSLRNNELKVALKKALGQSKIFSQ*
290 >lcl|XP_001928944.3|Plus1complement(6314..7252) NW_003535165 putative olfactory receptor 2B8-like LOC100157733 __SEG__ Chr7 {Sus scrofa} MEQRNGSSFTGFILLGFSDRPQLEQVLFVVLLIFYVFTLLANTAIIALSHMDSHLHTPMYFFLSNLSFVDLCYTTSIVPQLLVNLRGSDKSISFGGCVVQLYISLGLGGT
ECILLGVMALDRYAAVCKPLHYTVIMHPCLCALMACASWITGFANSVLQTVLIFLLPLCGRNELDHFFCEVLPLLKLACVDTTVNESEIFFVSVITLFIPVAVIMFSYSQ
IVRAVLRIKSSAGQRKAFGTCGSHLTVVSLFYGSALYAYLHPSSNDSQDQGKFISLFYTIITPMINPLIYTLRNKEVKGAMRRVLWKDSASR*
291 >lcl|XP_001928948.1|Plus1complement(163409..164353) NW_003535165 olfactory receptor 2G6-like LOC100155320 __SEG__ Chr7 {Sus scrofa} MERANDSTFSGFILLGFSSRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCLTTCTVPQTVANFKGKDKSITYGGCVTQLFLALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGSSIVQTALTMTLPLCGKNQVDHFFCEVPAMLKLACTNTSINEAELFAVSVLFLVVPLSLILVSYGH
ITHAVLKLKSAQGRHKAFGTCGSHSMVVSVFFGTLISMYLQLPSSYSQDVNKSMALFYTLVTPLLNPLSYTLRNKEVKGALRRLVRRTPDSRQS*
292 >lcl|XP_001929118.1|Plus17226..8155 NW_003299867 olfactory receptor 10J5-like LOC100155689 __SEG__ Chr4 {Sus scrofa} MQRKNLTEVTEFIFLGFSRFHEHQITLFVVFLILYTLTLAGNAIIVTIIHMDRHLHTPMYFFLSMLASSETMYTLVIIPRMLTGLIAQNQPISLAGCTTQMFFFVTLAIN
NCFLLTVMGYDRYVAICNPLRYMVIMSKRVCVQLMCGAFGIGLAMAAVQVTSIFTLPFCHRVVGHFFCDILPVMKLSCIDTTINEIINFVVSLFVILVPMGLVFISYVLI
ISTILKIASAEGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENSVEQDLLLSVTYTIVTPLLNPVVYSLRNKEVKEALCRAVSKNIS*
293 >lcl|XP_001929165.1|Plus1<349820..350776 NW_003299867 olfactory receptor 10J1-like LOC100155243 __SEG__ Chr4 {Sus scrofa} LHFRFSGHSMKRENHTLTTEFSLQGFSSFQEHQLTLFVVFLALYILTLAGNIVIVTIIHIDHHLHTPMYFFLSMLSTSETIYTLVILPRMLASLVGVSQSISLAGCATQM
FLFVTFGITNCFLLTAMGYDHYVAICNPLRYTVMMNKRVCVQLVGGACSIGLIVAMTQVTSVFRLPFCAAKVAHFFCDIHPVMKLSCIDTTVNEILTLIISVLVLVVPMA
LVFISYVLIISTILKIASAEGRQKAFATCASHLTVVVVHYGCASIAYLKPKSENTKDQDQLISVTYTVITPLLNPVVYTLRNKEVKDALLRVIGRKLS*
294 >lcl|XP_001929193.1|Plus1complement(221608..222537) NW_003299867 olfactory receptor 10J1-like LOC100152040 __SEG__ Chr4 {Sus scrofa} MKNENHTVVSEFTFQGFTSFHEHQLTLFIVFFSLYTLTLAGNVIIVTVISADHHLHTPMYFFLSMLSASETVYTLIIIPKMLCNLVGLSQPISLAGCATQMFFFITLAIN
NCFLLAAMGYDRYVAICNPLRYTIMMNKRVCIQLVWGACSIGLIVAMTQVSAVFRLPFCTTKVAHFFCDIRPVMKLSCIDTTVNEILTLIISVLVILVPMGLVFISYILI
ISTILKIASAEGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENTMDQDQLISVTYTVITPLLNPVVYTLRNKEVKDALLRVIGRKLS*
295 >lcl|XP_001929238.1|Plus160265..61260 NW_003535236 olfactory receptor 6S1-like LOC100154303 __SEG__ Chr7 {Sus scrofa} MAPGGNQSNGVTEFILAGFPDLNSTKAELFSVFLLVYLLTLTGNVLIIGVVGADIHLQTPMYFFLGNLSCLEILLTSVIIPKMLSNFLLRQHTISFTGCITQFYLYFFLG
ASEFLLLAVMSVDRYLAVCHPLHYPLLMNGAVCCRVALACWMGGLFPVLGPTVAVALLPFCEQDAVVQHFFCDSGPLLRLACTNTRKLEETDFVLASLVIISSLLITAVS
YGHIVLAVLRIPSASGRQKAFSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVVTTFVTPLLNPFIYALRNERVKEALKDMFRKAIVRFWGDLLVAKCFSKKTV
K*
296 >lcl|XP_001929262.1|Plus1complement(623251..624198) NW_003534689 olfactory receptor 11A1-like LOC100155213 __SEG__ Chr4 {Sus scrofa} MVILPWENQTVESFVLRGFSSIQELNIFLFMMFLVFYILIVSGNILIVLLVLFSHRLHTPMYFFLVNLSFLEIWYTSNIVPKMLIIILAKQKTISVSGCLAQFYFFGSLA
ATECLLLAVMSYDRYLAICQPLHYPILMTGPFCVRLAASSWLCCFLLTAVTMVLLSRLTFCGPNEIDHFFCDFTPLVHLSCMDTSLTEMVAYSTSSAVTLFPFLLITASY
SCILAVILRIPSGTGRQKAFSTCSSHLTVVIVFYGTLIATYLVPSANSSQLLRKGFSLLYTILTPMFNPLIYSLRNRDILEALKKCWSKKPDFLV*
297 >lcl|XP_001929318.1|Plus12700613..2700891 NW_003534665 dolichol-phosphate mannosyltransferase subunit 3-like isoform 1 LOC100153065 __SEG__ Chr4 {Sus scrofa} MTKLAQWLWGLALLGSTWAALTMGALGLELPSSCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGMRF*
298 >lcl|XP_001929429.1|Plus1172531..173478 NW_003535238 olfactory receptor 4K3-like LOC100154725 __SEG__ Chr7 {Sus scrofa} MAWNNQSVIREFILQGLSSAWELQIFYFLFFSIVYAATVLGNLLILLTIVSEPRLHSPMYFLLGNLSFIDMSLASFATPKMIADFLSEHKAISFEGCITQIFFLHFLGGT
EIVLLISMSFDRYVAICKPLRYLTIMSRRMCVGLVTLSWIVGIFHAMSQLAFTVNLPFCGPNEVDSFFCDLPLVIKLACVDTYILGVFMISTSGMIALVCFILLVISYTV
ILVTVRQHSSGGSSKALSTCSAHFTVVALFFGPCIFIYVWPFTNFPIEKVLSVFYTIFTPLLNPVIYTLRTKDVKDSMRKLSSRVFKSRKTDHTP*
299 >lcl|XP_001929433.1|Plus1complement(209086..210018) NW_003535238 olfactory receptor 4M1-like LOC100153496 __SEG__ Chr7 {Sus scrofa} MEPANYTSVSEFVLTGLSPTQEVQLVLFVIFLSFYLFILPGNILIICTIRLDPHLTSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGAS
EMFLLTVMAFDRYAAICCPLHYATIMNQHLCCILVAFSWMGGFIHSIIQVALIVRLPFFGANELDSYLRQVVQIACVNTLLEELVMIFSSGLISVVCFIALLMSSAFLLA
MLKKHSGSGESTSRATSTCYSHITIVVLMFGPSIYIYAHPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKTAMRKLINRYILCKEK*
300 >lcl|XP_001929436.1|Plus1233938..234843 NW_003535238 olfactory receptor 4K3-like LOC100151889 __SEG__ Chr7 {Sus scrofa} MEEVNQTVVSEFILLGLCDTWELQAFLLLVFPLLYLITILGNNFTVLLIISDLHLHSPMYFLLANLSFIDFCLSTVITPKMITDFLKEHKTISFGGCMCQIFFGHFLGGS
EMVLLVLMAYDRYVAICKPLHYSSIMNKQMCIWLVMTSWITGFVHSISQLAIIIKLPFCGPRELDSFFCDIPLVIKLACMDTYILEKLINADSGVLATTCFTLLLISYTY
ILLTVCHQSKDGASKALSTCTAHITVVVLFFGPCIFIYLCPLGITWVDKFLAVFYAVITPLLNPAIYTLRNKEIKIAIKRL*
301 >lcl|XP_001929446.1|Plus1323758..324693 NW_003535238 olfactory receptor 4F15-like LOC100155936 __SEG__ Chr7 {Sus scrofa} MGGLNDSVVTEFVLLALSCSWEKKVFLTLICSLLYLGVILGNLLILFLVIFDSHLHSPMYFLLVNLSLIDVGLSSTTVPKIITDLLNDDTVISFQSCMTQICFIHTIGGA
EMVLLIAMAFDRCTAICKPLHYLKIMNPKTCVSFVITGWVTGVIHAMSQFLFVIKLPFCGPNKVDSFYCDFPKIIKLACTDGAELEFIVTANSGFMSMGTFFLLILSYSF
ILITVWKRSSRDLSKAFVTLSSHITVVFLFFTPCMFLYVWPSAPPSLDKNLFIVDFAITPVLNPAIYTLRNKDIKVAIKRLCKKISYSRFC*
302 >lcl|XP_001929456.1|Plus181528..82466 NW_003535239 olfactory receptor 4F21-like LOC100155559 __SEG__ Chr7 {Sus scrofa} MDGANHSVVSEFVFLGLTNSWEVQLLRFVFISTFYIASMMGNSVIMLTVTSDPHLHSPMYFLLANLSFLDLGVYSATSPKMIYDLFRKHKVISFSGCIAQIFFINVIGGV
EGVMLITMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFRGPNVLDSFYCDLPRLIKLACTDTYQLESMVTANSGFISVGSFIILIISYIV
LILTVQKHSSAGSSKALSTLSAHIAVVVLAFGPFIFVYTWPSASIPLDKFLAIFDSVLTPFLNPVIYTFRNQEMKVAMRRVCRQLVSYRKIS*
303 >lcl|XP_001929464.1|Plus1141677..142615 NW_003535239 olfactory receptor 4F3/4F16/4F29-like LOC100154334 __SEG__ Chr7 {Sus scrofa} MDGANHSMVSEFVFLGITNSWEIQLLLFLFSSVFYVASMMGNSLIMLTVTSDRHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKHKVISFSGCITQIFFIHIIGSV
EMALLIAMAFDRYVAICKPLHYLTVMSPRMCILFLVTAWIIGLIHSLVQLAFVVKLPFCGPNVLDSFYCDFPRFIKLACTDTYRLEFMVTANSGFISLGSFFILIISYIF
ILITVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFAYIWPHPTSHLDKFLAAFDAVLTPFLNSVIYTFRNKEMKMAMRKVCSQIFIYRRIS*
304 >lcl|XP_001929482.1|Plus1complement(103627..104562) NW_003535240 olfactory receptor 4F21-like LOC100151929 __SEG__ Chr7 {Sus scrofa} MDGANHSMVSEFLFLGLTNSWERQLLFLFSSIFCVAGMMGNAFILLTVTSDPHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKCKVISFSGCITQIFFIHVIAGVE
MVLLIAMAFDRYVAICKPLHYMTIMSRKMCILLLVAAWIIGLTHSVVQLTFVIKLPFCGPDILDSFYCDLPWFIKLACIDTYRLEFIVTVNNGFISLGSFFILIISYVFI
LIVVWKHSSGVSFKALSTLSTHVMVVILFFGPCIFVYIWPHPTSHLDKFLAIFDAVLTPFLNSVIYTFRNKEMKVAMRKVCSQFINYRRIS*
305 >lcl|XP_001929495.1|Plus1complement(423998..424897) NW_003535240 olfactory receptor 4L1-like LOC100153467 __SEG__ Chr7 {Sus scrofa} MDLKNGSVVTKFILLGFSVGWELQFVFLVTFSLIYGATVLGNVIMLTVTFSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMIRDLLTKHKVISMWGCMAQMFFTHCFGGAE
ATLLIAMAFDRYVAICKPLHYRTIMSHKLLKGFVILSWTIGFIHTMSQMVLTVNLPFCGPHIIDNIFCDLPLVIKLACMDTYTLELFVIADSGLLSFICFLLLLVSYTVI
LVTVQQRSSGGLSKALSTLSAHITVVTLFFGPCIFIYAWPFSSFAGNKIFSVFYTVITPLLNPIIYTLRNEKMQEAMRK*
306 >lcl|XP_001929497.3|Plus1complement(118136..119062) NW_003535167 olfactory receptor 12D2-like LOC100152893 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAVYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKMLGNFLSSHKAISFWGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLRYTLIMNPWVCTQMAATVWIIGFFHALMHSIMTSRLHFCGSNHIHHFFCDIKPLLKLACGNTELNQWLLNTVTGTIAMGPFFLTLLSYFYII
IHLFFKTHSCSMLHKALSTCASHFMVVVLLYAPVIFTYIRPASSSSMDQDWIIAIMYSVVTPVLNPLIYTLRNKEVKGALKRVFRNGL*
307 >lcl|XP_001929499.1|Plus1181286..182239 NW_003535168 olfactory receptor 5V1-like LOC100152520 __SEG__ Chr7 {Sus scrofa} MDGKNQTALSEFIILGFSNLNQLQFLLFTIFFLTYICTLGGNTFIILVTVVDPRLHTPMYHFLGNLAFLDICYTTTNVPQMMAHLLSEKKSISYGGCMAQLFAFIFFVGS
ECLLLAAMAYDRYVAICKPLRYSVIMNKVLYSQLAASCWSGGFLNSAVHTVLAFRLPFCGNNQINYFFCDIPPLLVLSCGDTSVNELALLSIGVVIGWTPFLCIVLSYLY
IISTILRIRSSKGRQKAFSTCASHLTIVLLYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMLNPIIYTLRNKDIKEAMKAVGRKWQLPLLSFDV*
308 >lcl|XP_001929506.1|Plus1147451..148401 NW_003535168 olfactory receptor 12D3-like LOC100156546 __SEG__ Chr7 {Sus scrofa} MENVTTGNEFLLLGLTGVQMLRPFFFVIFLMVYLINLVGNGAILVIAILEPKLHSPMYFFLGNLSCLDICYSSVTLPKVLVNLLSTHRAIFFLGCITQLHFFHFLGSTEA
ILLAIMAFDRFVAICNPLRYTVIMNPQMCILLAVVAWITSFFYALMHSLMTARLNFCHSHKLNHFFCDVKPLLELACNNTLLNQRLLSVVTGSISMGAFFLTLLSYFYII
CSLLFKNKSCRILHKALSTCASHFMVVCLFYGPVGFTYTRPASATSMSQDRMVAIIYSAVTPVLNPLIYTLRNKEVMLALKKTFGSKLLEYCQQHH*
309 >lcl|XP_001929510.1|Plus1complement(126758..127684) NW_003535168 olfactory receptor 12D2-like LOC100155349 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIMAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYATVTLPKMLGNFLSSHKAISFWGCISQLHFFHFLGSTEV
LLLAVMAFDRFVAICKPLRYTLIMNPRGCTQMAVTVWIIGFLYALLHSVMTSHLNVCGSNHIHHFFCDIKPLLELACGNIELNQWLLNTVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSRLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKGALRRVIRRRL*
310 >lcl|XP_001929515.2|Plus1complement(<4..816) NW_003535168 olfactory receptor 12D2-like LOC100152891 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAVCLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKMLGNFLSSHKEISFWGCISQLHFFHFLGSTEA
LLLAVMAFDRFVAICKPLRYTLIMNPRVCTQMAVTVWVIGFFHALMHSIMTSRLHFCGSNYIHHFFCDIKPLLKLACGNIELNQWLLNTVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVFLFFAPVVFTYICPTSGGSMDQDR
311 >lcl|XP_001929516.1|Plus1complement(8673..9599) NW_003535169 olfactory receptor 12D2-like LOC100158133 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPRMLGNFLSSHKAISFWGCISQLHFFHFLGSTEG
LLLAVMAFDRFVAICKPLRYTLIMNPQICAQMAVTVWITGFLYALLHSVMTSHLNFCGSNHIHHFFCDIKPLLKLACGNIELNQWLLNTVTGTIAMGPFFLTLLSYFYII
IHLFFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKGALSRVIRRRL*
312 >lcl|XP_001929521.1|Plus129615..30565 NW_003535169 olfactory receptor 12D3-like LOC100156948 __SEG__ Chr7 {Sus scrofa} MENVTTGNEFLLLGLTGVQMLRPFFFVIFLMVYLINLVGNGAILVIAILEPKLHSPMYFFLGNLSCLDICYSSVTLPKVLVNLLSTRRAISFLGCITQLHFFHFLGSTEA
ILLAIMAFDRFVAICNPLRYTVIMNPQMCILLAVVAWITSFFYALMHSLMTARLNFCHSHKLNHFFCDVKPLLELACNNTLLNQRLLSVVTGSISMGAFFLTLLSYFYII
CSLLFKNKSCRILHKALSTCASHFMVVCLFYGPVGFTYTRPASATSMSQDCMVAIIYSAVTPVLNPLIYTLRNKEVMLALKKTFGSKLFEYCQQHH*
313 >lcl|XP_001929522.1|Plus139398..40336 NW_003535169 olfactory receptor 12D3-like LOC100155747 __SEG__ Chr7 {Sus scrofa} MENVTTVDEFLLLELTSNQELQPIIFMTLLVVYIIDLFGNGSILVVVTSEPRLYSPMYFFLGNLSCLDICYSSVTLPMLMANLFSTHKAISFLGCISQLHFFHFLGGTEA
LLLAVMGFDRFVAICYPLRYTVIMNLRVCILLAAVAWITSFFYALMHSVMTARLNFCHSLKLSYFFCDVKPLLELACGDIWLNRWLIFIVTGSLSMAACFLTLLSYFYII
TFLLLKHRSCHMLHKALSTCASHFMVVSLFYGTVGLTYIPPASATSVSQARYVAVIHTTVTSVLNPLIYTLRNKEVKLALRRVFGRKWKLSV*
314 >lcl|XP_001929531.1|Plus162469..63407 NW_003535169 olfactory receptor 12D3-like LOC100154526 __SEG__ Chr7 {Sus scrofa} MENVTTVDEFLLLELTSNQELQPIIFMTLLVVYIIDLFGNGSILVVVTSEPRLYSPMYFFLGNLSCLDICYSSVTLPMLMANLFSTHKAISFLGCISQLHFFHFLGGTEA
LLLAVMGFDRFVAICYPLRYTVIMNLRVCILLAAVAWITSFFYALMHSVMTARLNFCHSLKLSYFFCDVKPLLELACGDIWLNRWLIFIVTGSLSMAACFLTLLSYFYII
TFLLLKHRSCHMLHKALSTCASHFMVVSLFYGTVGLTYIPPASATSVSQARYVAVIHTTVTSVLNPLIYTLRNKEVKLALRRVFGRKWKLSV*
315 >lcl|XP_001929536.1|Plus181291..82244 NW_003535169 olfactory receptor 5V1-like LOC100153316 __SEG__ Chr7 {Sus scrofa} MDGKNQTALSEFIILGFSNLNQLQFLLFTIFFLTYICTLGGNTFIILVTVVDPRLHTPMYHFLGNLAFLDICYTTTNVPQMMAHLLSEKKSISYGGCMAQLFAFIFFVGS
ECLLLAAMAYDRYIAICKPLRYSVIMNKVLYNQLAASCWSGGFLNSAVHTVLAFRLPFCGNNQINYFFCDIPPLLVLSCGDTSVNELALLSIGVVIGWTPFLCIVLSYLY
IISTILRIRSSKGRQKAFSTCASHLTIVLLYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMLNPIIYTLRNKDIKEAMKAVGRKWQLPLLSFDV*
316 >lcl|XP_001929618.1|Plus1248252..249328 NW_003301250 testis-specific serine/threonine-protein kinase 2-like LOC100156779 __SEG__ Chr14 {Sus scrofa} MDDAAVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHRSIIKTYEIFETSDGRIYIVMELGVQGDLLEFIKCRGALHE
DVARKMFRQLSSAVKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDGTGRIILSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSD
IKKMLRIQKEHRVDFPRSKNLTGECKDLIYRILQPDVNRRLHIDEILSHSWLQPPKPKAMSSASFKREGEGKYRAECKLDTRPGSRPEHRPDHKLGAKTQHRLLLVPENE
DKMEDRLAETSRVKDHHVSGAEVGKAST*
317 >lcl|XP_003121162.1|Plus1complement(487926..488903) NW_003533895 proto-oncogene Mas-like LOC100522470 __SEG__ Chr1 {Sus scrofa} MDEANGTSFVTEGSSNASTSRNASAGDPRREIPMVHWVILSISPLGFVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSVDYALDYELSSGYYYTIVTLSV
TFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKHQSALVCALLWALSCLVTTMEYVMCIDREGQAHSRSDCRAVIIFIGVLSFAVFTPLMVVSSSILVVKIRKTAWA
SPSSKLYLVITVSIIVFFIFAVPMRLLYLLYYEYWSTFRNLHHVSLLFSTINSSANPFIYFFVGSSRKKRFKESLKVVLTRAFKDEMQPRRPGDATATPATETVV*
318 >lcl|XP_003121340.2|Plus1complement(2127540..2128958) NW_003533942 cannabinoid receptor 1 CNR1 __SEG__ Chr1 {Sus scrofa} MKSILDGLADTTFRTITTDLLYVGANDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSYKENDENIQCGENFMDMECFMI
LNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHR
PLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVT
RPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTA
SVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL*
319 >lcl|XP_003121402.1|Plus1164185..165285 NW_003299227 G-protein coupled receptor 6-like LOC100511485 __SEG__ Chr1 {Sus scrofa} MNASASSLNDSQVVAVAAEGVAAVATAARAPDVGEWGPPAAAAAAAALGAGGAANASLELSSQLPAGPPGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTP
MFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHFLLAATWTVSLGLGLLPVLGWNCLAERAAC
SVVHPLTRSHVALLSATFFAVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINP
IIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV*
320 >lcl|XP_003121788.2|Plus11456877..1457410 NW_003534056 mothers against decapentaplegic homolog 6-like LOC100516659 __SEG__ Chr1 {Sus scrofa} MSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKV
PPGYSIKVFDFERSGLLQHGPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNHR*
321 >lcl|XP_003122039.1|Plus1complement(760208..761167) NW_003534138 putative olfactory receptor ENSP00000348552-like LOC100513390 __SEG__ Chr1 {Sus scrofa} MASANQTASVTKFILLGLSAHPKLEKTLFVLILLTYLVILLGNGLLILVTILDSRLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFPACAMQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPVVMRKSVYVPMASSSWAAGSAASMVQTSLAMRLPFCGDNVINHFTCEILAVLKLACADISINVISMGVTNVLFLGVPVLFIFISYI
FILTTILRIPSAEGRKKAFSTCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKEDLADKLTSLFYGVVTPMLNPIIYSLRNKDVKVAVRSLVSQKLFTQ*
322 >lcl|XP_003122042.1|Plus1864641..865600 NW_003534138 olfactory receptor 2S2-like LOC100514385 __SEG__ Chr1 {Sus scrofa} MDRSNQTSPMVQFILLGLSAHPKLEKTFFVLILLMYLVILLGNGLLILVTILDPRLHTPMYFFLGNLSFLDICYTTSSVPLVLDGFLTPRKTISFSGCAIQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPIVMSKAAYVPMATSSWAAGIANSVVQTSQAMQLPFCGDNVINHFSCEILAVLKLACADISINVISMVVSNVIFLGVPVLFIFISYV
FIIATILRIPSAEGRKKAFSTCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLTSLFYGMVTPMLNPIIYSLRNKDVKAAVRNLVRQKHLTE*
323 >lcl|XP_003122043.1|Plus1884118..885080 NW_003534138 putative olfactory receptor ENSP00000348552-like LOC100514559 __SEG__ Chr1 {Sus scrofa} MDRSNQTSSLVGFILLGLSAHPKLEKTLFVLILLMYLVILLGNGLLILVTILDSRLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTIPFSACFGQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPVVMRKATYVPMAASSWAAGIINTAVQTLQAMQLPFCGDNVINHFSCEILAVLKLACADISINVISMVVSNVLFLGIPVLFIVFSYV
FIIAAILRIPSAEGRRKAFSTCSAHLTVVVIFYGTIVFMYAKPKSKDPLGTDKQDLADKLTSLFYGVVTPMLNPIIYSLRNKDVKAAMKKLVHQKHLTEV*
324 >lcl|XP_003122044.1|Plus1complement(746830..747789) NW_003534138 putative olfactory receptor ENSP00000348552-like LOC100514941 __SEG__ Chr1 {Sus scrofa} MGRSNGTSSVVGFTLLGLSAHPKLEKMFFVLILLTYLVILLGNGLLILVTILDPRLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTIPFPACAMQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPIVMSKAVYVPMAVSSWAAGSTTATVQTSLAMQLPFCGDNIINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFISFSYM
FIIITILKIPSAEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKSKDPLGADKQDLADKLTSLFYGVVTPMLNPIIYSLRNKDVKAAMRNLVTQKCFTQ*
325 >lcl|XP_003122047.1|Plus1996401..998167 NW_003534138 calicin-like LOC100515522 __SEG__ Chr1 {Sus scrofa} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLISNHDMKTTDELFITIDPNYLSPTTVDHLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGSLHFMRCPPVIFGRLLRDENLHVLNEDQALQALLSWVYFRKDEREKYFKKFF
NYINLNAVSNKTLMYASNKLMGMENSSAHSTLIESVLVDRKQERPTSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATAAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIFRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTNTGDVVQCITFPIEFNHRPLLSFHQDNILCVYSHRQSVEINLQKIKANKTTTSVPLLPNNCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
YLLDQKTGEWKTLAPPPEALDCPACCLAKLPCKILQRI*
326 >lcl|XP_003122058.1|Plus1complement(658475..659413) NW_003534138 olfactory receptor 13J1-like LOC100518591 __SEG__ Chr1 {Sus scrofa} MELANWTEVSAFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNVAIVAVSVLDAHLHTPMYFFLGNLSILDICFTSSFVPLMLVHLLSVQKTISFIGCAIQMCLGLSTGST
ECVLLAVMAYDRYLAICQPLRYPVLMSHRLCLLLAGAAWVLCLLKSVAETVIAMRLPFCGHHVVSHFSCEILAVLKLACSDTSVNEGFLLVGAILLLPLPLAFICLSYTL
ILATVLRVPSAAGRRKAFSTCSAHLAVVLLFYGTVIFIYMKPKSKEARVSDEVFTVLYAVVTPMLNPIIYSLRNKEVKEAARKVWGRTWTSW*
327 >lcl|XP_003122059.1|Plus1complement(781520..782476) NW_003534138 putative olfactory receptor ENSP00000348552-like LOC100518764 __SEG__ Chr1 {Sus scrofa} MQVVNQSIVTGFVLLGLSDQPKLEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLRNLSFLDICYTTSSVPLILDGFLTPRKTISFSGCAIQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPMVMSKATYVPMAASSWLAGGANSLVQISLAVQLPFCGDNVINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIF
ILTTILKIPSAEGRKKAFSTCSAHLTVVILFYGTILFMYAKPKSKDPLGADKQDVSDKLISLLYGVLTPMLNPLIYSLRNKDVKVAVKNLKSQKCYPH*
328 >lcl|XP_003122063.1|Plus1complement(728876..729835) NW_003534138 olfactory receptor 2S2-like LOC100519461 __SEG__ Chr1 {Sus scrofa} MEKANQTSPVVGFILLGLSAHPKLEKMFFVLILLMYLVILLGNGLLILVTILDSRLHTPMYFFLGNLSFLDICYTTSSVPLVLDGFLTPRKTISFSGCAIQMFLSFAMAG
TECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAVSSWAVGGVASLVHTSLAIQLPFCGDNIINHFACEILAVLKVACADISINVISMAVTNVIFLGVPVLFISVSYV
FIIATILRIPSAEGRKKAFSTCSAHLTVVVIFYGTLFFMYGKPKSKDPLGADKEDLADKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVKNLVAQKHSSH*
329 >lcl|XP_003122096.1|Plus179292..79804 NW_003299402 calcineurin subunit B type 2-like LOC100516056 __SEG__ Chr1 {Sus scrofa} MGNEPSNPMEMCSQFDQNEIKQLSKRFKKVDLDSSGTLTMKELMSLPGLQVNPLVQRVFDIFDTDGNGEVDFKEFLVGTSQFSVKGDKEQKLRFAFSIYDMDKDGYISNG
ELFQVLNMMVGDNLKDWQLQQLVDKTIIALDKDGDGKISFHEFCAVARNLKVHEKLGVIV*
330 >lcl|XP_003122101.1|Plus1108002..108943 NW_003534146 olfactory receptor 13F1-like LOC100518052 __SEG__ Chr1 {Sus scrofa} MFQANLTSVTVFFFLGFSHYPNAEVIIFVLCLLMYLTTLLGNIILISVSVLDSRLHTPMYFFLSNLSFLDIWYTSSALTPMLANFVAGKNTISFSGCAAQMYFSLAMGST
ECVLLSLMAYDRYVAICNPLRYPIIMNKRVCVQIAAGSWVTGCFTALVETVSVLQLSLCGNSIINHFTCEILAVLKLVCGDTSKVEFIMLVISVLLLPMPMLLVCISYGF
IVSSIVRISSVDGRSKAFSTCAAHLTVVVLFYGIALSMYLKPSAVDSQEIDKFMALVYGGLTPMLNPIIYSLRNKEVKAVMKKLLMRSSLVLS*
331 >lcl|XP_003122106.1|Plus1242610..243563 NW_003534146 olfactory receptor 13C3-like LOC100520168 __SEG__ Chr1 {Sus scrofa} MERTNWTEIEFILQGLSEYPRAEKFLFVICLVMYLVILLGNSTLIILTLLDARLHTPMYFFLGNLSFLDIWYTSSFIPSMLIHFLSEKKSISFTRCVVQMSVSYTMGSTE
CVLLAVMAYDRYVAICIPLRYPIIMSKALCIQMAALSWGLGFLNSLTETILAVRLPFCGKNAINHFVCEILAFVKLACTDISLNEITIMLGNVLFLFSPLLLICVSYIFI
LSTVLRINSAEGRKKAFSTCSAHVTVVTVFYGTILFMYMKPKSKDSAFDKLIALFYGVVTPMLNPIIYSLRNTEVHGAMRKLMTRLVWEERMRNLHL*
332 >lcl|XP_003122171.1|Plus1404627..405568 NW_003534164 olfactory receptor 1J4-like LOC100517451 __SEG__ Chr1 {Sus scrofa} MRSQNQSIVSKFILLGLPIHPEQQGMFFALFLGIYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDQSIPYAGCVTQVYFFIFFACI
DNLLLAVMAYDRYVAICHPLRYTIIMREELCLCLLAGCWLLSCAYALTHTLLLAQLSFCADNIIPHFFCDLASLFKLSCSDTSLNELVIFSAGAAVFIFPLSGILVSYGR
IGISILRVPSTKGIFKALSTCGSHLSVVSLFYGTIMALYFSPSSGQSHDKGIIASVMYTVVTPMLNPFIYSLRNRDMTLALGIIFRNNNLFTT*
333 >lcl|XP_003122172.1|Plus1complement(368997..369941) NW_003534164 olfactory receptor 1L8-like LOC100517802 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFTLFLTIYLVTITGNLLIILAIRSDPQLQTPMYFFLTFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFIYALGNT
DSCLLVVMAFDRYVAICDPFHYVTIMSHHRCVLMVALSCSLPHLHSLLHTLLLNQLTFCESNIIHHFLCDFSPLVKLSCSPTSVNEIVMMIEGSFFLGTPFLCIAFSYIR
ILTVVLKIPSAAGKCKAFSTCGSHVTVVTLFYGSIFYVYLQPVSSYTIRDHMATIVYTVLTSTLNPFIYSLRNKDLKQGLRKLVGRSKFQATSP*
334 >lcl|XP_003122173.1|Plus140957..41898 NW_003534165 olfactory receptor 1J4-like LOC100518354 __SEG__ Chr1 {Sus scrofa} MRRENQSSISEFLLLGLPIQTEQQGIFFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLAFSDISFSSVTVPKMLMNMQTQDQSISYAGCIAQMYFFIFFTVL
DDFLLTSMAYDRYVAICHPLHYTTIMREGLCTLLVTVSWILSSANALCHTLLLTQLSFCADNTIPHFFCDFGALLKLSCSDTSLNELVIFTVGLAVITLPLICILVSYGH
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFVPSSSASSPKDTISSVMYTVVTPLLNPFIYSLRNRDMKGALEKLFHKAAVLSQ*
335 >lcl|XP_003122174.1|Plus147102..48043 NW_001886053 olfactory receptor 1J4-like LOC100519071 __SEG__ Chr1 {Sus scrofa} MRRENQSSMSEFLLLGLPTQPEQQGILFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALSDISFSSVTIPKMLKNMQTQDQSIPYAGCITQTYLFMFFGCI
DNLLLAVMAYDRYVAICHPLHYAIIMREELCLCLLAGSWLFSCAAALTHTLLLAQLSFCADNIIPHFFCDLAALVKLSCSDTSLNELLIFTLGPAVVIFPLSGILVSYGH
IGLSILKVPSMKGICKALSTCGSHLSVVSLFYGTMMAVYFSSSSGQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGLVFRKSNILAK*
336 >lcl|XP_003122175.2|Plus1complement(180790..181731) NW_001886053 olfactory receptor 1J4-like LOC100519586 __SEG__ Chr1 {Sus scrofa} MRRENQSSISEFLLLGLPIQTEQQGLFFALFLGMYLTTMLGNLLIILLIRLDTRLHTPMYFFLSHLAFSDISFSSVTVPKMLMNMQTQDQSISYAGCIAQMYFFIFFTVL
DDFLLTSMAYDRYVAICHPLHYTTIMREGLCTLLVTVSWIHSSANALCHTLLLTQLSFCADNTIPHFFCDFGALLKLFCSDTSLNELVIFTVGLAVITLPLTCFLVSYGR
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFVPSSSASSPKDTISSVMYTVVTPLLNPFIYSLRNRDMKGALEKLFHKAAVLSQ*
337 >lcl|XP_003122176.1|Plus1complement(184112..185053) NW_001886053 olfactory receptor 1J4-like LOC100519758 __SEG__ Chr1 {Sus scrofa} MRRENQSSMSEFLLLGLPTQPEQQGILFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALSDISFSSVTIPKMLKNMQTQDQSIPYAGCITQTYLFMFFGCI
DNLLLAVMAYDRYVAICHPLHYAIIMREELCLCLLAGSWLFSCAAALTHTLLLAQLSFCADNIIPHFFCDLAALVKLSCSDTSLNELLIFTLGPAVVIFPLSGILVSYGH
IGLSILKVPSMKGICKALSTCGSHLSVVSLFYGTMMAVYFSSSSGQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGLVFRKSNILAK*
338 >lcl|XP_003122177.1|Plus1139737..140675 NW_003534165 olfactory receptor 1J4-like LOC100520823 __SEG__ Chr1 {Sus scrofa} MRRENQSHVSEFLLLGLPIWPEQQGVFFVLFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDISFSSVTVPKMLMNMQTLDQSIPYAECVTQMYFFLFFSGL
DDFLLTSMAYDRYVAICHPLHYTTIMREGLCSLLVSVSWIFSLANALCHTLLLAQLSFCADYTIPHFFCDLGALLKLSCSDTSLNELVIFTVGLAVITLPLMCILVSYGH
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFVPSSSTSSDKDIVASVMYTVVTPLLNPFIYSLRNRDMKRALEKLFKKPSVLC*
339 >lcl|XP_003122178.1|Plus1complement(317703..318680) NW_001886053 olfactory receptor 1G1-like LOC100523884 __SEG__ Chr1 {Sus scrofa} MGIRNQTTTSDFLLLGFSPHPDQQALLFGLFMAMYLITMLGNVLVILGIGSDQHLHSPMYFFLANLSFIDTCSCCTIVPKVLVNIQTQHHTISYTGCLVQMYFFMALTLL
DDFLLAVMAYDRYVAICLPLHYTMIMCPQRCLLLVTTSWLCAHLLAFSPTLLMSQFSFCDSHSIPHFFCDLLPLLNLACSDKHIFQVTMLTEAILSGAIPLTCVLISYAH
IIHTILRVPSPGGKHKVFSTCGAHLTVVTLFYGTLFLVYFQPSSSYSADTGMVSSVIYTVVTPMLNPFIYSLRNRDMMEALCRFFNCGKVLLSKRAFPRLEAQSL*
340 >lcl|XP_003122179.1|Plus155685..56623 NW_003299422 olfactory receptor 1L4-like LOC100524066 __SEG__ Chr1 {Sus scrofa} METKNYSSSSMSDFILLGISSNPHLQKPLFAVFLIMYLVTLVGNVLIILAIHSDARLHTPMYFFLSNLSFMDICFTTVIVPKMLVNLLSETKSISYVGCLVQMYFFMAFA
NTDSYLLASMAIDRLVAICNPLHYDVAMSPRHCLLLLLGSCTISHLHSMLRVLLMSRLAFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIATPFLCILFSY
LRIIFTVLRVPSVAGKWKAFSTCGSHLSVVVLFYGSVIYVYFRPLSMYSVVKDRVATVMYTIVTPMLNPFIYSLRNKDMKRGLRKLRDRIHS*
341 >lcl|XP_003122180.1|Plus1212154..213101 NW_003299422 olfactory receptor 1J4-like LOC100524234 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSMSKFVLVGLHIWPEQQGMVFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLAFSDVSFSSVTVPKMLMNMQTQDQSIPYAGCVTQTYFFIFFS
CIDNLLLAVMAYDRYVAICHPLRYAIIMKEELCLCLLAGSWLLSCAYALTHTLLLAQLSFCADNIIPHFFCDLASLIKLSCSDTSLNELVIFSLGPAVFIFPLSGILVSY
GCIVVSILSVHSPKGIFKALSTCGSHLSVVSLFYGTSMAVYLSSSSGQSHDKDTIASIMYTVVTPLLNPFIYSLRNRDMTLALQILFRNSNLLAK*
342 >lcl|XP_003122181.1|Plus1259934..260875 NW_003299422 olfactory receptor 1J4-like LOC100524604 __SEG__ Chr1 {Sus scrofa} MRRMNQSSVSEFLFLGLPIWPKQQGVFFALFLGVYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMDMHTEYKSIGYSSCIAQMYFFIFFTDL
ENFLLTSMAYDRYVAICHPLHYTTIMREGLCTLLITVSWILSCANALGHTLLLAQLSFCDDNTIDHFFCDLSALLKLSCSDTSLNELVIFTVGLAVIILPLTCILVSYGH
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFVPSSSTSSDKDIIASVMYTVVTPLLNPFIYSLRNRDMKGALKKLFHKAAVLSQ*
343 >lcl|XP_003122183.1|Plus1491978..492919 NW_003299422 olfactory receptor 1J4-like LOC100525147 __SEG__ Chr1 {Sus scrofa} MKRENQSSVSKFLLLGLPIWPEQQDMFFSLFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALSDVCFSSVTVPKMLTNMQTQDQSISYAECIAQMYFFIFFTVL
DNFLLTSMAYDRYVAICHPLHYTNVMREGICTLLVTVSWLLSCGDALCQTLLLTQLSFCDDNTIPHFFCDLDVLLKLSCSDTSLNELAIFTVGLAVITLPLVCILVSYGC
IGATILKVPSTKGVCKALSTCGSHLSVVSLYYGTIMGVYFSPLSSTSNDKDIITSVMYTVVTPLLNPFIYSLRNRDMKRALVKLFHKGAVLSQ*
344 >lcl|XP_003122184.1|Plus1293501..294442 NW_003299422 olfactory receptor 1J4-like LOC100525502 __SEG__ Chr1 {Sus scrofa} MRRMNQSSVSEFLFLGLPIWPKQQGVFFALFLGVYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMDMHTEYKSIGYSSCIAQMYFFIFFTDL
ENFLLTSMAYDRYVAICHPLHYTTIMREGLCTLLITVSWILSCANALGHTLLLAQLSFCDDNTIDHFFCDLSALLKLSCSDTSLNELVIFTVGLAVIILPLTCILVSYGH
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFVPSSSTSSDKDIIASVMYTVVTPLLNPFIYSLRNRDMKGALKKLFHKAAVLSQ*
345 >lcl|XP_003122186.1|Plus1complement(321351..322289) NW_003299422 olfactory receptor 1J1-like LOC100513969 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFHLLGLPIRPEQQGMFFALFLGMYLTTVLGNLLIILLIRLDPHLHTPMYFFLSHLALTDISFASVTVPKMLINMQTQDQSIPYAGCISQTYCFILFADL
DSFLITSMAYDRYVAICHPLHYAIIMSQSMCVMLVAGSWIIACACALLHTLLLARLSFCADTIPHFFCDLAALLRLSCSDTYLNQLVIFTAGLTAIMLPFVCILISYGHI
GANVLRVPSTKGICKALSTCGSHLSVVILYYGAIIGLYFLPSSNNTNDSNIIASLMYTVVTPMLNPFIYSLRNKDMKGAWRKLWSKKTYFSN*
346 >lcl|XP_003122187.2|Plus1complement(12710..13645) NW_003534166 olfactory receptor 1J4-like LOC100517746 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPIQQEYWGLIFALLLGIYLTTVLGNLLIILLIRLDPHLHTPMYFFLSHLALTDVSFSSVTVPKILMSTQTQDQSIPYAGCITQMYFFIFFSCI
DNLLLVVMAYDRYVAICHPLRYTIIMMEELCICLLAGSWLLSCADALTHTLLLAQLSFCSDNIIPHFFCDLASLLKLSCSDTSLNELIIFTAGAFFSPLSGILVFYGHIG
VSILRAPSTKGIFKAWSTCGSHLSFVSLFYGTMMALYLSSSSGQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGILLRNSNLFAK*
347 >lcl|XP_003122188.2|Plus1complement(28488..29429) NW_003534166 olfactory receptor 1J4 LOC396794 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPIQPEQQAVFFALFLGMYLITVLGNLLIILLIRLDPRLHTPMYFFLSHLAFSDVSFSCVTLPKMLLNMQTQQQSISYVGCITQMYFFLLFICL
DNFLLAVMAYDRYVAICQPLHYRTIMRDGFCVLLVVGSWFFSCVHALLHTLLLSRLSFCADNAIPHFFCDFTAVLKMTCSDTSINELVIFIEGGLLTSLPLSAILGSYVR
IGASILRVPSMKRICKALSTCGSHLFVVFLYYGTIAMTYFFPSSYNSKVKGIIASVIYTVVAPMLNPFIYSLRNRDMKLALGILYRRAIIFAK*
348 >lcl|XP_003122190.1|Plus1complement(111047..111985) NW_003299424 olfactory receptor 1J4-like LOC100522178 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPIQPEQQSLFFALFLGMYLTTVLGNLLIIMLIRLDPRLHTPMYFFLSHLALTDISFSSVTVPKMLMYMHTHDQSIPYAGCISQMYFFSLFGCL
DNLLLAVMAYDRYVAICQPLHYTTVMRQELCVSLVAGSWVLCSILALLHTLLLVQLSFCAANTIPHFFCDLTSLLKLSCSNISISELVIFIVGGTLFILPLSSILGSYIH
IGTAVLRVSFTKSLFKVFSTCGSHLFVVSLYYGTIASVYFFSSSWESNDKDVIASFVYAVVTPMLNPFIYSLRNRDIKQAFEIFVNRANFLK*
349 >lcl|XP_003122192.1|Plus1complement(70912..71841) NW_003299424 olfactory receptor 1L1-like LOC100523301 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFALFFIMYVVTLVGNLLIILAIRSDTQLQTPMYFFLSILSFIDVCYTTTIVPKMLVNFLSKKSISYAECMTQMYFFLAVANT
ESYLLATMAIDRYVAICDPFHYVTVMSHRRCVLLVAFSCSISHLHSLLLVLLINHLLFCDSNVIQHFLCDINPLLKLSCSSTFVNEIVINTEGRTTLVTPFICVIISYLR
ILTAVLKIPSAAGKHKAFSTCGSHLTMVTLFYGSIIYVYFRPLSTYTIQDQVATVIYTVLSSMLNPFIYSLRNKGMKRGLGKLMSRRVS*
350 >lcl|XP_003122193.1|Plus141026..41964 NW_003299424 olfactory receptor 1J4-like LOC100523660 __SEG__ Chr1 {Sus scrofa} MRSQNQSIVSKFLLLGLPIHPEQQGMLFALFLGMYLTTVLGNLLIILLIRLDPCLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDQSILYLGCVTQVYFFIFFAFI
DNLLAVMACDRYVAICHPLRYTIIMREELCICLLAGCWLLSCAYTLTHTLLLAQLSFCVDNIIPHFFCDLAALLQLSCSDTSLNELVIFSAGAAVFIFPLSGILVSYGRI
GLSILRVPSMKGIFKALSTCGSHLSVVSLFYGTIMALYFSSSSGQSHDKGIIASVMYTVVTPMLNPFIYSLRNRDMTLALEILIRNKNLFTT*
351 >lcl|XP_003122194.1|Plus124126..25070 NW_003299424 olfactory receptor 1L8-like LOC100523835 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFTLFLTIYLVTITGNLLIILAIRSDPQLQTPMYFFLTFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFLYALGNT
DSFLLTVMAFDRYVAICDPFHYVTIMSHHRCVLMVALSCSLPHLHSLLHTLLLNQLTFCDSNIIHHFLCDLSPLMKLSCSSTFVNETVMMIERPILLVTPFLCITFSYIR
ILTVVLKIPSAAGKCKAFSTCGSHVTVVTLFYGSNFYVYLQPVSSYTVRDHMATIVYTVLSSMLNPFIYSLRNKDLKQGLRKLVGSRKLQAACS*
352 >lcl|XP_003122195.1|Plus1complement(91474..92415) NW_003299424 olfactory receptor 1J4-like LOC100524011 __SEG__ Chr1 {Sus scrofa} MRRENQSNVSKFLLLGLPIQQEQQGMFFALFLGVYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDISFASVTVPKMLMNMQAQDHSISYAGCVTQTYFFMFFACI
DNLLLTVMAYDRYVAICHPLRYTIIMREELCICLLAGCWLLSCAYALTHTLLLAQLSFCVDNIIPNFFCDLAALLQLSCSDTSLNELVIYTSGAAVFIFPPSGILVSYGR
IGISILRVPSTKGICKALSTCGSHLSVVSLFYGTIMALYFSPSFGQSHYKGIIASVMYTVVTPMLNPFIYSLRNRDMTLALEILIRNKNLFTT*
353 >lcl|XP_003122200.1|Plus1complement(21579..22517) NW_003534168 olfactory receptor 1J4 LOC396787 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPIQPQQQGMFFALFLGMYLITVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSLSSVTVPKMLMNMQTQQQSIPYAGCISQMYFFILFGCL
DNFLLTVMAYDRYVAICQPLRYSTIMRQELCVSLVAGSWFLCCIYALLHTLLLVQLSFCMDNTISHFFCDLTVLLKLSCSDTSLNDLVIFAVGGTLFILSLCSILGSYIH
IGTTVLSVSPTKKLFKICSTCGSHLFVVSLYYGTLATVYFFSSSWDSNDKDIIASAMYTVVTPMLNPFIYSLRNRDIKQALEILVNRANFLK*
354 >lcl|XP_003122353.1|Plus1115439..116377 NW_003299436 olfactory receptor 10AG1-like LOC100512945 __SEG__ Chr1 {Sus scrofa} MDHQKDLVDVNLTSIMEFVLLGFSDIPNLQMFLFVTFFFVYVITLLGNGIIIVIIGTDKALQTPMYFFLSNFSFLEICYVSVTLPRMLVNLWTQKRHISLFACATQMSFV
FTFGNIECLLLTVMAYDHYVAICDPLHYPLVMNHKACVQLVAACWITSALIEIGQTCQIFSLPFCRSNKINHFFCDIPPIFKLACGDTFLNEMLLFTIAVVFIMIPFLLI
LGSYSQIASTILKLPSAKGKAKAFSTCSSHVMVVTLFFGTAVIAYLQPKSKNSSRMDKFLSLFYTLVTPMFNPLIYSLRNKDVLMTLRKLVP*
355 >lcl|XP_003122355.1|Plus151399..52343 NW_003299436 olfactory receptor 5F1-like LOC100513518 __SEG__ Chr1 {Sus scrofa} MARKNHTLLTEFVLLGLADTLEQQITLFMLFLVMYTLTVLGNVGMILLIRMEARLHTPMYFFLAVLSFADVSYSSTITPKMLVDLLSEKKTISFAGCFLQMYFFITFATT
ECILFGLMAYDRYVAICNPLLYSLIMSRTVCLKMAAGALTAGLLNATVHTGYISSLPFCRSNVIHHFFCECPPLFKLSCSDTHLYEVIVSTITGVNTVGTLLVILTSYSY
ILFSIFRMHSGEGRHKAFSTCASHLTAIILFYSTGIYNYLRPTSSYSLNQDKVTSVFYTVVIPMLNPLIYSLRNKEVKKALWNGITRKSVPSFL*
356 >lcl|XP_003122356.2|Plus131584..32528 NW_003299436 olfactory receptor 5F1-like LOC100513907 __SEG__ Chr1 {Sus scrofa} MARKNHTLLTEFVLLGLADTLEQQITLFMLFLVMYTLTVLGNVGMILLIRMEARLHTPMYFFLAVLSFADVSYSSTITPKMLVDLLSEKKTISFAGCFLQMYFFITFATT
ECILFGLMAYDRYVAICNPLLYSLIMSRTVCLKMAAGALTAGLLNATVHTGYISSLPFCRSNVIHHFFCECPPLFKLSCSDTHLYEVIVSTITGVNTVGTLLVILTSYSY
ILFSIFRMHSGEGRHKAFSTCASHLTAIILFYSTGIYNYLRPTSSYSLNQDKVTSVFYTVVIPMLNPLIYSLRNKEVKKALWNGITRKSVPSFL*
357 >lcl|XP_003122358.1|Plus13164..4105 NW_003534192 olfactory receptor 8K3-like LOC100517140 __SEG__ Chr1 {Sus scrofa} METENLTTLNEFILMGITDRPELQAPLFGLFLLIYVILVVGNLGMVILTKVDSRLQTPMYFFVRHLAFTDLGCSTTVGPKMLVNFVVDRNAISYYSCATQLAFFIVFIIS
EHFILSAMSYDHYVAICHPLLYPVIMSQKVCWVLVAIPYLYSTFVSLLISIKIFNLSFCGYGVIRHFYCDIFPLLSLLCSNTHEVELIILISAGFNLITSLLIVLVSYLF
ILEAILRMNSAEGRHKAFSTCGSHLTVVTVFYGTLIFMHVQPESSHSFDTDKVASIFYTLIIPMLNSLIYSLRNKDVNCAIQRMWKKLCNFFS*
358 >lcl|XP_003122362.1|Plus127468..28427 NW_003534192 olfactory receptor 8K1-like LOC100520001 __SEG__ Chr1 {Sus scrofa} MNHMEKYNLTAVPKVTEFILMGITDNPGLQAPLFGIFLIIYLVTVMGNLGMVILTHLDSKLHTPMYFFLRHLSITDLGYSTVIGPKMMVNFVQSQNTISYHWCATQLAVF
EVFIITELFILSAMAYDRYVAICKPLLYVVIMAEKVCWGLVLTSYLYSTFVSLLLTIKLFKLSFCGSNIISYFYCDCLPLMSMLCSDTHELESIILIFSGCNLLSSLLIV
LVSYTFILMAILRMNSTEGRHKAFSTCSSHLTVVVVFYGTLLFIYLQPKSSHAFATDKMASVFYTLVIPMLNPLIYSLRNKEVKDALRRTLTNRCKIPN*
359 >lcl|XP_003122363.1|Plus122813..23754 NW_003534192 olfactory receptor 8K5-like LOC100520171 __SEG__ Chr1 {Sus scrofa} MGPQNLSLLTEFILMGVTRQPELQAPLFGIFLIIYTITVVGNLGMIILTQMDSHLHTPMYFFIKHLAFIDLGNSTVICPKMLVNFVVDPNTISYYACATQLTFFLMFIIS
EFFILAAMACDRYVAICNPLRYNVIMSQRLCHMLVGIPYLYGTFQALMFTIKIFTLTFCGSNVISHFYCDDGPLVLMLCSNAQEIELLIILFSAFNLISSLLVILVSYLL
ILIAIFRMHSTKGRKKAFSTCASHLTAVVVFYGSLLFMYMQPESTHSFDTDKMASVFYTLVIPMLNPLIYSLRNKDVKNAFYRVVKNQCKLCI*
360 >lcl|XP_003122364.1|Plus1complement(62797..63744) NW_003534192 olfactory receptor 8H3-like LOC100520536 __SEG__ Chr1 {Sus scrofa} MGTRNDTHVSDFILMGLTDSEAIQRIMFMLFLLIYLMTVLGNAGMILIIHLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLGNLLTSTKYISYMNCFTQMYFFVFLAGA
ECCLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFTGFLDSFVNVLCMSTLDFCDSNVIHHFFCDLSPILALSCTDTQITEIVIFILAGSTLVVSLTTIVVSYVS
ILSTIRKITSTSGKQKAFSTCASHLLGVTIFYGTMIFTYLKPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVMQKTVGSRQLK*
361 >lcl|XP_003122365.1|Plus1complement(111239..>112210) NW_003534192 olfactory receptor 8K3-like LOC100520881 __SEG__ Chr1 {Sus scrofa} LVVKHNGTVLSEFILMGKTDHPELQDPLFGLFLLISVISGVGNLGMVILTKVDASLQTPMYFFLRHLSLTDFGYSTTVSCGPKMLVSFVVDENKIPYYFCATQLAFFIMF
FISELFILSAMAYDRYVAIGHPLLYTVIMSPRLCCVLVVIPYNYSVILSSLTILKILTSLFCDSNVIRHFYCSSLSLIALLCSDTQEIRLIILMFSTFNLVSSLLIVVVF
YTLILVIILRMNSAESRNKALSTFGSHLTVIPVFYGTLFFMYVQPKSSESFDTDKVASLFYTLVIPMLNPVIYSLRKKEVKNAVCRTWNMCANVLLKIHCRIY*
362 >lcl|XP_003122366.2|Plus1complement(133459..134406) NW_003534192 olfactory receptor 8K3-like LOC100521242 __SEG__ Chr1 {Sus scrofa} MDKWNQTVLSEFILMGITDLRELQAPFFGLFLSIYAISVVSNLGMIILTKVDSGLQTPMYFFLRHLAFIDLGYSTAVGPKMLVNFVADRNTISYHWCAMQLTFFILFIIS
ELFILSAMAYDRYVAICHPLRYTAVMSQRVCWVLVAVPYLYSVFPSLITTIKIFISSFCGYNIIRHFYCDSLPLLALLCSSTLEIELFIQICSVFNLVSSLLIVLVSYIL
ILKAILRMNTAQGRHKAFSTCGSHLTVVIVLYATLSFMYMQPKSSHSFDTDKMASVFYTLVIPMLNPMIYSLRNKEVKGALRRIWKNLHKHPIRN*
363 >lcl|XP_003122419.1|Plus1106139..107077 NW_003299442 olfactory receptor 1J4-like LOC100520002 __SEG__ Chr1 {Sus scrofa} MRRENQSRMSEFLLLGLPIQPEHQGMFFALFLGMYLTTVLGNLLIIMLIRLDPRLHTPMYFFLSHLALTDISFSSVTVPKMLMYMHTHDQSIPYAGCISQMYFFLLFGCL
DNFLLAVMAYDRYVAICQPLHYTTVMRQELCVSLVAGSWVLCSILALLHTLLLVQLSFCAANTIPHFFCDLTTLLKLSSSDTSINELVIFIVGGILFILPLSSILGSYVH
IGTAVLSVSFSKNLFKVFSTCGSHLFVVSLYYGTIASVHFFSSSWESNDKGVIASFVYAVVTPMLNPFIYSLRNRDIKQAFEIFVNRANFLK*
364 >lcl|XP_003122421.1|Plus1complement(186992..187936) NW_003299442 olfactory receptor 1L8-like LOC100521062 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSRPEDQKPLFSLFLTIYLVMIIGNLLIILAIRSDPQLQTPMYFFLAFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFLYALGNT
DSFLLAVKAFDRYVAICDPFHYVTIMSHHRCVLMVALSCSLPHLHSLLHTLLLNQLTFCDSNIIHHFLCDISPLMKLSCSSTFVNETVMMTEGSFILVTPFLCITFSYIR
ILTVVLKIPSAAGKRKAFSTCGSHVTVVTLFYGSIFYVYLQPVSSYTIRDHMATIVYTVLTSTLNPFIYSLRNKDLKQGLRKLVGRRKFQATSP*
365 >lcl|XP_003122422.1|Plus1complement(20823..21764) NW_003299442 olfactory receptor 1J4-like LOC100521944 __SEG__ Chr1 {Sus scrofa} MRSQKQSNMSEFLLLGLPIHPEQQGVFFALFLGMYLTTLLGNLLIILLIRLDPRLHTPMYFFLSHLALTDISFSSVTVPKMLMNMQTQDQSIPYAGCVTQVYFLIFFACI
DNLLLAVMAYDRYVAICHPLHYTIIMREELCLCLLTGSWLFSCAYALTHTLLLARLSFCDDNIIPHFFCDLASLLKLSCSDTSLNELVIFTAGAAVFIFPPSGILVSYGR
IGFSILRVPSTKGIFKALSTCGSHLSVVSLFYGTIMAMYFSPSFGKSHDNDIIASVMYTVVTPMLNPFIYSLRNKDMTSALEILIRNKNLFTT*
366 >lcl|XP_003122423.1|Plus189518..90459 NW_003299442 olfactory receptor 1J4-like LOC100522119 __SEG__ Chr1 {Sus scrofa} MRSQKHSNMSEFFLLGLPIHPEQQGVFFALFLGVYLTTLLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDRSISYAGCVTQVYFSIFFACI
DNLLLVVMAYDRYVAICHPLRYTIIMREELCLCLLAGCWLLSSAYALTHTLLLAQLSFCADNTIPHFFCDLASLLKLSCSDISLNELVIYTSGAAVFIFPLSGILVSYGR
IGISILRVPSTKGIFKALSTCGSHLSVVSLFYGTIMALYFSPSSGQSFDKGIIASVMYTVVTPMLNPFIYSLRNRDMTLALEILIRNNNIFTT*
367 >lcl|XP_003122427.1|Plus1351302..352273 NW_003299442 olfactory receptor 1N1-like LOC100524844 __SEG__ Chr1 {Sus scrofa} MRNQTSISDFLLLGISPHPDQQPLLFGLFLAMYLVTMLGNLLIILVIGSDTHLHTPMYFFLANLSFIDTCFSCTIVPKVLVNIQTQHHNISYTGCLVQMYFFMALTLLDD
FLLAVMAYDRYVAICHPLHYTMIMCPQRCLLLLTTSWLCAHLLAFSPTLLMSQFSFCASHSIPHFFCDLLPLLKLACSDTHIFQVMMFVAGTLSGVVPLTCVLVSYAHII
HTILRVPSPGGKHKVFSTCGAHLTVVTLFYGTLFLVYFQSSSSYSADTGMAASVVYTVVTPMLNPFIYSLRNRDMKEALCRFFDWGKILLSQRAFPRLEAQAR*
368 >lcl|XP_003122428.1|Plus1343167..344144 NW_003299442 olfactory receptor 1N1-like LOC100525026 __SEG__ Chr1 {Sus scrofa} MGMKNQTSISDFLLLGISPHPDQKPPLFWIFLAIYLVTVLGNLLIILGIGSDQHLNTPMYFFLTKISFIETCFSCTIIPKVLVNIQTQHHNISYTGCLVQMYFFMALTLL
DDFLLAVMAYDRYVAICHPLHYTMIMCPQRCLLLLTTSWLCAHLLAFSPTLLMSQFSFCASHSIPHFFCDLLPHLKLACSDKHIFRVTMLTEAILSGMIPLTCVLVSYAH
IIHTILRVPSPGGKHKVFSTCGAHLTVVTLFYGTLFLVYFQSSSSYSADTGMAASVVYTVVTPMLNPFIYSLRNRDMKEALCRFFDWGKILLSQRAFPRLEAQAR*
369 >lcl|XP_003122429.1|Plus1334225..335157 NW_003299442 olfactory receptor 1L6-like LOC100525203 __SEG__ Chr1 {Sus scrofa} MMRGNLSHMPEFLLLGLTSDPQKQVWLFASFLVMYLVNMAGSSVIIAAIQGDAHLHIHMYFFLSKLSLVDVCFTTVIVPRMLVNMLTQRKTIFFAQCLAQMYFFVTCVIT
DSFLLAVMAIDRYVAICNPLHYTTTMDPRHCLMLVITSWLVSHLHSLTHTILMARLSFCGPNIIHHFFCDVQPLLMLSCSDTSVNELLAFTEGSFVIMSPFFFIIVSYVC
ITRAVLRVPSGRGRFKVFSTCGSHFTVVSLFYGTILSVYIRPSSTYSVTKDSVVTVIYTVVTLMLNPFIYSLRNKDMKQALHKLMRKTEL*
370 >lcl|XP_003122430.1|Plus1323609..324538 NW_003299442 olfactory receptor 1L6-like LOC100525381 __SEG__ Chr1 {Sus scrofa} MTRGNQTHITEFLLLGLTSDPRKQVWLFASFLAMYLVNMAGNSVIIAAIWGDAHLHTPMYFFLSNLSFVDICFTNVIVPRMLANILSKGKNVPFAQCLTQMYFFVTCAIT
DSFLLAVMAIDRYVAICNPLYYTTTMNPRRCLLLVITSWLVSHLHSLTHTILMARLSFCGPNIIHHFFCDVQPLLMLSCSDTSVNELLAFTEGSFVIMSPFLFIIVSYVC
ITRAVLQVPSGRGRFKVFSTCGSHLTVVTLYYGTAISVYIRPSSTYSVTKDRVVTVIYTVVIPMLNPFIYSLRNKDMKYALRKLAGRKE*
371 >lcl|XP_003122717.1|Plus1complement(380024..381241) NW_003299463 putative G-protein coupled receptor 44-like LOC100510947 __SEG__ Chr2 {Sus scrofa} MLANVTMKPLCPILEQMSRLQSHSNSSIRYIDHASVVLHGLASLLGLVENGLILFVVGCRMRQTVVTTWVLHLALSDLLATASLPFFTYFLAVGHSWELGTTFCKLHSSI
FFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTIKRLDGRIMCYYNVLLLNPGPDLDATCNSRQMALAVSKFLLAFAVPLA
IIASSHVAVSAQLRQRGRRRSGRFVRLVAAVVAAFALCWGPYHVFSVLEARSHSNPELRPLVWRGLPFVTSLAFINSVVNPLLYVLTCPDVLRKLRRSLRSVLESVLVDD
SELGGGGSSRRRRRASSTDASSASSSLGSRLLPQHVPARLFRWLGGSRAAPPRRDRARSQEERGPLNRALSTTSG*
372 >lcl|XP_003122732.1|Plus1167891..168829 NW_003534215 olfactory receptor 10V1-like LOC100514625 __SEG__ Chr2 {Sus scrofa} MGNENRTKEIQFYFHPFSPILEIQMLIFVAFLLMYVGSLIGNATIFLTVWAERSLHTPMYFFLANLAALEIFYSSTVAPLALVNLLTMGRIPISVTGCGTQMFFFVFLGS
ADCILLGIMAYDRFVAIRDPLRYNLIMRWQLCAQLAVGAPVLGFILALQLTVLIFHLPFCAHNRIPHFYCDVLPILRLACGDTRTPEAMIFIVSVIILTIPFSLISISYI
FIVAAILKIRSAEGRRKAFSTCSSHLTVVLLQYGCCSLIYLRPSSSYNPEMGRVVSVVYTFVTPVLNPLIYSMRNQELKDALNKVMKRHLLN*
373 >lcl|XP_003122735.1|Plus1398963..399898 NW_003534215 olfactory receptor 4D9-like LOC100515186 __SEG__ Chr2 {Sus scrofa} MEQENYTRVKEFIFQGLTQSRELSLVLLLLLASVYTATVLGNLLIMVTVTWESRLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSRRKTISFNGCITQMFFFHLLGGA
DIFSLSVMAFDRYVAISKPLHYVTVMSRGWCTALIVASWLGGFVHSVVQISLLLPLPFCGPNVVDGFYCDVPQVLKLACTDTFALEVLMISNNGLISTLWFLFLLVSYTV
ILTMLRSHSGEGRKKAISTCTAHITVVTLHFVPCIYVYARPFTALPMDRAVSITFTVIIPVLNPMIYTLRNQEMKSAMRRLKRRLGPSQKE*
374 >lcl|XP_003122736.1|Plus1382690..383625 NW_003534215 olfactory receptor 4D9-like LOC100515358 __SEG__ Chr2 {Sus scrofa} MDQGNYTRVKEFIFLGITQSRELSWVLFVFLLLVYMTTLVGNLLIMVTVTWESHLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSERKTISFNGCVTQMFFFHLLGGA
DVFSLSVMAFDRYVAISRPLHYLTIMSKERCASLVVASWVGGFVHSVAQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTDTFVLELLMISNNGLVSWFIFFFLLISYTV
ILRMLRSHQGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDTAISVTFTVISPLLNPMIYTLRNQEMKSAMRRLKKRLEHSERI*
375 >lcl|XP_003122737.1|Plus1374050..374985 NW_003534215 olfactory receptor 4D11-like LOC100515525 __SEG__ Chr2 {Sus scrofa} MELRNGTRVTEFIFLGLTQSQDLSLVFFLFLSFVYMTTLLGNLLIMVTVTWESRLHTPMYFLLRNLAILDICFSSITAPKVLVDLLTKIKTISYTSCMTQMFFFHLLGGA
DIFSLSVMAFDRYVAISKPLHYVTIMSRGRCTALIVASWLGGFVHSVVQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTNTFVLELLMISNNGLVTTLWFIFLLVSYTV
ILMMLRSQAGEARRKAISTCTSHIAVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNHEMKSAMRKLKGRLIPSERR*
376 >lcl|XP_003122738.1|Plus1347995..348939 NW_003534215 olfactory receptor 4D6-like LOC100515706 __SEG__ Chr2 {Sus scrofa} MVQSNHTNVKEFVFLEITHFRELELFLFVAFLAVYVATVLGNALIVVTITCESPLHTPMYFLLRNKSVLDIAFSSVTVPKFLVDLLSERKAISYDGCMAQIFFFHFAGGA
DIFFLSVMAYDRYLAISKPLHYVTIMRRELWLALVVASWVGGGLHSIVQIILMLPLPFCGPNVLVAFYCDVPQVVKLACTDTFALELLMISNNGLVTLLWLLLLLGSYTS
ILVMLRSHSGEGRNKALSTCTSHILVVTLHFVPCVYIYCRPFSTLPMDTAVSISNTVLTPMLNPMIYTLRNQEMKSAMKRMQRWLGPFESNKLG*
377 >lcl|XP_003122739.1|Plus1complement(305130..306068) NW_003534215 olfactory receptor 5AN1-like LOC100515876 __SEG__ Chr2 {Sus scrofa} MTRGDNTTNITAFVLLGFSDFPHIRAALFVVFLVIYILTLTWNLCLIVLIRLDSHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVFSTMGL
SECCLMTVMAYDRYAAICNPLLYSSIMSPSLCGRMVLGSYMAGLSATLSQVCAVLQLHFCGPNVIHHFFCDMPLMLGLSCSDTFFVQVLTAIFTVFFGIINALVIMMSYV
YVVISIMKITSAKGRSKAFNTCASHLTAVTLFYTSGIFVYLSSSSGGSSGLDRFAAVFYTVVIPMLNPLIYSLRNKDIKDAWKRLKKRKECC*
378 >lcl|XP_003122740.1|Plus1complement(295447..296385) NW_003534215 olfactory receptor 5AN1-like LOC100516059 __SEG__ Chr2 {Sus scrofa} MTRGDNTTNITAFVLLGFSDFPHIRAALFVVFLVIYILTLTWNLCLIVLIRLDSHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVFSTMGL
SECCLMTVMAYDRYAAICNPLLYSSTMSPSLCGRMVLGSYMAGLSASLSQVCAMIQLHFCGPNVIHHFFCDMPQLLVLSCSDTFFLQLLTLVLTVIFGILNALVIMMSYV
YIVISVTKVTSAKGWSKAFNTCASHLTAVTLFYTSIIFVYLSSSSGGSSGLDRFAAVFYTVVIPMLNPLIYSLRNKDIKDAWKRLKKRKECC*
379 >lcl|XP_003122741.1|Plus1complement(287379..288317) NW_003534215 olfactory receptor 5AN1-like LOC100516243 __SEG__ Chr2 {Sus scrofa} MTGGDNITDNTDFVLLGFSDFPHIRPALFVVFLLIYILTLTWNLCLIVLIRMDSHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVFSTMGL
SESCLMTVMAYDRYAAICNPLLYSSIMSPSLCGRMVLGSYMAGLSASLSELCAMLQLHFCGPNVIHHFFCDMPLMLGLSCSDTFFVRVLTSIFTVIFGIINALVIMMSYV
YIVISVMKITSAKGRSKAFNTCASHLTAVTLFYTSSIFVYLSSSSGGSSGLNRFASVFYTVVIPMLNPLIYSLRNKDIKNALMRLQKGKECC*
380 >lcl|XP_003122742.1|Plus1506679..507617 NW_003534215 olfactory receptor 5AN1-like LOC100516417 __SEG__ Chr2 {Sus scrofa} MTRGENTTNITDFVLLGFSDFPHIRAALFVVFLVIYILTLTWNLCLIVLIRMDSHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVCSTMGL
SECGLMTVMAYDRYAAICNPLLYSSIMSPSLCGRMVLGSYMAGLSASLSQVCAMLQLHFCGPNVIHHFFCDMPQLLVLSCSDTFFLQLLTIILTVIFGIINALVIMMSYV
YIVISIMKITSAKGWSKTFNTCASHLTAVTLFYTSSMFVYLSSSSGGSSSFDRFAAVFYTVVIPMLNPLIYSLRNKDIKDAWKRLKKKKECC*
381 >lcl|XP_003122743.1|Plus1575658..576596 NW_003534215 olfactory receptor 5AN1-like LOC100516591 __SEG__ Chr2 {Sus scrofa} MNGGENTTRIIHFILLGFSDFPHIRAALFVVFLVIYILTLTWNLCLIVLIRMDSHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVFSTMGL
SESCLMTVMAYDRYAAICNPLLYSSIMSPSLCGRMVLGSYMAGLSSSLFHVCAMLQLRFCGPNVIQHFFCDLPQLLVLSCSDTFFVRLLTAISTMIFGIINALVIMISYV
YIVISIMKITSAKGWSKAFNTCASHLTAVTLFYTSGMFVYLSFSSGGSSSFDRFAAVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKGKECC*
382 >lcl|XP_003122744.1|Plus1598957..599901 NW_003534215 olfactory receptor 5AN1-like LOC100516778 __SEG__ Chr2 {Sus scrofa} MAGGKNSTTITRFILLGFSEFPKLTAVLFSVFLGIYLTTVSWNMGLITLIRMDSHLHTPMYFFLSNLSLLDICYVSTIAPRMLSDFFKKYKFISFMGCTMQYFFFSSLGL
TECCLLAAMAYDRYAAVCNPLLYAAIMSPTLCVQMVAGSCITGFFGSFIQLCALFQLHFCGPNVINHFFCDLPQLLILSCSDTFFFQVMTSVLTVIFGLTSVLVIIISYC
YIVATILKITSAEGRSKAFNTCASHLTAVTLFFGSGIFIYMYPNSGDSLSQNKLVSVLYTVIIPMLNPLIYSLRNKEIQDALSRCKKRIFSWCY*
383 >lcl|XP_003122756.1|Plus1650768..651712 NW_003299464 olfactory receptor 5B17-like LOC100519009 __SEG__ Chr2 {Sus scrofa} MENNTEVTDFILLGLTSATELQIPLFTMFILVYGITLIGNLGLIVLILLDPRLHIPMYFFLSNLSLVDFCYSSTITPKVMAGLLIGDSVISYNACAAQMFFFVAFATVES
YLLASMAYDRYAAVCKPLHYTTTMTTSVCAHMAIGCYVFGILTAAIEVGDTFCLSFCRSNVVHHFFCDIPAVMTLTCSDKDVNELIRLLISSFNIFFALLVILISYLLIF
VTVLKMHSGEGYRKALFTCASHLVAVSIFYGTVIIMYLQPSSSHSMDRDKIVSVFYTMLIPMLNPMVYSLRNKEVKNAFRKVVEKAKDSVDLIF*
384 >lcl|XP_003122757.1|Plus1complement(804207..805142) NW_003299464 olfactory receptor 9Q1-like LOC100519181 __SEG__ Chr2 {Sus scrofa} MAEKNFTLVTEFLLIAFTDCPERALPLFLLFLFIYLTTLWGNLGMIILIRVDLRLHTPMYFLLSHLSFMDICYSSVTVPQMMAVLLEHGVALSYTRCVTQFFLFTFFGSI
DCYLLALMAYDRYLAVCRPLLYVTIMTQKARLGFVGGAYVAGVFSALVRTVSAFTLSFCGTNEIDFIFCDLPPLLKLTCGDSYTQEVVIIVFAIFVIPACMVVILVSYLL
IILAILRIPSVGGRAKTFSTCASHLTSVSLFFGTLIFMYLRDKSGQSTEEDRVVSVFYTAVIPMLNPLIYSLRNKEVKEALKKALNRARLS*
385 >lcl|XP_003122767.1|Plus1complement(104004..104942) NW_003534215 olfactory receptor 10V1-like LOC100521066 __SEG__ Chr2 {Sus scrofa} MEEANQTEMIHFHFRPFSKLPEVQMLIFVTFLIMYLVSISGNSSIALIIWIYRSLHTPMYFFLASLAVLEICYSSTIAPLTLASILSMEKTLISLPGCGAQMFFFIFLGS
ADCVLLAIMAYDRFVAICHPLHYTLMMSWRLCARLALGSLALGFILAMQLTVLIFRLPFCSSKEVGMFYCDVLPVMRLACADTRVHEATLFVVGVTVLTIPFLLIALSYV
FIVAAILKIRSAEGRHKAFSTCSSHLTVVLLQYGGGSLIYLCPSSSYSPERGQVVSVVYTFITPMLNPLIYSLRNRELKDALKRATMRFLPS*
386 >lcl|XP_003122768.1|Plus1complement(118988..119989) NW_003534215 olfactory receptor 10V1-like LOC100521245 __SEG__ Chr2 {Sus scrofa} MEEQNQTGAVHFHFHPFSTDPAVASLIFVAFLLLYLGSLIGNITIGLIVWQDHSLHSPMYFFLFALAILELGYSTNIAPLTLAGILSMGRMLISLPGCGAQMFFFILLGG
SDCVLLAAMAYDRYVAICHPLHYNLIMSWQLCGHMTLGSLGLGFLLALPLTVLICHLPFCGHNEIYHFFCDMPAVMRLACADTRVQEAALYAISVAAVAIPFLLICLSYG
CIMTAISRMDSAQGKCRAFSTCSSHLMVVLLQYGCCTLIYLRPSSSYSPEEGRALSVVYTFFSPVLNPLIYTIRNQEVTHAVRRLIARMCWFREPETFLLRKNIPSIRSR
DRS*
387 >lcl|XP_003122772.1|Plus1185638..186639 NW_003534215 olfactory receptor 10V1-like LOC100521946 __SEG__ Chr2 {Sus scrofa} MEEQNQTGAVHFHFHPFSTDPAVASLIFVAFLLLYLGSLIGNITIGLIVWQDHSLHSPMYFFLFALAILELGYSTNIAPLTLAGILSMGRMLISLPGCGAQMFFFILLGG
SDCVLLAAMAYDRYVAICHPLHYNLIMSWQLCGHMTLGSLGLGFLLALPLTVLICHLPFCGHNEIYHFFCDMPAVMRLACADTRVQEAALYAISVAAVAIPFLLICLSYG
CIMTAISRMDSAQGKCRAFSTCSSHLMVVLLQYGCCTLIYLRPSSSYSPEEGRALSVVYTFFSPVLNPLIYTIRNQEVTHAVRRLIARMCWFREPETFLLRKNIPSIRSR
DRS*
388 >lcl|XP_003122775.1|Plus1366284..367219 NW_003534215 olfactory receptor 4D9-like LOC100522475 __SEG__ Chr2 {Sus scrofa} MELGNGTAVKEFIFLGLTQDHELSLVLFLFLLLVYMTTLLGNLLIMITVTCESRLHTPMYFLLRNLSIADICFSSITAPKVLADLLSPRKTISYNGCFTQMFFFHLIGGV
DVFSLSVMALDRYVAISKPLHYVTIMSRGRCIGLIVTSWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTNTFVLELLMISNNGLLTTLWFVFLLVSYLV
ILLLLRSHQGEARRKAISTCTAHIAVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNHEMMSAMRKLKGRLAPSVMG*
389 >lcl|XP_003122776.1|Plus1356188..357123 NW_003534215 olfactory receptor 4D9-like LOC100522662 __SEG__ Chr2 {Sus scrofa} MALRNHTRVSEFIFYGITQSQELSLLLFFFLSTVYVTTVLANLAIMVTVTWESRLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSRRKTISFNGCITQMFFFHLLGGA
DIFSLSVMAFDRYVAISKPLHYVTVMSRGRCTALIVASWLGGFVHSIVQVSLLLPLPFCGPNVVDGFYCDVPQVLKLACTDTFVLELLMISNNGLVTTLWFVLLLVSYTV
ILVMLRSHSGEGRKKAISTCTAHITVVTLHFVPCIYVYARPFTALPMDRAVSITFTVIIPVLNPMIYTLRNQEMKSAMRRLNGRLMLSARG*
390 >lcl|XP_003122780.1|Plus1complement(641324..642262) NW_003534215 olfactory receptor 5AN1-like LOC100523771 __SEG__ Chr2 {Sus scrofa} MIRGGNTTEITSFIFLGFSDFPRIIAMLFVVFLVIYMTTLTWNMCLIILIRMYAHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFRDQKIITYVGCFVQSLVFSTMGL
SESCLMTVMAYDRYAAICNPLLYSSIMSPSLCGRMVLGSYMAGLSASLSQVCAMLQLHFCGPNVIQHFFCDLPQLLVLSCSDTFFLQLLTIVLTVIFGIINALVIMISYV
YIVISIMKITSAKGQSKAFNTCASHLTAVTLFYTSSIFVYLSSSSGGSSSFDRFAAVFYTVVIPMLNPLIYSLRNKDIKDALKRLQKRRRYC*
391 >lcl|XP_003122781.2|Plus1561615..562583 NW_003534215 olfactory receptor 5AN1-like LOC100523946 __SEG__ Chr2 {Sus scrofa} MTGGENITNITDFILLGFSDFPHIREVLFVVFLVIYILTLTWNLCLIVLIRMDSHLHMPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVFSTMGM
SESYLMTVMAYDRYAAICNPLLYSSTMSPSLCGRMMLGSYMAGLSASLSQVCAMFQLHFCGPNVIHHFFCDMPQLLVLSCSDTFFVRLLTAILTVIFGIINALVIMISYV
YIVISIMKITSAKGRSKAFNTCASHLTAVTLFYTSGMFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKDIKDALKRLQRKRGCRSNNRLRDLSC*
392 >lcl|XP_003122782.1|Plus1539065..540030 NW_003534215 olfactory receptor 5AN1-like LOC100524301 __SEG__ Chr2 {Sus scrofa} MTGGENITNITHFILLGFSDFPQIIAGLFGMFLVIYMTTLTWNLFLIVLIRMDSHLHTPMYFFLSNLSFIDICYVSSTAPKMLYDFFQAKPTITIVGCAIQYFVFSTMGL
SESCLMTVMAYDRYAAICNPLLYSSTMSPSLCGWMVLGSYMAGLSASLSQVCAMLQLHFCRPNVIHHFFCDMPQLLVLSCSDTFFVRLLTAILALIFGIINSLVIMMSYV
YIVISIMKITSAKGRSKAFNTCASHLTAVTFFYTSGIFVYLSSSSGSSSSFDRFASVFYTVVIPMLNPLIYSLRNKDIKDALKRLQRKRGCWSNKRFVMLD*
393 >lcl|XP_003122791.1|Plus1677287..678222 NW_003299464 olfactory receptor 5B2-like LOC100511436 __SEG__ Chr2 {Sus scrofa} MDNRTDVTHFILLGLTDIPELQVPFFIMFTLIYLVNTVGNLGIILLILMDSHLHTPMYFFLSNLSLVDFCYSSTVTPTVMTGFFKVYKVISYNACAAQMFFFAGFVTTEN
YFLASMAYDRYAAVCKPLHYTTTMTPSVCAGLVIGCHICGFLNASIHVGNTFPLSFCRSNVVHHFFCDIPAVMALSCSDTHTSELVLVYAASFNVFLALLVILISYIFIF
ITILKMPSSAGYQKALSTCASHLTAVSIFYGTGIFMYAKPSSSHSMDTDKIASVFYSMVIPMLNPIVYSLRNKEVKSAFKKVLLGEKLFLG*
394 >lcl|XP_003122793.1|Plus1complement(693198..694139) NW_003299464 olfactory receptor 5B2-like LOC100511803 __SEG__ Chr2 {Sus scrofa} MENRTKVTWFILLGLTTAPELQMLLFIVFTFIYFINVVGNLGMITLILLDTRLHTPMYFFLSNLSLVDLGYSTAIVPTIMAGFLIGDKVNISYNACVAQMFFFVAFATME
NFLLASMAYDRYAAVCKPLHYTTTMTTSVCAWLAIGSYVYSFLNASFHIGDIFSLSFCKSNIVHHFFCDVPAVLALSCSDKHINEVVLVFISSFNVFLALVVILISYLFI
FVTILKMHSAQGHQKALSTCTSHLTAICIFYGTGIFMYSQPSSSHSMDTDKVASVFYSMVIPMLNPVVYSLRNKEVKSAFRKVIEKANSSVEF*
395 >lcl|XP_003122795.1|Plus1729007..729984 NW_003299464 olfactory receptor 10Q1-like LOC100512154 __SEG__ Chr2 {Sus scrofa} MVAGSPVLNQSGPPEFVFRAFTTVPEFQALLFLLFLLLYLMILCGNTAIVWAVCTHSSLRTPMYFFLSNLSFVEISYTTVVVPLMLSNIVGAGKPIPLAGCGAQMFFFLT
LGGADCFLLAIMAYDRYVAICHPLRYTVIMTQPLCIQMVAGALGLALFLSLQLTSLIFTLPFCGHLREINHFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFLLIC
VSYAFITSAILRIRSGEGRRRAFSTCSSHITVVLLQYGFCALVYLRPQSSSSVDEDRQFALVYTFVTPLLNPLIYTLRNKDVKGALKKAISCKGTAEALSGFRGT*
396 >lcl|XP_003122796.1|Plus1769777..770736 NW_003299464 olfactory receptor 10Q1-like LOC100512331 __SEG__ Chr2 {Sus scrofa} MVAGSPVLNQSGPPEFVFRAFTTVPEFQALLFLLFLLLYLMILCGNTAIVWAVCTHSSLRTPMYFFLSNLSFLEICYTSVVVPLMLSNIWGFQKPIPLAGCGAQMFFFVT
LGSTDCFLLAVMAYDRYVAICHPLHYTLIMTQKLCIQMVAGALGLALFLSLQLTSLIFTLPFCGHLREINHFLCDVPPVLRLACADIRVHQAVLYVVGILVLTVPFLLIC
VSYAFITSAILRIRSGEGRRRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYTFVTPLLNPLIYTLRNKDVKDALRHAIISKAASDTN*
397 >lcl|XP_003122797.1|Plus1780769..781809 NW_003299464 olfactory receptor 1S1-like LOC100512519 __SEG__ Chr2 {Sus scrofa} MATVKWYHIGFSCRVVKTSCSFLQISRNMHQGNQTTISEFLLLGLSNQAEHQKPLFVLFLGMYLVTVAGNGLIILAIGLDSYLHTPMYLFLANLSFADISSISTSVPKML
VNIQTKSQSISYESCITQMYFATLFVVIDNFLLGVMAYDRFVAICHPLNYTTIMEPRLCLLLTVIPWVLSNTVSLTHTLLLLRLVFCDSNTLPHFFCDLAPLLRLSCSDT
MINQLVLFIVGLSVITFPFALILFSYVCIVRDVLRLSSTEGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTDPDNRDKIGAVLFTVVTPMANPFIYSLRNKDMKGALR
KLINVKRSSPFDTLGI*
398 >lcl|XP_003122798.1|Plus1complement(792071..793015) NW_003299464 olfactory receptor 9Q2-like LOC100512703 __SEG__ Chr2 {Sus scrofa} MAQRNYTAVREFFLSVFAEHPEWGLPLFLVFLGFYLLTLLGNAGMIFLTRKDRRLHTPMYFFLSHLSLVDICYSSTIVPQMLAVLLEHGAVISKARCAAQFFLFTFFASI
DCYLLAIMAYDRYVAVCQPLLYVTIVTEKARLGLVAGAYVAGFSSAFVRTVTAFTLSFCGDNEIDFIFCDLPPLLKLTCGDSYTQEVVIIVFALFVMPACILVILVSYLF
IIMAVMQIRAAGGRAKTFSTCASHLTAVALFFGTLIFMYLRDNSGQSSEADHVVSVLYTVVTPMLNPLIYSLRNKEVKDAVVKVLSQSKPSGRT*
399 >lcl|XP_003122799.1|Plus1complement(868825..869766) NW_003299464 olfactory receptor 9I1-like LOC100512887 __SEG__ Chr2 {Sus scrofa} MAENGSAVTEFILMGFQLWDELQMGLFFVFLVIYLVTVGGNLGMIVLIRNDPRLQTPMYFFLSHLSFLDICYSSVIVPQLLEILVTRKMVIAFERCATQFFFFTLCASTE
CFLLAVMAYDRYVAVCNPLLYATAMTPQTRLGLVAGAYGGAMVNSMIRTGCTFSISFCKSNHVDFFFCDLPPLLKLACSETGPRERVIYLLAFLVITTSISVILVSYLFI
IRAILKIRSADGKAKTFSTCASHMTAVALFFGTLIFMYLKGNMGKSLWEDKIVSVFYTVVIPMLNPMIYSLRNKEVKEALKKALNRMRVSQVG*
400 >lcl|XP_003122805.1|Plus11030295..1031254 NW_003299464 olfactory receptor 1020-like LOC100514032 __SEG__ Chr2 {Sus scrofa} MAPGDPARASGNDTPVTQFILLGFSKYPDLQELFFGGFLLIYAVTVVGNLGMMALIFTDSRLHSPMYFFLSVLSFLDICYSSVVTPKLLADLLVSDKSISFAGCVVQMTF
FVMHATAESFLLASMACDRYMAICRPLHYGSIMTKETCLQLVAASYAFGGANSAIQTGNVFSLPFCGPNQVAHFFCDIQPLLRLACANTAVAGVVLYIFSALVTFLPAAL
ILTSYSSVLAAIGRMRSAAGREKALSTCASHFLAIALFYSTVIFTYVQPHGSTNDASGQVVSVFYTIITPMLNPFIYSLRNKEVKDALQRKLRIKLFPC*
401 >lcl|XP_003122810.2|Plus114152..15111 NW_003535237 olfactory receptor 4K14-like LOC100514946 __SEG__ Chr7 {Sus scrofa} LEQNLKPEIMDLQNYSLVSEFVLHGLSNSQHLQKFFFIFFSGIYVAMVLGNLIIVVTVISDPHLYSSPMYFLLGNLSFLDIWLASFATPKMIRDFLSDRKLISFGGCMAQ
IFFLHFVGGAEMVLLVTMAYDRYVAICKPLHYMTMMNRQTCIRLVSVSWAIGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACVDTYVLGILMISDSGLLSMSC
FLLLLISYTVILITVQQQAAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFSWFSVDKVLSVFYTIFTPLLNPLIYTLRNKDMKIAMKRLRNRHVTFH*
402 >lcl|XP_003122813.1|Plus189333..90277 NW_003534217 olfactory receptor 1009-like LOC100515469 __SEG__ Chr2 {Sus scrofa} MAGENYTRITEFIFTGLKYHPRMQVFLFLLFLLFYLVTMTANLGMIILIQLDSRLHTPMYFFLSHLSFVDICFSSVVGPKMLRDFFAERKAISFLGCALQQWFFGFFVAI
ECLLLASMAYDRYVAICNPLLYSVAMSQRLCIQLVVGPYTVGFLNTMTHTTAAFRLPFCGSNIINHFFCDMSPLLSLICADIWINKLLVFIVAGAVLVVSSLTIIISYFY
IFIAILRIRSADGRHKAFSTCSSHLTVVSILYGTLFFIYVRPGAIFSLDLNKGVSVFYTAVIPMLNPLIYSLRNKEVKAAMCRTIARRKFCLGS*
403 >lcl|XP_003122814.1|Plus1107812..108753 NW_003534217 olfactory receptor 1009-like LOC100515647 __SEG__ Chr2 {Sus scrofa} MASENYTRVTEFIFRGLSYNPHLQVFLFLLFLSFYIINLTGNLGMIFLIQIDSHLHTPMYFFLSHLSFVDLCFSSVVSPRMLADFFVKRKAISFLGCALQQWFFGFFVAA
ECFLLASMAYDRYVAICNPLLYSVAMSQRLCIQLVVGPYVIGFVNTMTHTTNAFRLPFCGPNVINHFFCDMSPLLSLVCADTRITELVVFVVAGAVGVFSGLSILISYVY
ILVAILKIRSADGRCKAFSTCSSHLTAVSILYGTLFFIYVRPSASFSLDVNKVVSVFYTAVIPMLNPLIYSLRNKEVKDAIRRTVAKRKFGRA*
404 >lcl|XP_003122818.2|Plus1complement(46130..47029) NW_003299465 olfactory receptor 4L1-like LOC100516720 __SEG__ Chr2 {Sus scrofa} MDLKNGSVVTKFILLGFSVGWELQFVFLVTFSLIYGATVLGNVIMLTVTFSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMIRDLLTKHKVISMWGCMAQMFFTHCFGGAE
ATLLIAMAFDRYVAICKPLHYRTIMSHKLLKGFVILSWTIGFIHTMSQMVLTVNLPFCGPHIIDNIFCDLPLVIKLACMDTYTLELFVIADSGLLSFICFLLLLVSYTVI
LVTVQQRSSGGLSKALSTLSAHITVVTLFFGPCIFIYAWPFSSFAGNKIFSVFYTVITPLLNPIIYTLRNEKMQEAMRK*
405 >lcl|XP_003122819.1|Plus156569..57501 NW_003534217 olfactory receptor 998-like LOC100517262 __SEG__ Chr2 {Sus scrofa} MEDQNQTAVTEFLFLGLTDQLHQQILLFVTLVFVYLVTLGGNLGMITLIWMDPRLHTPMYFFLSHLSFVDMCSSSSIAPKVLCDIFAEKKGISFLGCAAQMWFLGLFVAT
ECFLLASMAYDRYLAICKPLLYSQIMSQRVCVQLVMGPYAVALMSTMTHTTLTFCLPFCGPNVINHFFCDVSPLLSLACADTWANKVVLFTLAGAVGVLSGLIIMVSYVC
ILVAILRLQSAGGRGKAFSTCSSHLAAVSILYGTLFFVYVRPGSGSSLDINEVVSLFYTVVTPMLNPLIYSLRNKEVKNAFGRMFERDIV*
406 >lcl|XP_003122820.1|Plus164455..65426 NW_003534217 olfactory receptor 5G3-like LOC100517453 __SEG__ Chr2 {Sus scrofa} MEDQNQTAVTEFLFLGLTDQLHQQILLFVTLVFVYLVTLGGNLGMITLIWMDPRLHTPMYFFLSHLSFVDMCSSSSIAPKVLCDIFAEKKGISFLGCAAQMWFLGLFVAT
ECFLLAAMAYDRYLAICKPLLYSQIMSQRVCVQLVMGPYAVALMSTMTHTTLTFCLPFCGPNVINHFFCDVSPLLSLACADTSVIKLVLFTLAGAVGVLSGLIIMVSYVC
ILVAILRLQSAGGRGKAFSTCSSHLAAVSILYGTLFFVYVRPGSGSSLDINEVVSLFYTVVTPMLNPLIYSLRNKEVKNAFGRTVERNFFLKKIDRILIDHRG*
407 >lcl|XP_003122821.1|Plus179997..80938 NW_003534217 olfactory receptor 1002-like LOC100517632 __SEG__ Chr2 {Sus scrofa} MDYGNQTLVMEFVFVGLTNHFQHQVVLFVIFLLVYLVTLLGNLGMVTLIWMDSRLHTPMYFFLSHLSFVDVCSSSVIGPKMLTDIFVEKKVISFFGCAAQLWVFCQCVVT
ECFLLASMAYDRYMAICKPLLYALVMSQRVCVQLVLGPYAMGLISAVTHTVFAFRLPYCGSNIINHFFCDLLPVFSLACADTQANKFLLFIVAGAVGVLTGVTILVSYTY
IVMAISRIRSADGKRNAFSTCSSHLTSVSILYGTLFFIYVRPSSSFSLDINKVVSVFYTAVIPMLNPLIYSLRNKEVKNSFRRAYQRKTFSYG*
408 >lcl|XP_003122822.2|Plus1complement(179631..180593) NW_003534217 olfactory receptor 5AK2-like LOC100517804 __SEG__ Chr2 {Sus scrofa} LQVLMTQGNSTEITEFFLLGFGAQHKFRYVLFPVFLLIYVTSLVGNIGMILLIKTDSRLQTPMYFFLQHLAFVDLCYTTAITPKMLQNFIVENKAISFKGCVMQLLVYAT
FATSDAYLLAAMAVDRYVAICNPLHYPIVMSRRVCFWLVAGSYVMGSMNASVHTGFTFSVFFCKGNTINHFFCDVPPILALSCSSIDINVMLLVVFVGFNLLFTVLVVIF
SYVNIIPAVLKISSDAGRRKAFSTCGSHLTTVTVFYGTLSYMYLQPHSHNSQENMKVASVFYGIMIPMLNPMIYSLRNKEVKEALKVLWKKYSSRLDSNS*
409 >lcl|XP_003122823.1|Plus1complement(164699..165631) NW_003534217 olfactory receptor 5AK2-like LOC100517996 __SEG__ Chr2 {Sus scrofa} MEQNNGTKGTEFILLGFAGQHKSWPVLFIVFLVTYVVTLVGNIGMILLIKIEASLHTPMYFFLQNLEEKVDLCYATAITPKMLQNFVWTEHSISFIGCMVQLLTYGAFAT
SDCYILAAMAVDRYVAICNPLRYPTVMSQRVCIQLVIGSYFMGFLNASVNTSFTFQLNFCKSNKINHFFCDAPPILALSCSSIYFSIMLLAAFVGFNLTCTVSVVIFSYV
FILAAILKISSAAGRKKAFSTCASHLTAVTLFYGTLSYMYLHHRTLESQEQEKLASVFYGIVIPMFNPLIYSLRNQDVREALKGVGKQCF*
410 >lcl|XP_003122824.1|Plus1complement(4652..5605) NW_003299466 olfactory receptor 5AP2-like LOC100518174 __SEG__ Chr2 {Sus scrofa} MIRYTKDVQGKNQTEVTEFILLGLSDNSDLQVVLFGLFLIIYMTTMVGNLGMVLLIKIDPCLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLVAESKAISFKGCAAQFYF
FGSFLGTECFLLAMMAYDRYAAIWNPLLYPVLMSGRICFLLVATSFLAGFGNAAIHTGMTFRLSFCGSNKINHFYCDTPPLLKLSCSDTHINSIVIMAFSSFIVITCVMI
VLISYLCILIAILRIPSLEGRHKAFSTCASHLMAVTILFGTILFMYLRPTSSYSMEQDKIVSVFYTVVIPMLNPLIYSVKNKDVKEALKKVLHKQIL*
411 >lcl|XP_003122825.2|Plus1complement(22818..23750) NW_003299466 olfactory receptor 2B2-like LOC100518356 __SEG__ Chr2 {Sus scrofa} MIKTNFTVTEFVFLGLSSQPKMQLILFVMFLFFYLLTVAGNVIIITVIQIEPRLHTPMYFFLTNLSFLDICYTSTNVPKMLSNMVGKKKKTIPFFSCAAQMFFSLSFGMI
ECVLLGVMAYDRYVAICQLLHYIVIMNQITCVQLATISWFSSFLSSVVINIFTLSLPYCGPNVLNHFFCEVPSILRLACTDTSFTEMVVFIFSIIIVFIPFLLIIVSYTQ
ILLSVLRMQSASGRQKALSTCASHQTGVALFYGTAIFMYMRPQSKSSRAGGKIIVVFYTVIPPMLNPLIYSLRNQDVKGGLRRAFAKQRA*
412 >lcl|XP_003122826.1|Plus138159..39076 NW_003299466 olfactory receptor 9G1-like LOC100518535 __SEG__ Chr2 {Sus scrofa} MEKNNHTITEFILVGFTTDPVMQLVLFVVFLGVYSGTVIGNTTLMVLICKDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILLTCVSEEKTISFAGCAAQFFFSGGLGYSE
CYLLAAMAYDRYMAISKPLLYSQAMSIKLCAFFVAASYLGGFINCSIITKRIFTMNFCNDNVIDDFFCDLLPLVKLACGRKEGYQALMYFLLASNVITPAMLILASYLFI
ITTILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPRSSYSSDRDKIVSTFYTVVFPMLNPMIYSLRNKDVKEALNKLFK*
413 >lcl|XP_003122827.1|Plus171222..72139 NW_003299466 olfactory receptor 1013-like LOC100519587 __SEG__ Chr2 {Sus scrofa} MERSNYTVTDFIMVGFTTDPVVQLVLFVTFLGINSATVLGNTTLMVLICKDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCVAQFFFSAGLTYSE
CYPPAAMAYDHYMAISKLLLYSQAMPIKLCAFFIAPSYLGGFINAFIVTKGTFALNFCSNNIIDDFFCDIPPLVKLACGRKDSYQTVLYFVLASNVITPIVLIIASYLFI
ITTILKIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPQSSYSLDRDKIVSTFYTVVFPMLNPMIYSLRNKDMKEALNKLLK*
414 >lcl|XP_003122828.1|Plus186570..87505 NW_003299466 olfactory receptor 1013-like LOC100519759 __SEG__ Chr2 {Sus scrofa} MERSNHTVTEFILVGFTTDPVMQLVLFVAFVGVYSVSLVGNTTLMLLICNDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCVAQFFFSAGLAYSE
CYLLAAMAYDRYVVIANPLLYAQAMSRTLCCSLVTYSYIGGFVNAIILTSNTFTLNFCGDNMIDDFFCDVPPLVKLACGVKDTYQDMLYFLLASNVITPAMLILSSYLFI
ITTILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPSSSYSLERDKMVSTFYTVLFPMLNPMIYSLRNKDVKGALKKLFRIMQTEG*
415 >lcl|XP_003122834.1|Plus1complement(68130..69059) NW_003299469 olfactory receptor 4X2-like LOC100522784 __SEG__ Chr2 {Sus scrofa} MANTHNVTEFIFLGLSPDLKVQKVCFVIFLLLYTAIVLGNFIIVLTVMTSRSLGSPMYFFLSSLSFVEICYSSTTTPKLISDLLADRKAISLWGCMSQVFFIHFFAGTEM
FLLTVMAYDRYVAIFKPLNYATIMNGQVCAFLVGVAGAGAFVHSSTQILLIFRLPFCGPNVIDHYFCDVFPLLKLACSDTFLIGLLMVANGGTLTVVSFLVLLASYVVIL
LHLRTQSSEGRRKALSTCGSHIAVVTLFFGPCLFIYLRPSTILPVDKVVAVFYTVITPLLNPVIYSLRNAEMKKAVKRLWIRTVKLEEK*
416 >lcl|XP_003122835.1|Plus1complement(95068..95985) NW_003299469 olfactory receptor 4B1-like LOC100522977 __SEG__ Chr2 {Sus scrofa} MATTNNVTELIFTGLFQDPEVQRVCFAVFLPVYLATVVGNGLIVLTVKVSQSLHSPMYFFLSYLSLVEISYSSTVAPKFIADLLSKVKTISLEGCVAQIFFFHFFGVAET
FLLTVMAYDRYVAICKPLHYTVIMSRAVCHRLVAGSWLGGFFHSMVQIIVTLQLSFCGPNVIDHYFCDLHPLFKLACTDTSVEGLVVLANSGLISFLSFLILVSSYIVIL
VNLRNHSAEGRRKALSTCASHITVVVLFFGPAIFLYMRPPSTFTEDKQVAMFYSVVTPMMNPIIYTLRNAEVKIAMRRLWGRKVK*
417 >lcl|XP_003122836.1|Plus1complement(111405..112334) NW_003299469 olfactory receptor 4X2-like LOC100523167 __SEG__ Chr2 {Sus scrofa} MANTHNVTEFIFLGLFPNLKVQKVCFVIFLLLYTAIVLGNFIIVLTVMTSRSLGSPMYFFLSSLSFVEICYSSTTTPKLISDLLADRKAISLWGCMSQVFFIHFFGGVEM
FLLTVMAYDRYVAICKPLNYITIMNRQVCAFLVGVAGAGGFVHSSAQILLIFRLPFCGPNVIDHYFCDVLPLLKLACSDTFLIGLLMVANGGTLSVVSFLVLLVSYAVIL
LHLRTQSSEGRRKALSTCGSHIAVVTLFFGPCLFIYLRPSTILPVDKVVAVFYTVITPLLNPVIYSLRNAEMKKAVKRLWIRTVKLEEK*
418 >lcl|XP_003122837.1|Plus1complement(150267..151196) NW_003299469 olfactory receptor 4X2-like LOC100523356 __SEG__ Chr2 {Sus scrofa} MANTHNVTEFIFLGLSPDLKVQKVCFVIFLLLYTAIVLGNFIIVLTVMTSRSLGSPMYFFLSSLSFVEICYSSTTTPKLISDLLADRKAISLWGCMSQLFFIHFFGGTEI
FLLTVMAYDRYVAICKPLNYATIMNRQVCAFLVGVAGAGGFVHSSAQILLIFRLPFCGPNVIDHYFCDVLPLLKLACSDTFLIGLLMVANGGTLSVVSFLVLLVSYAVIL
LHLRTQSSEGRRKALSTCGSHIAVVTLFFGPCLFIYLRPSTILPVDKVVAVFYTGITPLLNPVIYSLRNAEMKKAVKRLWIRTVNLEEK*
419 >lcl|XP_003122838.1|Plus1complement(160092..161021) NW_003299469 olfactory receptor 4B1-like LOC100523534 __SEG__ Chr2 {Sus scrofa} MAPTNNVTELIITGLFEDPEVQRVCFVVFLPVYLATVVGNGLIVLTVKVSQSLHSPMYFFLSYLSLVEISYSSTVAPKFIADLLSKVKTISLEGCVAQIFFFHFFGVTEI
FLLTVMAYDRYVAICKPLHYTVIMSQAVCHRLVAGSWLGGFFHSMVQIIVTVRLPFCGPNVIDHYFCDLHPLFKLACTDTSVEGLVVLANSGLISIFSFLILVSSYIVIL
VNLRNHSAEGRRKALSTCASHVTVVVLFFGPAIFLYMRPSSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKIAMRRLWGRKVNSGVE*
420 >lcl|XP_003122839.1|Plus1complement(178222..179151) NW_003299469 olfactory receptor 4B1-like LOC100523717 __SEG__ Chr2 {Sus scrofa} MASTKNVTELIFTGLFEDPEVQRVCFVVFLPVYLATVVGNGLIVLTVKVSQNLHSPMYFFLSYLSLVEISYSSTVAPKFIADLLSKVKTISLEGCVAQIFFFHFFGVAEI
FLLVVMAYDRYVAICKPLHYMNIMSHQLCHRLVAGSFLGGFVHSIIQILITIQLPFCGPNVIDHYFCDLQPLFKLACTDTSVEGLIVLANSGLIALCSFLILVTSYIVIL
VNLRNHSAEGRRKAFSTCASHITVVLLFFGPAIFLYMRPSSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKIAMRRLWDKKENSGME*
421 >lcl|XP_003122840.1|Plus1complement(73979..74908) NW_003299469 olfactory receptor 4B1-like LOC100523887 __SEG__ Chr2 {Sus scrofa} MATTNNVTELIITGLFQDPEVQRVCFVVFLPVYLATVVGNGLIVLTVKVSQSLHSPMYFFLSYLSLVEISYSSTVAPKFIADLLSKVKTISLEGCVAQIFFFHFFGVAET
FLLTVMAYDRYVAICKPLHYTVIMSRAVCHRLVAGSWLGGFFHSMVQIIVTLQLSFCGPNVIDHYFCDLHPLFKLACTDTSVEGLIVLANSGLLSIFSFLVLVSSYIVIL
VNLRNHSAEGRRKALSTCASHVTVVVLFFGPAIFLYMRPPSTFTEDKLVAVFYTMVTPMLNPIIYTLRNAEVKIAMRRLWGRKVNLGVE*
422 >lcl|XP_003122841.1|Plus1complement(135366..136295) NW_003299469 olfactory receptor 4X1-like LOC100524068 __SEG__ Chr2 {Sus scrofa} MATTSNVTEIIFLGFSQNQDVQKFISALFLIMYLAIVLGNGLIVVTITTSKGLSSPMYFFLGSLSFVELCYCSVTAPKLILDSFMERRVISLKGCLTQIFFLHFFGGTEI
FLLTVMAYDRYVAICKPLHYTVIMHRRVCGLLVGAAWGGGLLHSVGQTFLIFQLPFCGPKVLDHYFCDVHPVLKLACADTFLVGLLIIANGGSISVVSFAGLLASYGVIL
CSLRTRSSEGRRKALSTCASHVAVVALFFIPCSFVYMRPCVTLPADKIVAVFYTVATPLLNPVIYSFRNVEVKNAMRRLMGRKAIREEK*
423 >lcl|XP_003122842.1|Plus137621..38652 NW_003299469 olfactory receptor 4S2-like LOC100524237 __SEG__ Chr2 {Sus scrofa} MENNVTEFILMGLTQNQEAQQICFFLFILFYMILMTGNFLIIMTIQRSPNLNSPMYFFLSFLSFVDICYSSVTAPKMITDFQVNVKRISLVGCMAQLFFVHLLGGTEIFI
LTVMAYDRYVAICKPLHYLTIMDWKFCSILVVSCWLGGFVHTFIQTMLTVHLPFCGPSLIDHYFCDVHPLLKLACTDTYVVGLIVVANSGMISLISFVILVGSYTVILLS
FKTRSSKGRRKALSTCASHITVVILYFVPCIFIYLRPSTTFPEDKMVALFYTIITPMLNPLIYSLRNVEVKNAMRRLWIKRLLGRNRRDPDGKFDGIGTVVPASKNVVGN
LSVISPQSYHTNT*
424 >lcl|XP_003122843.1|Plus1complement(14811..15764) NW_003299469 olfactory receptor 4C45-like LOC100524420 __SEG__ Chr2 {Sus scrofa} MLSSQDELTARVSNVTEFILLGLTQNPELQKLLFGVLLTTYLITLAGNLLISVTIFISPALASPMYFFLSYLSLIDVFYSSSIAPKMIFDLISGTNTISFKGCMTQLFAE
HFFASAEIVLLIVMAYDRYVAICKPLHYMTIMSPPVRAFLVGMAGALGFIHGGIQILFMVQLPFCGPNVIDHFMCDLVPLLELACTDTHTLGPLIAANSGSLCLVIFCML
VASYGVILRSLRTHSSEGRRKALSTCASHVTVVILFFVPCSFLYLRPMTSFPTDKAVTVFCTIVTPMLNPLIYTLRNAEVKDALKKLWGQIMKTGGK*
425 >lcl|XP_003122876.1|Plus1273334..274773 NW_003534223 muscarinic acetylcholine receptor M4-like LOC100516483 __SEG__ Chr2 {Sus scrofa} MANVTPVNGSAGNQSVRLVTATHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLAL
DYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVPDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYVHISLA
SRSRVHKHRPEGPKEKKAKPLAFLKSPLMKQSVKKPPPGEAAARGELRNGKLEEAPPPVLPPPPRPVADKDTSNESSSGSATQNTKERPPTELSTTEATTPAAPAPPLQP
RTLNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQSCIPDTVWSIGYW
LCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR*
426 >lcl|XP_003122907.1|Plus1868348..870270 NW_003534230 leucine-rich repeat-containing protein 4C LRRC4C __SEG__ Chr2 {Sus scrofa} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLVK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
427 >lcl|XP_003123071.1|Plus1complement(192690..194468) NW_003534265 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3-like LOC100515299 __SEG__ Chr2 {Sus scrofa} MTCWLCVLSLQLLLLPAAPPPAGGCPARCECTAQTRAVACPRRRLTAVPDGIPAETRLLELSRNRIRCLNPGDLAALPLLEELDLSDNVIAHVEPGAFANLPRLRELRLR
GNLLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLRSLRRLEVGDNDLVFISRRAFAGLLALEELTLERCNLTALSGESLGHLRGLGALRLRHLAIAALEDQNFQR
LPGLLHLEIDNWPLLEEVAAGSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLL
STLEESTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQHVTAAAGDDVRFQCRAEGEPAPTVA
WVTPRHRAVTATSAGRARVLPGGTLQIRDAQPGDSGTYTCVASNAGGNDTYFATLSVQPEPATNRTLGEGRNDTQAAMRFPLDLTTILVSTAMGCITFLGVVLFCFLLLF
VWSRGRGQHKNNFSVEYSFRKVDGPAAAAGQSGARKFNMKMI*
428 >lcl|XP_003123083.1|Plus1181800..182957 NW_003534266 sphingosine 1-phosphate receptor 4-like LOC100517997 __SEG__ Chr2 {Sus scrofa} MNTTEAPAEAPESCQQLAAGGHSRLIILHYNHSGRLAGRGGPEEGGLGLLRGLFVAVSCLVVLENLLVLVAIASRMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGAH
TFRLAPAQWFLREGLLFMALAASTFSLLFTAGERFATMVRPVAESGATKRGRVCSFIGLCWLLATLLGLLPLLGWNCVCAFQRCSSLLPLYSKDYILFCVVVFACILATI
TVLYGAIFRVVRANGQKAMRAPARRKARSLLNTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMEWILTLAVLNSGINPLIYSFRSRDVRRAVLSFLCCPCLRL
GLRGPGDCLAQAAEAQSGASNTDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSV*
429 >lcl|XP_003123120.1|Plus1complement(752059..752862) NW_003534267 leucine-rich alpha-2-glycoprotein-like isoform 2 LOC100524848 __SEG__ Chr2 {Sus scrofa} MPADILQGIPNLQELHLSNNQLEDLSAKFLLPVPQLKVLDLTRNALKRLPPGLFKVSAALHTLVLKENRLDILDASWLRGLKALRHLDLSGNQLRTLPRKLLANFTDLHI
LDLGNNQLQTLPPDLLRGPLKLEWLHLEGNRLQVLEEGFLAPQPKLRYLFLNNNKLTTLAAGAFRGLQVLDMLDLSNNSLTSVPEGLWASLGKAAGNMKVGFDISGNPWI
CDQKLDDLYRWLVANEDKMFFQNNTHCAGPKALEGQTLLAVAASLEA*
430 >lcl|XP_003123188.1|Plus1complement(163034..163378) NW_003534271 insulin receptor-like LOC100522600 __SEG__ Chr2 {Sus scrofa} MRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMESVPLDRSSHSQREEAGGRDGGSALGLKRNYEEHISYTHMNGGKKNGRILTLPR
SNPS*
431 >lcl|XP_003123270.1|Plus1960966..962021 NW_003534273 sphingosine 1-phosphate receptor 2-like isoform 1 LOC100511551 __SEG__ Chr2 {Sus scrofa} MGNLYSEYLSPSKVPEHYNYTKETPVTETPSRQVASVLIIILCCAIVLENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFIANTLLSGPFTLRLTPVQWFAREGS
AFITLSASVFSLLAIAIERQVAIAKVKLYGSDKSCRMLLLIAASWLISMVLGGLPILGWNCLGHLEACSTVLPLYAKPYVLCVVTIFSVILSAIVALYIRIYCVVRSSQA
DVAGQQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVRACPILYKAHYFFAFATLNSLLNPVIYTWRSRDLRREVLRPLQCWRRAAGGQGRRDGTPGHRLLPLRSSS
SLERGTHMPTSPTFLEGNTMV*
432 >lcl|XP_003123281.1|Plus1complement(1634287..1635207) NW_003534273 olfactory receptor 7D4-like LOC100513718 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSLFLLLGLSEDPELQPFLFGLFLSMYLVTVLGNLLIILTVSSDSHLHTPMYFFLSNLSFVDICFVSTTVPKMLMNIQAQSKDISYVGCLTQVYFFVVFAGM
DNFLLAVMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWFVLFWVALVHLLLLMQLTFCIGTEIPHFSCELDQILKVACSDTLINDICLYVATGLLCMLPLTGIVFSYSQ
IVSTLMKMASTEGKYKAFSTCGSHLSVVSLFYGTILGVYLTSTVTHSPQRRSIASVMYTVITPMLNPFIYSLRNKDVKGALGRLLS*
433 >lcl|XP_003123282.1|Plus11615855..1616778 NW_003534273 olfactory receptor 7D4-like LOC100513910 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKIFFLLGLSDDPELQPFLFGLFLSMYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFVSTIVPKMLVNIQAQSKDISYVGCLTQVYFFVVFAG
MDDFLLTVMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWFVFFCVALVHLLLLTQLTFCVGTEIQHYSCELDQILKVACSDTFINDVCMYVATALLCMLPLTGILFSYY
QIVSTLMKMASTEGKYKAFSTCGSHLSVVTLFYGTSLGVYFTSAVTHSPHRISIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLS*
434 >lcl|XP_003123283.1|Plus11722541..1723461 NW_003534273 olfactory receptor 7D4-like LOC100514092 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKLFLLLGLSDDPELQPLLFGLFLSMYLITMLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFISTAVPKMLVNIQAQSKDISYIGCLAQVYFFMVFAG
MDNFLLTVMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWLILFCVALVHLLLLRWLTCIGTEIPHFSCELAQILKVACSDTFINEVCLYVATALLCMLPLTGILFSYYQ
IVSSLMKMASTEGKYKAFSTCGSHLSVVSLFYGTGMGVYLTSAVTHSPHRISIASVMYTVVSPMLNPFIYSLRNKDVKGALGRLLS*
435 >lcl|XP_003123284.1|Plus1complement(1686100..1687026) NW_003534273 olfactory receptor 7D4-like LOC100514275 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKLFLLLGLSDDPELQPFFFGLFLSMYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFISTIVPKMLVNIQAQSKDISYVGCLTQVYFFFVVFA
ELDDFLLTMMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWFVFFCVALVHLLLLTQLTFCVGTEIQHYSCELDQILKVACSDTFINEVCMYVATALLCMLPLTGILFSY
SQTVSTLMKMASTEGKYKAFSTCGSHLSVVSLFYGTSLGVYFTSAVTHSPHRISIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLS*
436 >lcl|XP_003123285.1|Plus1complement(131759..132682) NW_003534274 olfactory receptor 7D4-like LOC100514448 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKLFLLLGLSDDPELQPFHFGLFLSMYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFVSTTVPKTLVNIQAQSKDISYIGCLTQVYFFVVFVG
MDDFLLTVMAYDRFVAICHPLHYVVIMNARLCVLLVLMCWFVFFCVALVHLLLLMQLTFCVGTEIPHFFCELDQILKVACSDTFINEVCMYVATALLCMLPLTGILFSYY
QIVSTLMKMVSTEGKYKAFSTCGSHLSVVTLFYGTSLGVYFTSAVTHSPHRISIASVMYTVVSPMLNPFIYSLRNKDVKRALGRLLS*
437 >lcl|XP_003123286.1|Plus1complement(108833..109756) NW_003534274 olfactory receptor 7D4-like LOC100514628 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKLFLLLGLSDDPELQPLVFGLFLSMYLVSLLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQAHTKDISYIGCLTQVYFFVVFAG
MDNFLLAVMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWFVFFCVALVHLLLLMQLTFCVGTEIPHFSCELDQILKVACSDTFINEVCMYVATALLCMLPLTGILFSYS
QIVSSLMKMASTEGKYKAFSTCGSHLSVVSLFYGTSLGVYLTSAVTHSPHRISIASVMYTVVSPMLNPFIYSLRNKDVKGALGRLLS*
438 >lcl|XP_003123287.1|Plus1163233..164156 NW_003534274 olfactory receptor 7D4-like LOC100514822 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKLFLLLGLSEDPELQPLLFGLFLSIYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIEAQSKDISYIGCLTQVYFFMVFAG
MDDFLLTVMAYDRFVAICHPLHYVVIMNAHLCVLLVLMCWFILFWAALIHLLLLTQLTFCVGTEIPHFFCELAQILKVACSDTFINEVCLYVATALLCMLPLTGVLFSYY
QIVSTLMKMASTEGKYKAFSTCGSHLSVVTLFYGTSLGVYFTSAVTHSPHRISIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLS*
439 >lcl|XP_003123288.1|Plus1complement(263882..264805) NW_003534274 olfactory receptor 7D4-like LOC100515010 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKLFLLLGLSDDPELQPFQFGLFLSMYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFVSTTVPKTLVNIQAQSKDISYIGCLTQVYFFVVFVG
MDDFLLTVMAYDRFVAICHPLHYVVIMNARLCVLLVLMCWFVFFCVALVHLLLLTQLTFCVGTEIPHFFCELDQILKVACSDTFINEVCMYVATALLCMLPLTGILFSYY
QIVSTLMKMVSTEGKYKAFSTCGSHLSVVTLFYGTSLGVYFTSAVTHSPHRISIASVMYTVVSPMLNPFIYSLRNKDVKRALGRLLS*
440 >lcl|XP_003123298.2|Plus1complement(1504100..1505038) NW_003534273 olfactory receptor 7D4-like LOC100517700 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSLFLLLGLSEDPELQPFLFGLFLSMYLVTVLGNLLIILTVSSDSHLHTPMYFFIANLSFVDICFVSTTVPKMLVNIQSQSRDISYVGCLTQVYFFMAFVGV
DDFLLTVMAYDRFVAICHPLHYMVIMNARLCDLLVLMCWFVVLSISLFHILLMVRLTFCVGTEIPHFFCELAQLLKAACSDTLINDICLYVATALLGVFPLTGILFSYSQ
IVSTLMKMASTEGKYKAFSTCGSHLSVVSLFYGTSLGVYLTSAVTHSPRRISIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLRRSAFCP*
441 >lcl|XP_003123299.1|Plus1complement(1539790..1540728) NW_003534273 olfactory receptor 7D4-like LOC100517880 __SEG__ Chr2 {Sus scrofa} MRAGNHTGVSLFLLLGLSEDPELQPLLFGVLLSMYLVTVLGNLLIIRAISSDSHLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQAQSKDISHVGCLTQVYFFMIFAGM
DGFLLTVMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWFVIFWVALIHLLLLMQLTFCVGTEIPHFFCELTQILKVACSDTLINDIFLLVTTVLLGVFPLTGIFFSYFQ
IVSSLMKMSSIEGKYKAFSTCGSHLSVVSLYYGTSLAVYLSSDVFHSPQRSSIASVMYTVVTPMLNPFIYSLRNKDVKGALVRLLSRGAPCG*
442 >lcl|XP_003123300.1|Plus11531055..1531990 NW_003534273 olfactory receptor 7A10-like LOC100518059 __SEG__ Chr2 {Sus scrofa} MDEGNQTGVLEFFLLGLSEDPELQPLLFGLFLSMYLVSVLGNLLIILAVTSDSRLHTPMYFFLSHLSFSDICFNSTIVPKMLVNIQTANKAITYAGCITQIYFFWFFGYL
DHFLLTVMAYDRFVAICHPLHYMIMMNPHLCCLLALVSWSLSVLVALLYGLMVLRLSFCTHMEIPHFFCEWAEVLKSSCSDALSNYIVFYSGTGLLGIPLMTGILYSYSK
ILSSILKMSSVEGRYKAFSTCGSHLTVISLYYGTGLGVYLSSAFFPSSSKGTVASVMYTVVIPMLNPFIYSLRNRDMQVALRTFVSRLFSL*
443 >lcl|XP_003123301.1|Plus1complement(1594270..1595208) NW_003534273 olfactory receptor 7A10-like LOC100518238 __SEG__ Chr2 {Sus scrofa} MDAGNQTGVLEFLLLGLSEDPELQPLLFGLFLSMYLVSVLGNLLIILAVSSDSHLHTPMYFFLSQLSFSDICFSSTIVPKMLVNIQTASKAITYAGCITQIYFYFTFGYL
DHFLLTVMAYDRFVAICHPLHYMIMMNSHLCGLLALVSWSLSVLVALLYSLMVLRLSFCTHMEIPHFFCELTEVLKSSCSDALSNYIAMFTVIGLLAIPPLTGILFSYSK
ILSSILKMSSTEGRYKAFSTCASHLVVISLFYGTGLGVYLSSAFSPSSSKGAVASVMYTVVIPMLNPFIYSLRNRDMKGALRKLFSWSFFPV*
444 >lcl|XP_003123302.1|Plus11741550..1742488 NW_003534273 olfactory receptor 7A10-like LOC100518599 __SEG__ Chr2 {Sus scrofa} MDAGNQTGVLEFLLLGLSEDLEWQPLLFGLFLSMYLVSVLGNLLIILAVSSDSRLHTAMYFFLSHLSFSDICFNSTIVPKMLVNIQTASKAITYGGCITQMYFYLVFLYL
DHFLLTVMAYDRFVAICHPLHYMTMMNPHFCSQLALVSWSVSILVALLHSLMVLRLSFCTHTEIPHFFCELTEVLQSSCSDALSNYIVLFSVTGLLGIPPLTGILFSYSK
ILSSILKMSSTEGRYKAFSTCGSHLTVISLLYGTGLGVYLSSAFSSSSSKGAVASVMYTVVIPMLNPFIYSLRNRDMQGALRTFVSRSFFPL*
445 >lcl|XP_003123305.1|Plus1144835..145773 NW_003534274 olfactory receptor 7A10-like LOC100519645 __SEG__ Chr2 {Sus scrofa} MDAGNQTCVLEFLLLGLSEDPELQPLLFGLFLSMYLVSVLGNLLIIMAVGSDPHIHTPMYFFLSHLSFSDICFNSTIVPKMLVNIQTANKAITYGGCITQMYFYLVFLYL
DHFLLTVMAYDRFVAICHPLHYMIMMNPHLCCLLALVSLSLSVLIALLYSLMVLHLSFCTHTEIPHFFCELTEVLQSSCSDALSNYIVLFSVTGLLGIPPLTGVLYSYSR
IISSILKMSSVEGRYKAFSTCGSHLTVISLLYGSGIGVYLGSAFSPSSSKGAVASVMYTVVIPMLNPFIYSLRNRDMQGALRKFVSRSFFPS*
446 >lcl|XP_003123306.1|Plus1198022..199029 NW_003534274 olfactory receptor 7E24-like LOC100520007 __SEG__ Chr2 {Sus scrofa} MDTYLGAPTLFCLFNPFFFFRRCPLNMEPQNLTLVSEFFLLSLTEDPHQQPLLFGLLLSMYLVTLLGNLLIILAVTSDSHLHTPMYFFLSNLSLADISVSSTTVLKMLVN
LQAHRRSISYAGCLAQVIFFSLFACLESLLLTVMAYDRLVAICHPLHYLVIMNPRLCGLLVLVSFSISLLDSQLQYLMMLHLTFCADLEIPHFFCELSQLLSLACSDISI
NIILMYFLGAILAGVPLSGILYSYTRILSSILRVSSSGGRYKAFSTCGSHLSVVCLFYGAALGVYLSSAVSSSSRKGAVVSMMYTVVIPMLNPFIYSLRNKDIKHALWRI
ISRVG*
447 >lcl|XP_003123307.1|Plus1complement(206870..207802) NW_003534274 olfactory receptor 7C1-like LOC100520178 __SEG__ Chr2 {Sus scrofa} MEPGNQTRVLEFLLLGLSQDSEQQPILFGLFLSMFVVTVVGNVLIILAISSDSHLHTPMYFFLYNLSLADICFTSTTIPKMLVNIQTQRKAISYVGCITQMYFFMVFGVM
DTFLLTLMAYDRFVAICHPLHYMVIMNPRLCGLLVLVSWFISVSYSLIQSLLMLQLSFCSNWVIPDFYCELAQALTLACSDTLVNYILLYLVTGFLGIVPFSGILCSYTR
IVFSILRIPSANGRYKAFSTCASHLSVVSLFYGTGLGVYLSSESSSWRGMVASVMYTVVTPMLNPFIYSLRNRDIKRALQKLLGRTLCVQ*
448 >lcl|XP_003123308.1|Plus1complement(347296..348228) NW_003534274 olfactory receptor 7C1-like LOC100520543 __SEG__ Chr2 {Sus scrofa} MESGNQTRVLEFLLLGLSQDSEQQPILFGLFLSMFVVTVVGNVLIILAISSDSHLHTPMYFFLYNLSLADICFTSTTIPKMLVNIQTQRKAISYVGCITQMYFFMVFGVM
DTFLLTLMAYDRFVAICHPLHYMVIMNPRLCGLLVLVSWFISVSYSLIQSLLMLQLSFCSNWVIPDFYCELAQALTLACSDTLVNYILLYLVTGFLGIVPFSGILCSYTR
IVFSILRIPSANGRYKAFSTCASHLSVVSLFYGTGLGVYLSSDSSSWRGMVASVMYTVVTPMLNPFIYSLRNRDIKRALQKLLGRTLCVQ*
449 >lcl|XP_003123309.1|Plus1338451..339458 NW_003534274 olfactory receptor 7E24-like LOC100520719 __SEG__ Chr2 {Sus scrofa} MDTYLGAPTLFCLFNPFFFFRRCPLNMEPQNLTLVSEFFLLSLTEDPHQQPLLFGLLLSMYLVTLLGNLLIILAVTSDSHLHTPMYFFLSNLSLADISVSSTTVLKMLVN
LQAHRRSISYAGCLAQVIFFSLFACLESLLLTVMAYDRLVAICHPLHYLVIMNPRLCGLLVLVSFSISLLDSQLQYLMMLHLTFCADLEIPHFFCELSQLLSLACSDISI
NIILMYFLDAILAGVPLSGILYSYTRILSSILRVSSSGGRYKAFSTCGSHLSVVCLFYGAALGVYLSSAVSSSSRKGAVVSMMSTVVIPMLNPFIYSLRNRDIKHALWRI
ISRVG*
450 >lcl|XP_003123310.1|Plus1322916..323926 NW_003534274 olfactory receptor 18-like LOC100520888 __SEG__ Chr2 {Sus scrofa} MDTYLGAPTLFCLFKSFFFFRRCPLNMEPQNLTLVSEFLLLGLTEDLDLQPLLFVLFLSMYLVTLLGNLLIILAVTSDSHLHTPMYFFLSNLSLADISISTITVPKMLVN
LQTHRRSISYAGCLAQVTFFTLFASLESLLLAVMAYDRLVAICHPLHYLVIMNPHLCGLSVLVSLSISLLNSQLHYLMMSQLTFCADVEIPHFFCELSQLLNLACSDTST
SNILIYFIGAIFGGIPLSGILYSYTRILSSILRGSSSSGGRYKAFSTCGSHLSVVCLLYGTGLGVYLSSAISSSPRKGAVASVMYTVFTPMLNPFIYSLRNRDIKSALWA
IISRIV*
451 >lcl|XP_003123313.1|Plus1complement(231062..232000) NW_003534274 olfactory receptor 7C1-like LOC100521430 __SEG__ Chr2 {Sus scrofa} MDAGNQTWVLEFLLLGLSEDAEQQPLLFGLFLSMYLVSMLGNLLIILAVSSDSRLHTPMYFFLSHLSFSDICCSSTIVPQMLLNIQTASKAIIYSGCITQMYFSSVFLCL
DNLLLTVMAFDRFVAICHPLHYRIMMNPLLCDLLALFSWSVSILFPLIPCLMALHLSFCTHTEIPHFFCELAEVLKSACSDAFRNYIAMYSLTGLLAIPPLTGIIVSYSK
IIYSILKMSSLEGKYKAFSTCGSHLTVISLFYGTGLGVYLSSAFSPSSSKGAVASVMYTVVTPMLNPFIYSLRNRDLQGALRKFVSRSSFPL*
452 >lcl|XP_003123316.1|Plus128713..29642 NW_003299519 olfactory receptor 7E24-like LOC100522302 __SEG__ Chr2 {Sus scrofa} MEPQNLTSVSDFFLLGLSEDPDLQPFLLGLFLSMYLVTMLGNLLIILAVTSDSHLHTPMYFFLSILSLADMGFTSTTVPRMIVNIQTHSRVISYVGCLTQMSFFILFGYT
DSTLLTVMAYDRFVAICHPLHYPGIMSPRLRCFLVWVSVFVRLLDSQLHNLLVLQVACFKDVEISNFFCHPSQLLKLACFDTFTNTIIVYFIGTISGFLPISGIFFSYYK
IVSLVLRVSSSAGMYKAFSTCGSHLSVVCLFYGTAIGGYLGSALSPSPKKDVETSVMYTLVTPMLNPFIYSLRNRVIKSALWRILHRTA*
453 >lcl|XP_003123320.1|Plus198223..99314 NW_003299519 olfactory receptor 7E24-like LOC100523047 __SEG__ Chr2 {Sus scrofa} MLRNIAEGTEVYNLSNELLISKIWIGFYIPPYLFHYYPPSFLFKKVSKEHRPGNLSSVSEFFLLGISNDPELQPLLFVLFLSMYLVTTLGNLIIILAVASDSHLHTPMYF
FLCNLSLADMGFISTTVSKMIVNIQTHTRVISYVGCLTQMSFFILFGCMDGTLLTVMAYDRFVAICHPLHYPVIMNPRFCCFLVLLSFLVSLLDSQLHNLIVLQVNCFKD
VEISNFFCDPSHLFNLACLDIFTNNIVTYFSGAIFGAIPFSAIFFSYYQILSSILRVPSSGGGYKAFSTCGSHLAVVCLFYGTGIGLYLSSAISLSPRNDAMASVMYTVV
TPMLNPFIYSLRNRDMKRAMRRFLSQTNLGHPF*
454 >lcl|XP_003123326.1|Plus1131191..132120 NW_003299519 olfactory receptor 7E24-like LOC100524482 __SEG__ Chr2 {Sus scrofa} MEPQNLTSVSDFFLLGLSEDPDLQPFLLGLFLSMYLVTMLGNLLIILAVTSDSHLHTPMYFFLSILSLADMGFTSTTVPRMIVNIQTHSRVISYVGCLTQMSFFILFGYT
DSTLLTVMAYDRFVAICHPLHYPGIMSPRLRCFLVWVSVFVRLLDSQLHNLLVLQVACFKDVEISNFFCHPSQLLKLACFDTFTNTIIVYFIGTISGFLPISGIFFSYYK
IVSLVLRVSSSAGMYKAFSTCGSHLSVVCLFYGTAIGGYLGSALSPSPKKDVETSVMYTLVTPMLNPFIYSLRNRVIKSALWRILHRTA*
455 >lcl|XP_003123327.1|Plus1153577..154494 NW_003299519 olfactory receptor 7E24-like LOC100524668 __SEG__ Chr2 {Sus scrofa} MELQNLTHVSEFLLMGLSDDPELQPFILGLFLCMYLVAILGNMLIILAVSSDSHPHTPMYFFLSNLSLADIGVITTTVPKMLVNIQAHSKSITYAGCLTQVSFFFLFGCL
DSLLLAVMAYDRLVAICYPLHYLVIIKPHVCGLLVLVSFFISLLDSQIHFLMISQLTFCTNVEIPNFFRDAPQLIHLACSDTSIDDILIYFTGGIPISGILYSYTQIVSS
ILRIPSTGGKYKVFATCGSHLSVVCLFYETALGVYLSSAVSPSPQKSLVASAMYTLVTPMLNPFIYSLRNKDIKNALWRIINRIA*
456 >lcl|XP_003123328.1|Plus1168559..169488 NW_003299519 olfactory receptor 18-like LOC100524849 __SEG__ Chr2 {Sus scrofa} MEPENHTYFSEFLLLGLSDDPDLQPLLFELFLSMYLVTLIGNLLIILAVSSDSHLHTPMYFFLSNLSLADISISTTTVSKMLVNLQTHNKTIRYAGCLAQVTFYPFFACL
ESLLLTVMAYDRLVAICHPLHYLMIMNSRLCGLLVLGSFSIGLLNSQLHYLMMSQLTFCADVKIPHFFCELSQLISLASSDTSTYNILIYFIGTIFGGIPLLGIFYSYAR
ILSSILRVSSSGGRYKAFSTCGSHLSIVCLLYGTGLGVYLSSAISSSPRKGAVASVMYTVFTPMLNPFIYSLRNGDIKRALWGIVSRIV*
457 >lcl|XP_003123329.1|Plus1187693..188700 NW_003299519 olfactory receptor 7E24-like LOC100525032 __SEG__ Chr2 {Sus scrofa} MDTYLGAPTLFGLFNPFFFFKRCPLNMEPQNHTHSSKFFLLSLSDDPDLQPLLFGLLLSMYLVTLLGNLLIFLAVTSDSHLHTPMYFFLSNLSLADISISTTTVPKMLVN
LQTHSKSITYAGCVTQVMLFALFACLESLLLTVMAYDRLVAICHPLHYLVIMNPRLCGFLVLLSFSISLLDSQLHYLMMSQLTFCADVEIPHFFCELSQLLSLACSDISI
NIILMYLIGTILAGIPFSGILYSYSQILFSILRISSSVGRYKAFSTCGSHLSIVCLLYGTGLGVYLSSAVSSSSRNGAVVSMMYTVVIPMLNPFIYSLRNRDIKHALWRI
ISRVG*
458 >lcl|XP_003123330.2|Plus1314772..315701 NW_003299519 olfactory receptor 7E24-like LOC100526096 __SEG__ Chr2 {Sus scrofa} MELQNLTHVSEFLLMGLSDDPELQPFILGLFLCMYLVSILGNMLIILAVSSDSHLHTPMYFFLSNLSLADIGFITTTVPKMLVNIQAHSKSITYAGCLTQVSFFSLFGCL
DSLLLSVMAYDRLVAICYPLHYLVIIKPRVCGLLVLVSFFISFLDSQIYFLMISQLTFCTNVKIPNFFCDAPQLLHLACSDTSIDNILIYFTGAIFGGIPVSGILYSYTQ
IVSSILRIPSTGGKYKIFSICGSHLSVVCLFYGTGLGVYLSSAVSPSPQKGSVASVMYTMVTPMLNPFIYSLRNKDIKNALWRIIGRIA*
459 >lcl|XP_003123333.1|Plus1736976..737893 NW_003299519 olfactory receptor 7G1-like LOC100511438 __SEG__ Chr2 {Sus scrofa} MEPENQTDIAEFLLLGLSEDTELQPLIFGLFLTIYLVTVLGNLLIILAISSDSHLHTPMYFFLSHLSFTDICFSTTTVLKMLANLQRQSKSISYMDCLIQVGFVLFFAGL
ENFLLAAMAYDRYVAICHPLRYRVIMNSCLCVLLILLSLVTSMVDALLHSLMVLRLSFCKNLEIPHFFCELAQVIKLACSDTLVNNILVYLVTSILGGVPLLGIIFSYTQ
IVSSVLSMPSAGGRYKAFSTCGSHLSVVSLFYGTAFGVYISSAVTPSSKKTAVASLMYTVVPPMLNPFIYSLRNEDIKRALRKLI*
460 >lcl|XP_003123337.2|Plus1<363664..364632 NW_003299519 olfactory receptor 18-like LOC100512155 __SEG__ Chr2 {Sus scrofa} FNTFFFFRSCPLNMEPQNLTHVSEFLLLGLSDDLDLQPLLFDLFLSVYLVTLIGNLLIILAVTSDSHLHTPMYFFLSNLSLADISISTTTVPKMLANLQTHNKSITYTGC
LAQVTFFSLFACLESLLLAVMAYDRLAAICHPLHYLVIMNPRLCGLLVLVSLSISFLTSQLHYWMMSQLTFCADVKIPHFFCDLSQLLGFACSDTSTNNILTHFIGTIFG
GIPLLGILYSYTQIFSSVLRVSSSGGKYKAFSTCGSHLFVVCLFYGTGLGVYLSSAISSSPSKGATASVMYTVVTPMLNPFIYSLRNKDIKSALWRTIRSIA*
461 >lcl|XP_003123338.1|Plus1<374876..375829 NW_003299519 olfactory receptor 18-like LOC100512332 __SEG__ Chr2 {Sus scrofa} FFRSCPLHMEPQNLTHVSEFLLLGLSDDLDLQPLLFDLFLSVYLVTLIGNLLIILAVTSDSHLHIPMYFFLSNLSLADISISTTTVPKMLANLQTHNKSITYAGCLTQLT
FFSLFACLDSLLLAVMAYDRLAAICHPLHYLVIMNPRLCGLLVLVSLSISFLDSQLHYWMMSQLTFCADVKIPHFFCDPSQLLSLACSDISTNNILIYFIGTIFGGIPLL
GILYSYTQIISSILRVSSLGGKYKAFSTCGSHLFVVCLFYGTGLGVYLSSAISSSPRKGAMASVMYTVVTPMLNPFIYSLRNRDIIHVLWGIITRRT*
462 >lcl|XP_003123339.1|Plus1390117..391046 NW_003299519 olfactory receptor 18-like LOC100512520 __SEG__ Chr2 {Sus scrofa} MEPQNHTHSSEFFLLSLSDDPDLQPLLFGLLLSMYLVTLLGNLLIILTVSSDSHLHTPMYFFLSNLSLADISISTTTVPKMLVNLQTHSKSIIYAGCLTQVMLFPLFACL
ESLLLTVMAYDRLVAICHPLHYLVIMNPRLCGLLVLVSFSVSLLDSQLHYLMMSQLTFCADVEIPHFFCELSQLLKLACSDISINIILMYFSGAILAGIPLSGILYSYIR
ILSSILRVSSSGGRYKAFSTCGSHLSVVCLFFGTGLGVYLSSAVSSSSRKGAVVSMMYTVVIPMLNPFIYSLRNRDIKHALWRIITRVG*
463 >lcl|XP_003123341.2|Plus1complement(502819..503787) NW_003299519 olfactory receptor 7A10-like LOC100513070 __SEG__ Chr2 {Sus scrofa} MDTGNQTSVLEFLLLGLSEDPELQPLLFGLFLSMYFISMVGNLLIILAITSDSYLHTPMYFFLSHLSFSVICVNCTIVPKMLVNIQTVSKAITYAGCITQMYFSSVFSCL
DNLLLTVMAYDRFVAICHPLHYRSMMNPHLCDLLALFSWSLSVLVALLQSLMLLHLSFCTHTEILHFFCELAELLKSACSDALTNYIALYSAAGLLGIPPLTGILFSYSR
IISSILKMSSVEGRYKAFSTCGSHLTVISLFYGTGLGVCLSSAFSSSSSKGAVASVMYTVVIPMLNPFIYSLRNRDMQGALRKFVSRSFFPCEWLWMLRLGS*
464 >lcl|XP_003123342.1|Plus1537776..538795 NW_003299519 olfactory receptor 7C2-like LOC100513268 __SEG__ Chr2 {Sus scrofa} MSKFQMYGTFLSVNIVLASLQTISMNYMEIGNQTAMSKFILLGFSEDMDLQPLLFGLFLSMYLVTVFGNLLIILAVTSDSHLHTPMYFFLSNLSFTDICFTSTTLPKMLV
NIQMQNKAITYEGCLTQMYFFMIFAGLDDLLLTVMAYDRFVAICHPLHYTVIMSPRLCGLLLLLSWLICLTYSLVQSLMVLRVSFCQETEIPHFFCEHAQILKLACSDTL
VNDIVLYFVTGLLGVIPLIGILFSYSRIISSIMGISSAGRKYKVFSTCGSHLSVVSLFYGAGLGVYLTFGTAHPSRKGTIASVMYTVIAPMLNPFIYSLRNRDMKGALRR
LFTRGIYSQ*
465 >lcl|XP_003123343.1|Plus1complement(420058..420996) NW_003299519 olfactory receptor 7D2-like LOC100513459 __SEG__ Chr2 {Sus scrofa} MDVGNQTGVLEFLLLGLSEDSELHPLLFWLFLSMYLVSVLGNLLIILAVTSNSHLHTPMYFFLSHLSFSDICFNSIIVPKMLVNIWTASKAITYSGCITQMYFSLVFSCL
DNLLLTVMAYDRFVAICHPLRYRIMMDPQLCDLLVLVSWSVGFLLPLLHSLMVLHLSFCRHTEIPHFFCELTEVLKSACSDAFINYLALYSMTGLLTIIPLTGILFSYSK
IISSILKMSSVEGKYKAFSTCGSHLMVISLYYGTGLGVYLSSAFFSSSSKGAVASVMYTVVTPMLNPFIYSLRNRDMKGTLKKFVSRSFFLL*
466 >lcl|XP_003123350.1|Plus1<606251..607219 NW_003299519 olfactory receptor 7G1-like LOC100515126 __SEG__ Chr2 {Sus scrofa} HRSIFSIRFLNNMEWRNETRVSDFLLMKVTEDPELRSLLFSLFLLMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSINDICLSTTTIPKMLVNIHTQNQSIPYAGCL
TQIYFVLVFASLESCLLAAMAYDRYVAICHPLRYTVIMNSRLCGLLILLPLLIIIVDALLHSLMVLQLTFCTDLQIPLFFCEVVQVIKLACSDALINNILIYVATSVFGG
IPVCGIIFSYVQIVSSVLRMPSVGGKYKAFSTCGSHLSVVSLFYGTGLGVYISSALTNSSRKTAVVSMMYTVVPQMMNPFIYSLRNRDMKGALKKLIKTSLL*
467 >lcl|XP_003123351.1|Plus1complement(762691..763629) NW_003299519 olfactory receptor 7G1-like LOC100515300 __SEG__ Chr2 {Sus scrofa} MGPRNKTGVSQFLLMEVTEDPELQLFLFILFLSIYLVTILGNLLIILTVLSDSHLHTPMYFFLYNLSFTDICLSTTTITKMLVNIHTQNQSIPYAGCLTQIYFVLVFASL
ESCLLAAMAYDRYVAICHPLRYTVIMNSHICGQLILFSLFISILDALLHSLMVLQLTFCTDLQIPLFFCEVVQVIKLACSDALINNILIYVATSVFGGIPVCGIIFSYVQ
IVSSVLRMPSVGGKYKAFSTCGSHLSVVSLFYGTGLGVYISSALTNSSRKTAVVSMMYTVVPQMMNPFIYSLRNRDMKGALRKLSSKIPLFF*
468 >lcl|XP_003123352.1|Plus1complement(748235..749248) NW_003299519 olfactory receptor 7G1-like LOC100515471 __SEG__ Chr2 {Sus scrofa} MYYILFSFHFLPIRFIGSMETRNQTDVSEFLLLGLTDDPELQPFIFLLFLSMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSFTDICISTTTMPKMLVNIQAHNQSI
TYRGCLIQICFALVFASLENFLLAVMAYDRYVAICYPLRYTVIMNPQLCVLLILLSLFISAVIGLLHSLMALRLSFCKDLEIPHFFCELPQVIKLACSDTLINNILIYSV
AGLFGGVPLSGIIFSYIQIVSSVLRMPSLGAKLKAFSTCGSHLLVVSLFYMTGFGVYISFIVNDSSKKSAVASVMYLVVPQMMNPFIYSLRNRDIKGALKKLNSGLHSFL
CLYDEAK*
469 >lcl|XP_003123354.1|Plus1675639..676580 NW_003299519 olfactory receptor 24 LOC396790 __SEG__ Chr2 {Sus scrofa} MEIRNKTSTSEFILLGLSEYPEQETLLFALFLCMYVVMAMGNLLIILAITSDSHLHTPMYFFLANLSLVDFGLATNTVPKMLVNIQTKSKSISYSCCLTQMYFFHFFGII
DSVLIAVMAYDRFVAICHPLHYTTIMSPRLCGLLAGTPWMFSYFISLTHILLMVRLVFCGNNKIPHYFCDLTPLLRLSCTDTSVNKIFVLIVAGMVIATPFICILASYVR
IIVAIMKVPSAGGRKKAFSTCSSHLSVVTLLYGTTIGVYLCPSSVRTAVKEKASAVMYTLVTPMLNPFIYSLRNRDLKEALRNLISKKIIPSS*
470 >lcl|XP_003123428.1|Plus1complement(193514..194458) NW_003534278 olfactory receptor 7A17-like LOC100517517 __SEG__ Chr2 {Sus scrofa} MVPGNYTQNSEFFLQGLSKEPELQPLIFGLFLSMYLITVFGNLLIILAASSDSHLHTPMYFFLSNLSFVDICFTTTTILKMLINIHTRSKVISYEGCISQMYFYILFAVL
DDFILSVMAYDRFLAICHPLHYTVIMNPRLCGLLVLVSWIISALHSLLESLLVLRLSFCTDLEIPHFFCEIKQIVNLACDTFLNDTIMYFTALLIGGGPLAGILYSYSKI
ISSIHGMASAGGKYKALSTCASHLLVVFLYYCSGVGVYLSSAPTHSSHLSTIATVMYTVVTPMLNPFIYSLRNKDIKRALKKVIQMAVIKRQVT*
471 >lcl|XP_003123429.1|Plus1complement(301092..302024) NW_003534278 olfactory receptor 7A17-like LOC100518060 __SEG__ Chr2 {Sus scrofa} MELRNDTRISVFLLLGLSKEPELQALILGLFFSMYLITVFGNLLLILAVISDSHLHTPMYFFLSNLSFTDICFTSTTIPKMLMNIKTKINVITYEGCISQIYFFLLFASL
ENFLLAVMAYDRFVAICYPLHYTVIMKPWLCGILVLVSWMISALNSLLQSLMVLWLSFCTKVEIPHFFCEINQVVQLACSDTFLNDITMYFAAGMLGGASLSGILYSYSK
IVSTIREITSVQGKYKAFSTCASHLSVVSLFYCTVLGVYFSSAGTHSSNSSAIASVMYTVVTPMLNPFIYSLRNKDIKTALKRIIGITVT*
472 >lcl|XP_003123430.1|Plus1complement(315014..315937) NW_003534278 olfactory receptor 7A17-like LOC100518239 __SEG__ Chr2 {Sus scrofa} MEPGNDTQISEFLLLGISNEPELQPLIFGIFLSMYLITVFGNLLIFLAIISNPHLRTPMYFFLSNLSFVDICFISTTIPKMLWNIHMQSKGITYAGCISQIYFLLLFAGL
DDFLLTVMAYDRFVAICRPLHYTVIMNPWLCGLLVLVSWIMSALNSLIQTLMILWLPFCRVLEIPHFFCELNQVVRGACCDTFLNDIMVFIAAGLLSGGPFIGILSSYSK
IVSSIRGISSTQGKYKAFSTCVSHLSVVALFYGTVLGVYLNPADAHSSYNSITTSVMYTVVTPLLNPFIYSLRNKDIKGALRRFIGL*
473 >lcl|XP_003123433.2|Plus1221519..222472 NW_003534279 olfactory receptor 7A10-like LOC100519297 __SEG__ Chr2 {Sus scrofa} MAPRNITGVSGLLLLGFSEEADMHPLIFGLFLSMYLITVFGNLLLILAVSSDSCLHTPMYFFLSNLSFVDICFISTTIPKMLQNICSKRQVITYAGCITQMYFFILFVGL
DALLLTVMAYDRFVAICHPLHYMVIMNPQICRILVMASWITSVLDSLLQTLMTLRLSFCRNVKLPHYFCELRQLIQLACSDKCLNNMVMNFAAGLLGGIPLAGILYSYYK
IVASIRGISSAEGKYKAFSTCASHLSGVSLFFSTSLGIYLSSSATHSSYLIEINSVMYTVVTPMLNPFIYSLRNKHIKRSLKAFFHMAAIRSPVDLG*
474 >lcl|XP_003123435.1|Plus1328703..329653 NW_003534279 olfactory receptor 7A17-like LOC100520363 __SEG__ Chr2 {Sus scrofa} MEQGNVTQISEFLLQGLWKEPKLQPFIFGLFISMYLITVFGNLLIILAVSLDSHLHMPMYFFLSNLSFVDISFTSTTIPKMLMNIQTENKIITYKGCITQMYFFMLFAGL
DDFLLTVMAYDRFVAICYPLHYTVIMKPWLCGLLVLVSWMISALNSLLQSLMVLWLSFCTELEIPHFFCEIKQVVRLACSDTFLNDMVMYFAAGMLGGVSLTGILYSYSK
IVSSIRGISSSQGKYKAFSTCASHLSVVSLFYCTVLGVYLSSAGTHSSHSGAVASVMYTVVTPMLNPFIYSLRNKDIKRALRRITWPIFLGLKKCS*
475 >lcl|XP_003123436.1|Plus1361498..362421 NW_003534279 olfactory receptor 7A17-like LOC100520721 __SEG__ Chr2 {Sus scrofa} MEPRNDTQISEFLLLGISNEPELQPLIFGLFLSMYLITVFGNLLIFLAIISNPHLRTPMYFFLSNLSFVDICFTSTTIPKMLWNIHMQSKGITYAGCISQIYFLLLFAGL
DDFLLTVMAYDRFVAICRPLHYTVIMNPWLCGLLVLVSWMMSALNSLIQTLMTLWLPFCRVLEIPHFFCELNQVVRGACCDTFLNDIMVFIAAGLLSGGPFIGILYSYSK
IVSSIRGISSTQGKYKAFSTCVSHLSVVALFYGTVLGVYLNPADAHSSYNSITTSVMYTVVTPLLNPFIYSLRNKDIKGALRRFIGL*
476 >lcl|XP_003123438.1|Plus1complement(107342..108295) NW_003534280 olfactory receptor 7A17-like LOC100521249 __SEG__ Chr2 {Sus scrofa} MVPGNYTQNPEFFLQGLSKEPELQPLIFGLFLSMYLITVFGNLLIILAASSDSHLHTPMYFFLSNLSFVDICFTTTTILKMLINIHTQSKVISYEGCISQMYFYILFAVL
DDFILSVMAYDRFLAICHPLHYTVIMNPRLCGLLVLVSWIISALHSLLESLLVLRLSFCTDLEIPHFFCEIKQIVNLACDTFLNDTIMYFTALLIGGGPLAGILYSYSKI
VSSIHGMTSAGGKYKALSTCASHLSVVSLYYCSSLGVYLSSAPTHSSPLSTTASVMYTVVTPMLNPFIYSLRNKDIKRALKKVIQMAVIKGKLHKKE*
477 >lcl|XP_003123440.1|Plus1complement(49286..50209) NW_003534280 olfactory receptor 7A17-like LOC100521605 __SEG__ Chr2 {Sus scrofa} MEPRNDTQISEFLLLGISNEPELQPLIFGLFLSMYLITVFGNLLIFLAIISNPHLHTPMYFFLSNLSFVDICFISTTIPKMLWNTHMQSKGITYAGCISQIYFLLLFAGL
DDFLLTVMAYDRFVAICRPLHYTVIMNPWLCGLLVLVSWMMSALNSLIQTLMTLRLSFCRVLEIPHFFCELNQVVRGACCDTFLNDIMVFIAAGLLSGGPFIGILYSYSK
IVSSIRGISSTQGKYKAFSTCVSHLSVVALFYGTILGVYLNPADAHSSYNSITTSVMYTVVTPLLNPFIYSLRNKDIKGALRRFIGL*
478 >lcl|XP_003123441.1|Plus1complement(71599..72555) NW_003534280 olfactory receptor 7A17-like LOC100521773 __SEG__ Chr2 {Sus scrofa} MEPCNDTQISEFLLLGFAEEPEWQLLIFGLFLYMYLITVFGNLLIILVVTSDCQLHKPMFFFLSNLSFVDICFISTTIPKMLWNIQTQSKVITYEDCITQIYFFILSAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNPQLCRLLVLVSWIICILNSLLQCLMTLQLSFRGSVEIPHFFCDLSQIIQLSCSDTFLNNMVMYFTVGLLGGGPLAGILYSYSK
IVSCIRRISSAQGKYKAFSTCASHLLVVSLFFCTSIGVYFSAAATHGSHASAVASVMYTVVTPLLNPFIYSLRNKDIKGALKRFFAMESLKRKLILGL*
479 >lcl|XP_003123442.1|Plus1132331..133281 NW_003534280 olfactory receptor 7A17-like LOC100521949 __SEG__ Chr2 {Sus scrofa} MVPGNDTQISAFILLGFSEDPQLLPLIFGLFLSMYLITVLGNLFIILAVSSDSQLHTPMYFFLSNLSFVDICFISTTIPKMLVNIQIQSQVISYEGCMTQMYFFLLFIQL
DIFFLTVMSYDRFVAICHPLHYTDIMNPILCGILVLISWVIGALNSLLQSLLALRLSFCTSLEIPHFFCELKQMVQIASGDTFLNNAVMYFGVGLFGGVPLVGILYSYSR
IVSSIHGISSAWGKYKAFSTCASHLSVVSLFYCTGLGVYVSSAATHSPQSSATASVMYTVVTPMLNPFIYSLRNKDIKRALKILFRVAAIKGPIVL*
480 >lcl|XP_003123443.1|Plus1complement(151767..152723) NW_003534280 olfactory receptor 7A17-like LOC100522303 __SEG__ Chr2 {Sus scrofa} MEPCNDTQISEFLLLGFAEEPEWQLLIFGLFLYMYLITVFGNLLIILVVTSDCQLHKPMFFFLSNLSFVDICFISTTIPKMLWNIQTQSKVITYEDCITQIYFFILSAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNPQLCRLLVLVSWIICILNSLLQCLMTLQLSFRGSVEIPHFFCDLSQIIQLSCSDTFLNNMVMYFTVGLLGGGPLAGILYSYSK
IVSCIRRISSAQGKYKAFSTCASHLLVVSLFFCTSIGVYFSAAATHGSHASAVASVMYTVVTPLLNPFIYSLRNKDIKGALKRFFAMESLKRKLILGL*
481 >lcl|XP_003123444.1|Plus1complement(262487..263443) NW_003534280 olfactory receptor-like protein OLF4-like LOC100522478 __SEG__ Chr2 {Sus scrofa} MEPDNDTRISEFLLLGFAEEPEWQLLIFGLFLSIYLITVFGNLLIILAVSSDAQLHKPMYFFLSNLSFVDICFISTTIPKLLWNIQTQSKVITYKGCITQIYFFIFSAVL
DIFLLTVMAYDRCVAICHPLHYTVIMNPQFCRLLLLVSWIMSILNSLLQSLMSLKLSFCTDVEIPHFFCDLSQIIQLACSDTILNNIVMYFASVLLGAGPLGGILYSYSK
IISSIHGISSAQGKYKAFSTCASHLSVVSLFFCTSIGVYLSSAATPSSQSNATVSVIYTVVTPMLNPFIYSLRSKDIKGALKRVFMITILKRKFILGL*
482 >lcl|XP_003123446.1|Plus1complement(235800..236768) NW_003534280 olfactory receptor 7A17-like LOC100522853 __SEG__ Chr2 {Sus scrofa} MEPGNSTQIEKFLLLGLSEDPEQQPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSIVDICFTSTTIPKMLWNIQTQNKVITYKGCITQIYFYILFAGL
DDLLLSVMAYDRFVAICHPLHYMDIMNPGFCGLLVLLSWIMMVMYSLLHSLMVLRLSFCPDLEIPHFFCELSQVVQLASSDNFLNNLVMYFAAVLMGVGPFASILYSYSK
IVACILGISSAQGTYKAFSTCGSHISVVSLFYCTLLGTYLSSAATHSSHSSSVTSVMYTVVMPMLNPFIYSLRNKDIKRGLKRFYLMPCIKSPIILGVMKSP*
483 >lcl|XP_003123447.1|Plus1384003..384935 NW_003534280 olfactory receptor 7A17-like LOC100523950 __SEG__ Chr2 {Sus scrofa} MGPDNDTQISTFLLLGLSKERDFQPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTIIPKMLVNIQTENKVITYAGCITQLYFSTLFGGW
DNFLLAVMAYDRFLAICHPLHYTVKMSPQFCGLLVLVSWILSVLNSLLQSLIVLQLSYTDMEIPHFFCDLNQMVKLGCSDTFLNDTVLYFSTGLLAGGPLAGILYSYSKI
ISSLCRISSAQGKYKAFSTCASHLSVVSLFYFSVLGVYLISAATHSSHSIAVASVMYSVVTPMLNPFIYSLRNKDIKGALKRFYEMAGIK*
484 >lcl|XP_003123448.1|Plus1<399127..400101 NW_003534280 olfactory receptor 7A10-like LOC100524135 __SEG__ Chr2 {Sus scrofa} GNLTGVSEFLLLGFSEEQELQPMIFMLFFSMYLSTVFGNLFIILAAISDSHLHTPMYFFLSNLSFVDICFTSTIIPKMLQNIQTQRKVITFEGCMIQMYISILSLGLDDF
LLTVMAYDRFVAICHPLHYRVIMSPQHCGLLVLVSWIISVAYSFLQTLMVLHLSFYTNLQIPHYFCELNQLVQLACSDTFLNDTVMYFVAPLLGGGPLVGILYSYSKIVS
SILRISSGQGKYKAFATCASHLSVVSLFYCTMLGVYLSSAANHSSQSSAIASVMYTVVTPMLNPFIYSLRNKDIKRALKRFVEMALIKGANILVQDKGTRWQGS*
485 >lcl|XP_003123450.1|Plus1complement(477818..478867) NW_003534280 olfactory receptor 7A17-like LOC100525034 __SEG__ Chr2 {Sus scrofa} MGKLLYSAMWVMPICEKISHVIFLSPGSHLYPLEAQNNTQISEFILLGFSEEPKAQPLIFGFFLSMYLITVFGNLIIIQAVSSDSHLHTPMYFFLSNLSFTDICFTSTTI
PKMLWNIQNKSKVITFDGCITQIYFYILFAGLDDILLSVMAYDRFVAICHPLHYSVIMNPRLCGLLVLISWTLSAMYSLLHSLMVLGLSFCPDLEIPHFFCELNQVVQLA
SSDTFVNNMVMYFSTVLLAGGPFAGILYSYSKIVSCIRRISSAQGKFKAFSTCMSHLSVVSLFYCTSLGVYLSSSATHSSHSSVIASVMYTVVMPMLNPFIYSLRNKDIK
RALKRFYLMPDSKAQLSWG*
486 >lcl|XP_003123451.1|Plus1complement(540433..>541407) NW_003534280 olfactory receptor 7A10-like LOC100525388 __SEG__ Chr2 {Sus scrofa} GNLTGVSEFLLLGFSEEQELQPMIFMLFFSMYLSTVFGNLFIILAAISDSHLHTPMYFFLSNLSFVDICFTSTIIPKMLQNIQTQRKVITFEGCMIQMYISILSLGLDDF
LLTVMAYDRFVAICHPLHYRVIMSPQHCGLLVLVSWIISVAYSFLQTLMVLHLSFYTNLQIPHYFCELNQLVQLACSDTFLNDTVMYFVAPLLGGGPLVGILYSYSKIVS
SILRISSGQGKYKAFATCASHLSVVSLFYCTMLGVYLSSAANHSSQSSAIASVMYTVVTPMLNPFIYSLRNKDIKRALKRFVEMALIKGANILVQDKGTRWQGS*
487 >lcl|XP_003123452.1|Plus1complement(555594..556526) NW_003534280 olfactory receptor 7A17-like LOC100525562 __SEG__ Chr2 {Sus scrofa} MGPDNDTQISTFLLLGLSKERDFQPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTIIPKMLVNIQTENKVITYAGCITQLYFSTLFGGW
DNFLLAVMAYDRFLAICHPLHYTVKMSPQFCGLLVLVSWILSVLNSLLQSLIVLQLSYTDMEIPHFFCDLNQMVKLGCSDTFLNDTVLYFSTGLLAGGPLAGILYSYSKI
ISSLCRISSAQGKYKAFSTCASHLSVVSLFYFSVLGVYLISAATHSSHSIAVASVMYSVVTPMLNPFIYSLRNKDIKGALKRFYEMAGIK*
488 >lcl|XP_003123455.2|Plus1154662..155594 NW_003299527 olfactory receptor 7A17-like LOC100510893 __SEG__ Chr2 {Sus scrofa} METDNDTQILEFLLLGFSKQPESQPIIFGLFCSMYLITVFGNLLIILAVISDYHLHIPMYFFLSKLSFVDICFTSTTIPKMLWNIQTQSKAITYEGCITQIYFLILFAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLVLVPWVMSVLNSLLQTLMMMQLSFCTNFEIPHFFCELNQMIQLACSDTFLNTIVMYFAASLLCGGPFFGILCSYSK
IVSSICRISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAAAHSSHSSATASVMYTVITPMLNPFIYSLRNKDMKRALKALFVKGPM*
489 >lcl|XP_003123456.2|Plus1140028..140960 NW_003299527 olfactory receptor 7A17-like LOC100511069 __SEG__ Chr2 {Sus scrofa} MELGNDTQISEFLLLGFSEDPELQLIIFGIFLSMYLITVFGNLLIILAISSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQMQSKTITYEGCITQIYFLILFAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLVLMSWIINILNSLLQSLMMLRLSFCTNFEIPHFFCELNHMVQLACSDTFLNTIVMYFAAVLLGGGPFAGIIYSYSK
IVSSIRRISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAATHSAHSSSTASVMYTVITPMPNPFIYSLRNKDMKKALKAFFVKGTV*
490 >lcl|XP_003123457.1|Plus1128179..129111 NW_003299527 olfactory receptor 7A17-like LOC100511247 __SEG__ Chr2 {Sus scrofa} MEAENDTSVSEFYLMGLSKEPALQPLIFGLFLSMYLITVFGNLLIILAVSLDSHLQTPMYFFLSNLSFVDICFTTTTIPKMLQNIWTQNKVITYEGCIIQMYFFILFATL
DMFLLTVMAYDRFVAICHPLHYTVIMKPLLCRLLVLASWIMSALNSLFQSIMVLWLSFCTDLEIPHFFCEINQVVQLACSDTSLNDTVMYFAAGVYGGASLTGILYSYFK
IVSSIQRISSLRGKYKAFSTCASHLSVVSLFYCTVLGVYLSASATHSSHSSAVASVMYTVITPMLNPFIYSLKNKDIKRALRRITGMAAM*
491 >lcl|XP_003123458.1|Plus1112698..113654 NW_003299527 olfactory receptor 7C2-like LOC100511440 __SEG__ Chr2 {Sus scrofa} MEIRNQTRYFLLLGFTEEPDMQPLLFGLFLSMYLSTFTGNLLIILAIISDSHLHMPMYFFLSNLSFADLCFTSTTIPKMLMNIQTQSKVITYAGCLSQVFFFFVFGCLDN
LILTVMAYDRFVAICHPLYYTVIMNPQVCRMLALGSWCISVTGSLLDTLTLLRLSFCMNMNIPHFFCDLPEVLKLACSDTLINNIVVYFVVVVLGIFPLSGILFSYSQIF
SSILRISSSKGKHKAFSTCGSHLSVVSLFYGTSLGVYLSSAATSSSRTSLVASVMYTMITPMLNPFIYSLRNRDMKRALGRLLSRVASLSDGVVAGFS*
492 >lcl|XP_003123459.1|Plus168896..69864 NW_003299527 olfactory receptor 7A17-like LOC100512156 __SEG__ Chr2 {Sus scrofa} MAPRNQTGISEILLMGFMDESELQPIIFIIFLSLYLITVFGNLLIILVVSSDSHLHSPMYFFLSNLSFVDIYFTSTTIPKMLWNIQTQSKVIPFEGCIIQMYFFTLFAGL
DSLILTVMAYDRFEAICHPLRYTVIMNLWFCLLLVLVSWIISALHSLLESLMVLQLSFCPVLEISHFFCELNQMIQLASSDTFLNNLVMYCGAVLLAGISLTGILYSYSK
IVSSIHAISCSQGKYKAFSTCASHLSVVSLFYCTSLGVYLSSAATHSSYSSATTSVMYTVVTPMLNPFIYSLRNKDLKKGLKILYRKVTVKGPLVLGLRKCP*
493 >lcl|XP_003123460.1|Plus140707..41648 NW_003299527 olfactory receptor 7A17-like LOC100512522 __SEG__ Chr2 {Sus scrofa} MYGTNNNTHISKFLLLGLSNEPELQPLTFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTHSKVITYEGCIIQMFFFLLFGG
SDVFLLTMMAYDRFVAICHPLHYTVIMNPWHCVLLLLSSYTISFPYSLLQSLTVVQLSFCTNREIPSFFCETNQVVQLACSDTFICDMVKYLAAVLLGGGSLAGIISSYS
KIVSSIKGISSAHGKYKAFSTCASHLSVVFLFYCSVLGVYVISAVAHSSHSSATASVMHSVITPMLNPFIYSLRNKDIKEALKILFGKKKYRG*
494 >lcl|XP_003123462.1|Plus1237049..238017 NW_003299527 olfactory receptor 7A10-like LOC100512890 __SEG__ Chr2 {Sus scrofa} MTLRNITGVSEFLLLGFSEKPELQPFIFGIFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLANTQTENNVITYAGCITQLYFFILFVGL
DDFLLTVMAYDRFVAICHPLHYRVIMNPQLCGLLVLASWVISVLTSLLQTLMVLKLSYNKVKIPHYFCELNQVVHLACSDTFLNDMVMYFAIVLLVGGPLAGILYSYSKI
VSSIRRITSAQGKYKAFSTCVSHLSVVSLFYCTSIGVYLSSEDTRSSHSRVFASVMYTVVTPMMNPFIYSLRNKNIHRALKAFFRTIAIKGPLVFGWRRTHG*
495 >lcl|XP_003123465.2|Plus1108695..109627 NW_003299529 olfactory receptor-like protein OLF4-like LOC100514036 __SEG__ Chr2 {Sus scrofa} MELGNDTQISEFLLLGFSEDPELQPIIFGIFLSMYLITVFGNLLIILAISSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQMQSKTITYEGCITQIYFLILFAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLVLMSWIINILNSLLQSLMMLRLSFCKNFEIPHFFCELNHMVQLACSDTFLNTIVMYFAAVLLGGGPFAGIIYSYSK
IVSSIRRISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAATQSAHSSSTASVMYTVITPMLNPFIYSLRNKDMKRALKAFFVKGTV*
496 >lcl|XP_003123476.1|Plus1196797..197747 NW_003299529 olfactory receptor 7C2-like LOC100518112 __SEG__ Chr2 {Sus scrofa} MESGNQTGVRNFLLLGFTKEPALFWLFLSMYLIIFTGNLAIILAIISDSHLHTPMYFFLSNLSFADFCFTSTTIPKMLMNLQTERKVITYAGCLSQIFFFIVFGCLDNLL
LTVMAYDRFVAICHPLNYTVIMNPQVCGMLALGSWCISIIGSLLGTLTLLRLSFCRNMNISQFFCDLPEVLKLACSDTLINNIVLYFVTIALGVFPLSGILFSYSQIFSS
ILRISSVRGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSAMTSSSRTSMVASLMYTMVTPMLNPFIYSLRNKDMKGALIRLLGRAASLSVGTFTRLS*
497 >lcl|XP_003123483.1|Plus1177700..178674 NW_003534281 olfactory receptor 7A17-like LOC100519414 __SEG__ Chr2 {Sus scrofa} MEPGNSTHISKFLLLGFSEEPKLQPLIFGLILSMYLITVFGNLLIILAASSDSHLHSPMYFFLCNLSFVDICFTSTTIPKMLWNIQTQNQLITYKGCITQIYFYIHFAGL
DIFLLTVMAYDRFVAICDPLHYMLIMNPQLCGLLVLVSWVMCAMYSLLHSLMVLQLSFCIDLEIPHFFCEIKQVVQLACSDTFLNNMVMHFGAGLLGGSTLAGILYSYSK
IISSICRNSSTQGKHKAFSTCVSHLSVVSLFYCTSLGVYLSPFATHSSQSSATAALMYTVVTPMLNPFIYSLRNKDIRRALKGFSGMETFTKGAFVLRLKKCTG*
498 >lcl|XP_003123484.1|Plus1160559..161527 NW_003534281 olfactory receptor-like protein OLF4-like LOC100519591 __SEG__ Chr2 {Sus scrofa} MEPGNNTHISKFLLEGLSEDPKLQPLIFSLFLFMYLITVFGNLLTILAVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTQSKVITYEGCITQMYFYLLFGDL
DDVLLSVMAYDRFVAICHPLHYMSIMNPGLCRLLVLISWIMMAMYSLLHTLMVLRLSFCPDLKIPHFFCELNQMVQLASSDTFLNNLVMYFAALLMSVGPFSGILYSYLK
IFACIHRISSVQGKYKAFSTCVSHLSVVFLFYCTGLGVYISSAATHSSHSSAIASVMYTVVLPLLNPFIYSLKNKDIKNALKSLYLVPGIKWTIILGVMKCP*
499 >lcl|XP_003123486.1|Plus1<19490..20431 NW_003534281 olfactory receptor 7A10-like LOC100519945 __SEG__ Chr2 {Sus scrofa} STFLLLGLSKEQESQPLIFGLFLSMYLITVFGNLLIILSVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLVNIQTENKLITYTGCITQLYFSTLFGGWDNFLLAVMA
YDHFFAVCHPLHYMVKMSPQFCGPLVLVSWILGALNSLLQTLMVLQLSFCTDLEIPHFFCDLDEVVKLSCSDTFLNDTVLYFSAGLLAGGPLAGILYSYSKIVSTVCRIS
SAQGKYKAFSTCASHLSVVSLFYFSVLGDYLMSAATHSSHSTAVASVMYTVVTPMLNPFIYSLKNKDLKGALKRFCEMTGVKWTTVLKVTNCP*
500 >lcl|XP_003123488.1|Plus172577..73566 NW_003534281 olfactory receptor 7A10-like LOC100520829 __SEG__ Chr2 {Sus scrofa} MFSSPFLLVTFNTWHQDITGISEFFLLGFSEGAAMQPLIFGLFLSMYLITVFGNLLLILAVSSDSRLHIPMYFFLSNLSSVDICFISTTIPKMLWNIYSKRQVITYAGCI
TQMYFFLLFAGLDDLLLNVMAYDRFVAICHPLHYRVIMEPQLSGILVMVSWIISVLHSLLQTLMTLRLSFCREVKMPHYFCELKQLIQLVCSDKCLNNMVMNFAAGLLGG
VPLAGILYSYYKIVASIRRISSAQGKNKAFSTCASHLSVVSLFFSTSLGVYLSSSATHSSYLIEINSVMYTVVTPILKPFIYSLRNKHIKRALKAFFHMAAIRSPVDLG*
501 >lcl|XP_003123489.1|Plus1101780..102736 NW_003534281 olfactory receptor 7C2-like LOC100521182 __SEG__ Chr2 {Sus scrofa} MEIRNQTRYFLLLGFTEEPDLQPLLFGLFLSMYLTTFTGNLLIILAIISDSHLHMPMYFFLSNLSFADICFTSTTIPKMLMNIQTQSKVITYAGCLSQVFFFFVFGCLDN
LILTVMAYDRFVAICHPLYYTVIMNPQVCRMLALGSWCISVTGSLLDTLTLLRLSFCMNMNIPHFFCDLPEVLKLACSDTLINNIVVYFVVVVLAVFPLSGILFSYSQIF
SSILRISSSKGKHKAFSTCGSHLSVVSLFYGTSLGVYLSSAATSSSRTSLVASVMYTMITPMLNPFIYSLRNRDMKRALGRLLSRVASLSDGVVAGFS*
502 >lcl|XP_003123490.1|Plus1117120..118052 NW_003534281 olfactory receptor 7A17-like LOC100521364 __SEG__ Chr2 {Sus scrofa} MEAENYTSISEFYLLGLSNEPALQPLILGLFLSMYLITVFGNLLIILAVSLDSHLQTPMYFFLSNLSFVDICFTTTTIPKMLQNIWTQNKVIAYEGCIIQMYFFILFATL
DMLFLTVMAYDCFVAICHPLHYTVIMKPLFCGLLVLASWIMTALNSLFQSIMVLWLSFCTDFEIPHFFCEINQVVQLACSDTSLNDKVMYFAAGVYAGASLTGILYSYSK
IVSSIRRISSVQGKYKAFSTCASHLSVVSLFYCTVLGVYLSASATHSSHSSAVASVMYTVVTPMLNPFIYNLKNKDIKRALRRITGMAAM*
503 >lcl|XP_003123491.1|Plus1128946..129878 NW_003534281 olfactory receptor-like protein OLF4-like LOC100521545 __SEG__ Chr2 {Sus scrofa} MELGNDTQISEFLLLGFSEDPELQPIIFGIFLSMYLITVFGNLLIILAISSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQMQSKTITYEGCITQIYFLILFAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNPRLYGLLVLMSWIINILNSLLQSLMMLRLSFCKNFEIPHFFCELNHMVQLACSDTFLNTIVMYFAAVLLGGGPFAGIIYSYSK
IVSSIRRISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAATQSAHSSSTASVMYTVITPMLNPFIYSLRNKDMKRALKAFFVKGTV*
504 >lcl|XP_003123492.1|Plus1complement(124816..125748) NW_003299529 olfactory receptor 7A17-like LOC100521715 __SEG__ Chr2 {Sus scrofa} METDNDTQILEFLLLGFSKQPESQPIIFGLFCSMYLITVFGNLLIILAVISDYHLHIPMYFFLSKLSFVDICFTSTTIPKMLWNIQTQSKAITYEGCITQIYFLILFAVL
DMLLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLVLVPWIMSVLNSLLQTLMMMQLSFCTNFEIPHFFCELNQMIQLACSDTFLNTIVMYFAAALLCGGPFFGILCSYSK
IVSSICRISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAAAHSSHSSATASVMYTVITPMLNPFIYSLRNKDMKRALKALFVKGRM*
505 >lcl|XP_003123493.1|Plus111994..12950 NW_003299529 olfactory receptor 7C2-like LOC100521890 __SEG__ Chr2 {Sus scrofa} MEIRNQTRYFLLLGFTEEPDMQPLLFGLFLSMYLTTFTGNLLIILAIISDSHLHMPMYFFLSNLSFADICFTSTTIPKMLMNIQTQSKVITYAGCLSQVFFFFVFGCLDN
LILTVMAYDRFVAICHPLYYTVIMNPQVCRMLALGSWCISVTGSLLDTLTLLRLSFCMNMNIPHFFCDLPEVLKLACSDTLINNIVVYFVVVVLAVFPLSGILFSYSQIF
SSILRISSSKGKHKAFSTCGSHLSVVSLFYGTSLGVYLSSAATSSSRTSLVASVMYTMITPMLNPFIYSLRNRDMKRALGRLLSRVASLSDGVVAGFS*
506 >lcl|XP_003123494.2|Plus1173864..174799 NW_003299529 olfactory receptor 7A10-like LOC100522064 __SEG__ Chr2 {Sus scrofa} MTGVSEFLLLGFSEKPELQPFIFGIFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLANTQTENNVITYAGCITQLYFFILFVGLDDFLL
TVMAYDRFVAICHPLHYRVIMNPQLCGLLVLASWVISVLTSLLQTLMVLKLSYNKVKIPHYFCELNQVVRLACSDTFLNDVVMYFAVGLLAGGPLAGILYSYSKIVSSIR
RITSAQGKYKAFSTCVSHLSVVSLFYCTSIGVYLSSEDTQGSHSGVIASVMYTVVTPMMNPFIYSLRNKNIHRALKAFFGTIAIKGPLAFG*
507 >lcl|XP_003123495.1|Plus196294..97226 NW_003299529 olfactory receptor 7A17-like LOC100522242 __SEG__ Chr2 {Sus scrofa} MEAENYTSISEFYLLGLSNEPALQPLILGLFLSMYLITVFGNLLIILAVSLDSHLQTPMYFFLSNLSFVDICFTTTTIPKMLQNIWTQNKVIAYEGCIIQVYFFILFATL
DMLFLTVMAYDCFVAICHPLHYTVIMKPLFCGLLVLASWIMTALNSLFQSIMVLWLSFCTDFEIPHFFCEINQVVQLACSDTSLNDKVMYFAAGVYAGASLTGILYSYSK
IVSSIRRISSVQGKYKAFSTCASHLSVVSLFYCTVLGVYLSASATHSSHSSAVASVMYTVVTPMLNPFIYNLKNKDIKRALRRITGMAAM*
508 >lcl|XP_003123498.2|Plus1complement(16242..>17084) NW_003299529 olfactory receptor 7A10-like LOC100522982 __SEG__ Chr2 {Sus scrofa} TVFGNLLIILAVSSDSPLHTPMYFFLSNLSFVDICFTSTIIPKMLVNTQTENNVITYAGCITQLYFFLLLVGLDDFLLTVMAYDRFVAICHPLHYRVIMNPQLCGLLVLL
SWIINNLHSLLQTLMVLRLSFYNKVKIPHYFCELNQVVRLACSDTFLNDVVMGFAAALLGGGPLAGILYSYSKIVSSIRRITSAQGKYKAFSTCVSHLSVVSLFYCTSIG
VYLSSEDTQGSHSGVIASVMYTVVTPMMNPFIYSLRNKNIHRALKAFFGTIAIKGPLAFG*
509 >lcl|XP_003123499.1|Plus121298..22251 NW_003299529 olfactory receptor-like protein OLF4-like LOC100523171 __SEG__ Chr2 {Sus scrofa} MNQGNDTGISEFLLMGFSDEQELQPLIFVFFLSMYLITVFGNLLIILGVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTHSKVITYEECIIQMYFFVIFAVL
DIFLLTVMAYDRFVAICHPLLYTVIMNPRLCVLLVLASWIMSLLHSFLQSLMVLRLSFCTDLQIPHFFCELNQMVQLACSDTFLNNMMMCFAAVLLGVGSLTGIIYSYSK
IVSSIYGLSSAYGRYKAFSTCASHLSIVSLFYCTSLGVYLNSAATRSSHSNAEASVMYTLVTPMLNPFIYSLRNKDIKRALKMFFGMMSIKRCLSFL*
510 >lcl|XP_003123500.1|Plus1339170..340111 NW_003299529 olfactory receptor 1I1-like LOC100523537 __SEG__ Chr2 {Sus scrofa} MEPENLTTVSEFLLLGLSEKPEHQSFLFGLFLSIYLVTVFGNLLIILAIISDSHLHTPMYFFLSNLSLIDIFFSSTTIPKMLVNLWTQCQAIPFAGCLAQMYAFHLFGTM
DSFLLAVMAIDRFMAIVHPLRYLVIMSACVCGLLVGGAWLITNLQSLVHTCLMAQLTFCAGSEIPHFFCDLMPLLKLSCSDTHTNKLAIFVFGIIMGISPLACILFSYAC
IFWAVFKIPSAQGKWKAFSTCSSHLTVVSLFYGTIFAVYLQPASPASTQKDKVAALMCGVVIPMLNPFIYSLRNKNMKEALRKLVGKVASSQS*
511 >lcl|XP_003123502.1|Plus1182175..183158 NW_003299529 olfactory receptor 7C1-like LOC100523890 __SEG__ Chr2 {Sus scrofa} MLLPLSWQTVLYIEPRNHSGLPVFLLLXLSKKPEIQSVLFXLFLSLYFVTIFGNLLIILAIISDSHLHTPMYSFLANLSFSDICFTSTTIPKMLLNIQTQSKVITYTGCI
TQMFFFTVFGLLDNLLLTVMAYDRFVAICHPLHYTVIMNPWLCAQLLLLTWLISALGALPESLTTLQLSFCAVVEIPHYFCELPEVLKLACSDTFINNVVLYVVTGVMGF
FPLAGILFSYSRIVASVLRISTAGGKYKAFSTCGSHLSVVSLFYGTCLGVYLSSTWTHASRTGAFASVLYTVVTPMMNPFIYSLRNRDMKRALRKLLYSVLSLQGEH*
512 >lcl|XP_003123507.1|Plus1165177..166121 NW_003534283 olfactory receptor 10H1-like LOC100524789 __SEG__ Chr2 {Sus scrofa} MQGANLSAVTEFILIGFSTFPHLQLTFFLLFLLMYLFTLLGNLLIMATIWRERSLHTPMYLFLCALSISEILYTFAIIPRMLADLLSTHHSIAFSACASQMFFSFTFGFT
HSFLLTVMGYDRYVAICHPLRYNVLMSPGGCACLVVWSWAGGLVMGLVVTSAIFHLTFCGPNMIHHFFCHMPPLVKLACGDISIVITGVGLVCLSALLGCCLLILLSYAF
IVAAILRIPSAEGRHKAFSTCVSHLTVVIVHYGFASIIYFKPKGPQSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKNTMKKTFLNKFFLHSC*
513 >lcl|XP_003123508.1|Plus1complement(178045..178989) NW_003534283 olfactory receptor 10H1-like LOC100524975 __SEG__ Chr2 {Sus scrofa} MQGANLSAVTEFILIGFSTFPHLQLTFFLLFLLMYLFTLLGNLLIMATIWRERSLHTPMYLFLCALSISEILYTFAIIPRMLADLLSTHHSIAFSACASQMFFSFTFGFT
HSFLLTVMGYDRYVAICHPLRYNVLMSPGGCACLVVWSWAGGLVMGLVVTSAIFHLTFCGPNEIHHFACHVPPLLKLACGTDVHVVAKGVGLVCLSALLGCCLLILLSYA
FIVAAILRIPSAEGRHKAFSTCVSHLTVVVVHYGFASVIYLKPKGPPSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKNTMNKTFSKLYPETM*
514 >lcl|XP_003123512.1|Plus1107956..108897 NW_003534283 olfactory receptor 10H4-like LOC100525684 __SEG__ Chr2 {Sus scrofa} MTDQNHSTVSEFILIGFSNFPQQLLPTFFLLYLLMYLFTLLGNLLIMTTIWREHSLHTPMYLFLCALSTSEILFTVAITPRMLVDMLSTYRSISFTACASQMFFSFTFGF
THSFLLMIMGYDRYVAICHPLRYNVLMSTRDCARLVSWSWAGGSVMGMMVTMIVFHLTFCGSNEIHHFACHVLALLKLACGNETSSVTLGVILVCVTALMGCLFLIVLSY
VFIVAAILRIPSAEGRHKTFSTCVSHLTIVIVHYGFASIIYLKPKGPRSMDSNTLMATTYTVFTPFLSPIIFSLRNKELKNAIKKNYLRKFFP*
515 >lcl|XP_003123515.1|Plus1105725..106669 NW_003534284 olfactory receptor 2Z1-like LOC100511184 __SEG__ Chr2 {Sus scrofa} MRELNQSMTSYFTLMSLFSHSGPHLVLFSLVATIFTMGLLGNAILLFLIHTDSRLHTPMYFLLSQLSLLDVGFPLVTIPKMAADFLQGEDFISFEGCAAQMFFLMLMGVS
EGVLLSLMSYDRYVAVCHPLHYPMLMRRQVCLLMVGTSWLSGVLVASIQTSITLHFPYCASRTVDHFFCELPALLKLSCTDTSAYELALSISGVLILLLPLSLIATSYSH
VLGAILRMHITEAQHKAFTTCSSHITVVGLFYGAAVFMYMVPSTYHSPQQDNVVSLFYSLITPMLNPLIYSLRNREVRVALVKILGRAGFRSKR*
516 >lcl|XP_003123527.1|Plus145479..46426 NW_003534284 olfactory receptor 1F1-like LOC100513271 __SEG__ Chr2 {Sus scrofa} MALEGANLTLFSEFLLLGLSEDPKQQQLLFILFLSMYLVMGLGNLLIILAIVTDARLHTPMYFFLASLAFVDICFTSTTIPKMLANHVSGHKGIPYASCLTQMFFFIWFA
GIDSFLLTAMAYDRYMAICHPLHYATSVTPQLCGLLVAASWAAAFGNALTHTVLLTRLSFCTHNRIPHFFCDLSPLLKLACSDTFLNNAMVYTVGALPIITPFVGILLSY
THIFAAVLRIPSTRGKQKAFSTCGSHLSVVSLFYGTLIGVYFSPTSSHTAQKDTAAAVMYTVVTPMLNPFIYSLRNSDMKGALRALISRRPILTL*
517 >lcl|XP_003123597.1|Plus1complement(590040..590969) NW_003534288 olfactory receptor 2G6-like LOC100512766 __SEG__ Chr2 {Sus scrofa} MEWTNDSTFPGFILLGFSDQPQLELVLFGVILFLYLMTLLGNATIILVSLLDSKLHNPMYFFLSHLSFLDLCFTSSIIPQLLVNLGSSDKSITYGGCVIQLYVSLALGST
ECVLLAVMSYDRYVAVCRPLHYAFVMHPQLCHILAFMAWLSGVATTLIQSTLTLQLPFCDHHQVDHFFCEVPVLIKLACVDTTFNQAELFVASVLFLLVPLSLILISYGH
IAQAVLKIKSAIGRRKAFGTCSSHLMVVIIFYGTIIFMYLQPAKSRSKDQGKFVSLFYTIVTPMLNPLIYTLRNKEVKTALKKILRKAL*
518 >lcl|XP_003123600.1|Plus1complement(230988..231899) NW_003534289 olfactory receptor 14K1-like LOC100513523 __SEG__ Chr2 {Sus scrofa} MDNYTVVMEFFLMEFSDTRELRVLHGFLFMLIYLATLIGNFLIIVLVTLDQCLHTPMYFFLKNLSFFDFCLISTIVPKSILNSFSNKSTISFLGCVLQVLLVIHFAGSEV
FILTAMSYDRYVAICHPLHYDIIMNKAVCVQMAAVSWFFGGFFGGLYSGGTFSLSFCGSKSVPQFFCDVPSLLKISCSKDHLTINISVTIGIFYGFFCLLAIAFSYVCIF
SAVLSIPSVQGRSKAFSTCLPHLIVVATFLLTGAIAYLKPVPESPSLLDLLLSVLYSVLPPTLNPIIYSLRNKEIKAALRKLL*
519 >lcl|XP_003123608.1|Plus1complement(384407..385363) NW_003534288 olfactory receptor 2B11-like LOC100515362 __SEG__ Chr2 {Sus scrofa} MRSDNQSFWGDSPQAFILLGVSDRPWLELPLFVVLLVSYVLAMLGNIAIILVSHLDPQLHSPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSRKTISYSGCTVQYAIFHW
LGCTECIVLAAMALDRYVAICEPLRYAIIMHHPLCQQLVVLAWLSGFGNSLIQVVLTVQLPFCGQQVLNNFFCEVPAMIKLSCADTAVNDTTLAVLVAFFVLVPLALILL
SYGFIARAVLKIQSSKGRHKAFGTCSSHVVVVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFIYTLRNKDVKGALRRLLARIWRLCIR*
520 >lcl|XP_003123609.1|Plus1429242..430168 NW_003534288 putative olfactory receptor 2W6-like LOC100515529 __SEG__ Chr2 {Sus scrofa} MERDNDSYQQAFILVGFSDRPELEIILFAFILVFYILTLVGNTAIILLSIVDSRLHTPMYFFLGNLSFLDLCFTTSIVPQLLWNLWGPEKTITYHGCVAQLYIYMVLGST
ECVLLAVMSYDRYVAVCRPLHYTVVMHSRLCLQLVTMAWCCGFLNSFVMCPQTMQLSRCGHHKVDHFLCEMPALIAMSCEDTTLVEAFAFILGVALLLVPLSLILISYGM
IAAAVLRIKSSEGRKKAFNTCSSHLTVVILFYGTIIYMYLQPANSYSQDQGKFLTLFYTIVTPSVNPLIYTLRNKDVKGAMRKLLGWE*
521 >lcl|XP_003123610.1|Plus1complement(476302..477249) NW_003534288 olfactory receptor 2C3-like LOC100515880 __SEG__ Chr2 {Sus scrofa} MMEISNESSPEIFVLLGFSERPSLEPILFIIVLGIYVVCILGNGIIILVSCMDVHLHTPMYFFLVNLSFLDISFTTSIVPQLLVNLWGPQKTISYGGCVVQFYISHWLGA
TECILLAVMAYDRYAAICRPLHYNVIMHPHLCLSLAFASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSFNEVEMYVASFIFVVLPLGLILVSYS
HIAWAVLKIRSADGWRKAFNTCSSHVAVVTFFYGSIIFMYLQPAKSSSHEQGKFIALFYTVITPMLNPLIYTLRNKDVKKAFRHIVENHCGFGGT*
522 >lcl|XP_003123611.1|Plus1528871..529815 NW_003534288 olfactory receptor 2G3-like LOC100516421 __SEG__ Chr2 {Sus scrofa} MEKNNESSLVGFVLLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDASLHTPMYFFLSNLSLLDLCFTTSLVPQTLVNFRGPEKTITFGGCVVQLYISLALGST
ECILLAVMALDRYVAVCKPLHYVVIMNPRLCQQLASISWLSGLANSLIHATFTLQLPFCNNHRLDHFICEVPALLKLACVDTTINELVLFVVSVLFLLIPPALILISYGF
ITQAVLRIKSVEARNKAFSTCSSHLTVVTIFYGTIIYMYLQPSNSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDVKDALKKLLSGKLFFLQM*
523 >lcl|XP_003123612.1|Plus1553233..554156 NW_003534288 olfactory receptor 1044-like LOC100516783 __SEG__ Chr2 {Sus scrofa} MTNETTVTEFILKGFSDMPELKLISTIFFLFIYLFAFLGNISVIAAVTRDSHLHIPMYFFLKNLSFLDVCYTTVIIPKAMINSLKGSEVISFWECVVQLFLFVMMCAAEC
FLLTSMAYDRCLAIHKPLLYGVIMSRKMCMELVIVAWFSGALYAIFHTINTFSLWYCGPNVIDHFFCDSSPIMRLSCSDSHTNEEVGFAVGGCIILGAFALTIISYVLII
STIAQIHCAGGRWNAFSTCSSHLTAVILFYVTGSIAYLRPTSHYSPLQGRLVSVFYSILTPSLNPVVYCLRNKDMQVALKKLFVSSK*
524 >lcl|XP_003123614.1|Plus1356054..356986 NW_003534289 olfactory receptor 14A16-like LOC100517331 __SEG__ Chr2 {Sus scrofa} MNNFTSGSTFFLMGFTDIREIQILHAVFFLLIYLAALFGNLLIITLITKDHCLHTPMYFFLKNLSFLDLCLISITVPKSIMNSLMNHNSISFFGCVSQVFFFFLLATTEV
ALLTVMSYDRYVAICLPLRYDVIMSHRSCVEMAASSWLSGGLNAILHTASTFSIPMCGSPEVHQFFCDVPQLLSLTCSFNMGELVVIGISLVFDFGCFVFIAISYIHIFS
TVLKLSSREGRSKAFSTCLPHLLVVTLFLSSGFFAYLHSLPKSPSLLDLLISVFYTVVPPTMNPLIYSLRNKDMKIALGKLRKARYFQSN*
525 >lcl|XP_003123615.2|Plus1complement(243552..>244505) NW_003534289 olfactory receptor 14A16-like LOC100517518 __SEG__ Chr2 {Sus scrofa} LLLQIRISMAKKSTNTTIVTEFLLMRFPDDQVLQGLYVTFFLLIYLAALMGNFLIITLTTTDKCLQSPMYFFLKNLSLIDICFISVTVPKAIINALTKSQTISFLGCASQ
IFLFIFLAGTEYALLIAMSYDRYVAICHPLYYEAIVNRGTCWQMVTASWSSGCIYGSVHVGGTFSAHFCGPNIVHQFFCDIPSVLTLACSGENLEYAFIIASCIFAFVCF
LFLIASYIYIFSAVLRIPSAKGRLKSFSTCMPHLIVVMLFLFSGIVTYLGSNYKSASSLNLLISVLYSMLPPSLNPLIYSLRNKDMKEALGKMVKYW*
526 >lcl|XP_003123619.1|Plus1218488..219309 NW_003534287 testis-specific serine/threonine-protein kinase 6-like LOC100518240 __SEG__ Chr2 {Sus scrofa} MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGG
QARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGL
PRRQKRGVLYPDGLELSERCKALIAELLQFSPSARPSAGQVARNGWLRAGDSG*
527 >lcl|XP_003123622.1|Plus1453911..454879 NW_003534289 olfactory receptor 6M1-like LOC100518957 __SEG__ Chr2 {Sus scrofa} MDHRNKTIVTEFILLGFQGEKKVEILLFFAFLLMYMTSLIGNTMIVLLVWGDYRLHSPMYFFVANLSFLEVAITSTVVPKMLANTFSLTKTISFVDCLTQSFFYFLLGST
EFFILAVMSFDRYVAICNPLRYTIIMNKQTCILLLLGSYVGAFLSILASSILTAPLPFCGPNVINHFFCDSAPMLKLVCADISLAELADFVSSAVLLLGSLLLTGVSYTC
IVIAILKIPSVQGRQKAFSTCVSHITVVTLYYGSSIFIYVQPKKVTVMDANKFATVLNTIVTPVLNPFIYSLRNKKVKDSLKDSLNKYVSMLTNLRSLRSQK*
528 >lcl|XP_003123624.1|Plus1509618..510574 NW_003534289 olfactory receptor 6M1-like LOC100519299 __SEG__ Chr2 {Sus scrofa} MERENWTLITEINLTGIPTTKVFGNFLFLIFLMAYLMTVLGNSLIITLIFVDDRLHLPMYFFLSNLSLSEILTTTCAIPTMLASFLLGKKNISIGGCFAQMYFYFLSGCT
EFILFAVMSYDRYVAICSPLQYPMIMTSSLCVHLVILSWVGGFLLILPSIILKARLPYCGPNVIDHFFCDSAPFLHLACADIHFIELLDFLSSLVLLISSLSLTVVSYVY
IISTILKIPSGQGQRKAFATCASHFTVVSMGYGISIFVYVRPSQKSSLHLNKILFILSSVVTPLLNPFIFSLRNETVKDALKVTLVKCQNFLKGLRSK*
529 >lcl|XP_003123627.1|Plus1952834..953799 NW_003534289 olfactory receptor 2AK2-like LOC100520010 __SEG__ Chr2 {Sus scrofa} MKTGNQTVGTDFILLGLFQYGPMDSFLFVVIAILFLVALMGNIRLILLIQLDTRLHSPMYFLLSQLSFIDMMYISTTVPKMAINFLSNNKTITFLGCKIQTFLFLVLGGT
EALLLGFMSCDRYVAICHPLRYPLLMSKKLCWFMVTCAWTSSSLNSLIHTAHIFQLHFCGYRVINHFFCEIPTLVPLVCQDTSQYEYTVLLSGIIILLLPFMAILTSYAY
VLTVVFRKSSGKGQTKAISTCSSHLTVASLFYVTTLSTYTRPHTLHSPEEDKVVAVFYTIITPLLNPFIYSLRNKEVMGAMRRLWNHVHLYRNMTVGNFTD*
530 >lcl|XP_003123628.2|Plus1911228..912184 NW_003534289 olfactory receptor 2AJ1-like LOC100520547 __SEG__ Chr2 {Sus scrofa} MGHVNHTFSNDFILLGLFSSSQTCLIFFSFIVIIFSTAVTENAIMILLIHRESRLHTPMYFLLSHLSFMDILHISNIVPKMITDFLSGNRAISFAGCGFQIFLSLTLSGG
ECLLLAAMSYDRYVAICHPLRYPILMDDYVSILMAGGSWLIATVNSIVHTVYTLHLPFCGSRAIDHFFCDVSAMLVLSCVDTTHYERGVYVSSIIFLLVPFSLIFASYVQ
ILLTVLQMKSSEAWKKSFSTCFFHMIVVIMYYGPFIFTYMRPKMYHTPGQDKFLAIFYTILTPSFNPIIYSFRNKDVLEALKNMIKSNFLHKNNRKSA*
531 >lcl|XP_003123629.1|Plus1890766..891704 NW_003534289 olfactory receptor 2T12-like LOC100520723 __SEG__ Chr2 {Sus scrofa} MENWNLTSDFILLGLFNHTGPHLFLFVMVLTTAFTSLVGNALMLLLILLDPQLHRPMYFLLSQLSLMDMMLVSTVVPKMAADYLTGRNSISPAGCGLQIFFFLTLGGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWQICLRMILGSWFLGAADGLMQAAATLTFSYCSSHEIDHFFCEAPSLVHLACADTSLFESVMYICCVLMLLVPISLILISYSLIL
TTVLQMRSNEARKKAFATCSSHLSVVGLFFGAGIFTYMKPKSYRSANHDKIVSAFYTIFTPVLNPLIYSLRNSEVKGALKKCIDQCVALNHD*
532 >lcl|XP_003123630.1|Plus1873570..874511 NW_003534289 olfactory receptor 2T33-like LOC100520892 __SEG__ Chr2 {Sus scrofa} MENANDTTGINFILLGLFNHTQTHLFLFSIVLMTFLTSLMGNIFMILLIHTDPRLHTPMYFLLSQLSLMDIMLVLTIVPKMAVNYLMNTRSISPAGCGTQIFLFLTLGGG
ECFLLAAMAYDRYVAICHPLRYPILMNQKLCLHMTAGSWVLGGVDGLMQAAATLSFPYCHSREINHFFCEAPSVVRLACADTTIFEFFMYVCCILMLLIPLSLILASYGL
ILTAVLRMQSTAARKKAFSTCSSHLAVVGLFFGTIMFIYMWPKSYHSVAHDKVVSTFYTIFTPVLNPLIYSVRNKEVKGALRKFLEKHFWWSP*
533 >lcl|XP_003123631.1|Plus1860398..861336 NW_003534289 olfactory receptor 2L3-like LOC100521072 __SEG__ Chr2 {Sus scrofa} MENYTQTSTDFILLGLFPPSKIGMFLFILIVLIFLMALFGNLSMILLIYLDTQLHTPMYFLLSQLSFIDLNYISTIVPKMASNFLFGNKSISFIGCGVQSFFFLTLAVAE
ALLLTSMAYDRYVAICFPLHYPIRISRRVCVLMIMGSWIMGSINSCAHTTYALHIPYCKSRAINHFFCDVPAMLTLACMDTWVYEYTVFVSTTLFLVLPFIIIACSYGRV
LLAVFHMNSAEGRKKAYSTCSTHLTVVTFYYAPFVYTYLRPRSHRSPTEDKALAVFYTILTPMLNPVIYSLRNKEVMEALRRVTQRIYFVKM*
534 >lcl|XP_003123632.1|Plus1309461..310399 NW_003299536 olfactory receptor 2L2-like LOC100521251 __SEG__ Chr2 {Sus scrofa} MENYNQTSIYFILLGLFPSSRIGMFLFIIIVLIFLIALFGNFSMILLIFLDNNLHTPMYFLLSQLSLMDLTYISTIVPKMAYNFLFNDKSISFIGCGIQSFFFLTLAGAE
GLLLAAMAYDRFVAICFPLHYHIRVSKRICVLMIIGSWIMGSINSFAHTAYALNIPYCQSRAINHFFCDVPAMLTLACIDTWVYESTVFVSTTIFLLVPFTCIAFSYGRI
LLVVHHMNSTEGKKKAYSTCSTHLTVITLYSAPFAYTYLRPKFLRTPTEDKVLAMLYTIFTPMLNPIIYSLRNKEVMGALRRVIQRICSVKM*
535 >lcl|XP_003123633.1|Plus1170055..170993 NW_003299536 olfactory receptor 2L3-like LOC100521433 __SEG__ Chr2 {Sus scrofa} MENYNETSTDFILLGLFPPSRIGLFLFILIVLIFLVALFGNLFMILLIFLDIHLHTPMYYLLSQLSFIDLNYISTIVPKMAYNFLFGNRSISFIGCGVQSFFFLTLGGAE
TLLLTSMSYDRYVAICFPLHYPIRISRRLCVLMIIGSWIMGSINSCAHTIYALHIPYCRSRAINHFFCDVPAMLTLACMDTWVYEYTVFVSTTLFLLLPFIVILCSYGHV
LLAVHRMQSVEGRKKAYATCSTHLTVVTFYYVPFAYTYLRPRSLRSPVEDKVLAVFYTMLTPMLNPVIYSLRNKEVMGALRRLIQRIGSVKM*
536 >lcl|XP_003123634.1|Plus1201818..202756 NW_003299536 olfactory receptor 2L3-like LOC100521607 __SEG__ Chr2 {Sus scrofa} MEKYNQTSTDFILLGLLPPERIGFFLFILIVLIFLMTLFGNLSMILLIILDTQLHTPMYFLLSQLSFMDLNYISTIVPKMAYNYLIGNKSISFIGCGVQSFFFLTLGGAE
ALILAAMAYDRYVAICFPLHYPIRISRRVCVLMIMGSWIMGSINSCAHTIYILHIPYCRSRAINHFFCDVPAMLTLACMDTWIHEYTVFVSTILFLLLPFIGIACSYGRV
LLAVYHMRSDEGKKKAYSTCSTHLTVVTFYYAPFAYTYLRPKFLRAPTEDKALAVFYTILTPILNPLIYSLRNKEVMGALRRVTQRICSVKM*
537 >lcl|XP_003123635.1|Plus1127004..127948 NW_003299536 olfactory receptor 2AJ1-like LOC100522664 __SEG__ Chr2 {Sus scrofa} MEPENHTFSSDFILLGLFSSSQKGLIFFSFIVIIFILTVTENSVMILLIHRESRLHTPMYFLLSHLSFMDILHISNIVPKMITDFLSGNKAISFAGCGFQIFLSLTLLGG
ECLLLAAMSYDRYVAICHPLRYPILMNDYVSILMAGGSWLIGTVNSIVHTVYTLHLPFCGSRAIDHFFCEVPAMLVLSCVDTTHYERGVYVSGIIFLLVPFSLIFASYVQ
ILLTVLQMKSSESRKKSFSTCFFHMIVVIMYYGPFIFTYMRPKKYHIPGQDKFLAIFYTILTPSFNPIIYSIRNKDVLEAMKNMIKSNFLHKNF*
538 >lcl|XP_003123636.1|Plus15532..6470 NW_003299537 olfactory receptor 2L5-like LOC100522854 __SEG__ Chr2 {Sus scrofa} MESYNQTSTDFILLGLFPPSSIGLFLFILIVLIFLVALFGNLSMILLISLDNHLHTPMYFLLSQLSLMDLTYISTIVPKMAYNFLFGDKSISLLGCGVQSFFFLTLAGAE
GLLLASMAYDRYVAICFPLHYSIRISRRVCVLMIMGSWMMGSINSCAHTTCILYIPYCQSRAINHFFCDVTVMLTMACIDTRIYEYTVFVSTTIFLLLPFIGIAFSYGCV
LLAVYQMHSADGKKKAYSTCSTHLTVVTLYYSPFVYTYLRPRFLRTPIEDKALAVLYTILTPMLNPIIYSLRNKEVIGALKRVIERIRSLKM*
539 >lcl|XP_003123637.1|Plus135147..36085 NW_003299537 olfactory receptor 2L2-like LOC100523049 __SEG__ Chr2 {Sus scrofa} MENYNQTSTDFILLGLFPPSRIGLFLFIIIILIFLMALFGNVSMILLILLDIHLHKPMYFLLSQLSLMDLTYICTIVPKMASNFLFGNKFISFIGCGVQSFFFLTIAGTE
GLLLASMAYDRYVAICFPLHYPIRISRKVCVSMIMGSWIMGSINSCAHTTYALHIPYCQTRAINHFFCDVPAMLTLACMDTWIYEYTVFVSTTVFLLLPFFGIACSYGHV
LLAVYRMNSAEGKKKAYSTCSTHLTVVTFYYAPFVYTYLRPRSLRSPTEDKALAVFYTILTPLLNPIIYSLRNKEVMGALRRLMHRIYSVQL*
540 >lcl|XP_003123638.1|Plus167146..68084 NW_003299537 olfactory receptor 2L2-like LOC100523232 __SEG__ Chr2 {Sus scrofa} MENYNQTSTDFILLGLFPPSRIGLFLFILVVLIFLMALFGNLSMILLIFMDIHLHKPMYFLLSQLSLIDLNYISTIVPKMAYNFLFGNKSISFIGCGVQSFFFLTLAGAE
ALLLASMAYDRYVAICFPLHYSIRISRRVCVLMITASWIMGSINSCAHTTYALHIHYCRSRAINHFFCDVPAMLTLACMDTWIYEYTVFVSTILFLLLPFIGIACSYGRV
LLAVYHMNSAEGKKKAYSTCSTHLTVVTFYYVPFVYTYLRPRDLRSPTEDKALAVFYTILTPMLNPVIYSLKNKEVMGALKRVIQRIFSVKV*
541 >lcl|XP_003123639.1|Plus1complement(88365..89303) NW_003299537 olfactory receptor 2L13-like LOC100523426 __SEG__ Chr2 {Sus scrofa} MEKWNQTSNDFILLGLFPQNQTGLLLLFFIIFIFFLASVGNSAMIYLIRSDPRLHTPMYFLLSQLSLMDLMYLSTTVPKMVFNFLSGQKGISYLGCGVQSFFFLTMACSE
GLLLASMAYDRYVAICHPLHYCIRMSKRMCVKMIMGSWILGSINSLAHTVYALHIPYCQSRAINHFFCDIPAMLSLACMDTWVYEYMVFVSTSLFLLLPFLGITASYGWV
LFAVYHMRSKDGRKKAFTTCSTHLTVVTFYYAPFVYTYLRPSNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAMMRVFGIYSSIKL*
542 >lcl|XP_003123652.1|Plus166183..67118 NW_003534290 olfactory receptor 2L3-like LOC100511681 __SEG__ Chr2 {Sus scrofa} MGGGNESATTDFILAGLFPEFKHSIVLNSIIILIYILAFMGNILLIVLIWGDSRLHTPMYILLSQLSLIDLTLTSTIVPKMASNFFTGKKTISWIGCGTQSFFFLMLGMS
ECLILTLMAYDRYVAVCNPLHYPIIMNPKFCLHMIAVCWIGGSIGSFIHTVYPMHFPICGSREIHHFFCEVPVLIKLSCEDTSVYQSVVVVTSIVLLVLPFCLIIVSYTL
IFLAVLHMNSVKGRKKTLATCSSHLTVVSLFFGPNIFIYMTFTSSHSPEQDQALSVFSNILTPLLNPLIYSLRNKEVVAALVKLKGRCGVS*
543 >lcl|XP_003123653.1|Plus1127269..128204 NW_003534290 olfactory receptor 2L3-like LOC100511864 __SEG__ Chr2 {Sus scrofa} MVGWNESSVTNFILVGLFPEFKHSIYLNSIIIFLYILAFLGNILLIVLIWGDSRLHTPMYILLSQLSLIDLTLTSTIVPKMASNFFTGKKTISWIGCGMQSFFYLMLGMS
ECLILTLMAYNRYVAVCNPLHYPIIMNPKFCLHMIAVCWIGGSIGSFIHTVYPMHFPICGSREIHHFFCEVPALIKLSCEDTSVYQSVVVVTSIVLLVLPFILIIASYTL
IFLAVLHMNSVKGRKKTLATCSSHLTVVSLFFGPNIFIYMTFTSSHSPEQDQALSVFSNILTPLLNPLIYSLRNKDVVAALTKLMGRYGVS*
544 >lcl|XP_003123749.1|Plus1complement(37039..38808) NW_003534300 ectoderm-neural cortex protein 1 ENC1 __SEG__ Chr2 {Sus scrofa} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
545 >lcl|XP_003123816.1|Plus1124792..126087 NW_003299559 probable G-protein coupled receptor 150-like LOC100516597 __SEG__ Chr2 {Sus scrofa} MEDPFSPSTSSSPAPNLSETISLSWGLNLTSEQGSPVPGPPPPPPGPPSRRVRLVFLGVILVVAVAGNATVLCRLCGGGGPWAGPKRRKMDFLLVQLALADLYACGGTAL
SQLAWELWGPRRAAGDLACRFVQLLRASGRSASAHLVALIALERQRAVRRPQGLPLPARALTALGWLLALLLALPSAFVVRGGAPSPPPAEPPSARAWPGERRCHDIFAL
LPHWHLMVYALYEAVAGFLAPVAVMGVAGSRLLCAWRQRPAQTPSSAAPRSASPGRTPTPNALPRAKVQSLKMSLVLTLLFMGCELPYFAAWLAATWSSRPVGDWEAENL
AVALRLVAVAHSALDPFVYLFFQAGDCQLRRRLRRRLAAVCCPWEGTAEDDEGALGHQALHRHRWPHPHYHHARREQPEEGYLRPPPPRPRPLPCSCESIF*
546 >lcl|XP_003124057.1|Plus1complement(91231..92130) NW_003534378 protein sprouty homolog 4 SPRY4 __SEG__ Chr2 {Sus scrofa} MEPPIPQSVALTPSSVMVQPLLDSRMAHSRLQHPLTILPIDQMKTSHVENDYIDSPGLAPATGPKRTRSGAPELAPTPARCDQDATHHWISFSGRPSSVSSSSSTSSDQR
LLDHMAPPPVADQASPRAVRIQPKVIHCKPLDLKGPAVPPELDKHFLLCEACGKCKCKECSSPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGVFYHCTNEDDEGSCA
DHPCSCSRSNCCARWSFMGALSLVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAAAGDAKASRPDKPF*
547 >lcl|XP_003124073.2|Plus1211211..213673 NW_003534376 protocadherin gamma-B3-like LOC100516850 __SEG__ Chr2 {Sus scrofa} MGNGPGLKLPAERRPMLFLFLLPLFGPALSEQIRYTIPEELARGALVGNLAKDLGLDVRDVPARNLRVSAEKKFFTVSPENGDLLVNDRIDREQICGQKSICVLEFEIVA
EKPLNFFHVTVEIQDVNDNSPTFSRNVTELEISEMALTGATFALESAQDSDVGVNSLQQYHLSPDPHFSLIQKENPDGSRYPELVVKAPLDREEKSCHHLVLTAVDGGEP
ARSCSTQIRVVVADANDNPPVFTQDLYRVRVQENLPLGSSLLRVMATDLDEGINAEITYTFINVGKAVRQLFKLDSKTGELTTGGKLDFEERESYTIGVEAKDGGHHTAH
CKIQIDILDENDNAPEITLDSESKYIQEDAELGTVVALIKTHDLDSGFNGEILCQLKGNFPFTIVQDTRNTYKLVTDGVLDREQTPEYNVTITATDRGKPPLSTSTTITL
HIADVNDNAPVFPAASYEVHVAENNPPGASIAQVSARDPDLGPNGHVSYSLVAGDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRALELTLQARDHGSPALRANVSLRV
LVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADAGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGERDAARQRLLVAVRDGGQPPLSATATL
LLVFADSLQEALPDLGDAPAPSDAQAELQLYLVVALALISVLFLVAVILAVALHVRRSSSLAVWSCFHTSFSSNTGPGVLPNYGEGTLPYSYNLCAATHSSKTEFKFLNI
KPENAPPQDLLRNEASWLERTSNGNPQMTSNSVDLPPVSYFNTLSFHKYG*
548 >lcl|XP_003124074.1|Plus1214714..217146 NW_003534376 protocadherin gamma-A6-like LOC100517026 __SEG__ Chr2 {Sus scrofa} MAILQRRPPRHHRRLVLFFMLLGMLWGARAGQIRYSISEELEKGSFVGNIAKDLGLEPRELGERGVRIVSRGRTQLFALNARSGSLVTAGRIDREELCAQSARCLVSVNI
LVEDKLNLYSVEVEILDINDNAPRFLREELEVKIIENAALSSRFPLMEVYDPDVGVNSLQGFKLSENSHFSVDMPKQADGPKYPELVLERALDREGEAIHQLVLTAMDGG
DPVRTGMARILVTVLDANDNAPVFTQPVYRVSVPEDLPVGTPVLSVNATDQDEGLHSEVTYSFVRITDKISKTFCLNVLTGEITTSANLDYEDSSFYELDVEARDRPGLQ
DRTKVFITILDVNDNVPEVVVTSGSRSVAESTPPGTVIALFQVYDRDSGPNGLVTCSISRSLPFELEKSVDNYYRLVTNTVLDREHVSMYNITVTATDEGRPPLSTEILI
SLNVADINDNSPAFPHSSYSVYIPENNPRGASIFAVTAYDPDSRENAQVTYSLAEDTIQGVPLSSYISINSDTGVLYALLSFDYEQFRDLQLRVIASDSGDPPLSSNVSL
SIFVLDQNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATV
TLTVAVADSIPDVLADLGSLEIPHHSDTSGLTLYLVVAVAVVSCVFLAFVIVLLALRLRRWHKSHMLQASGGGLGGMPASHFVGVDGVRAFLQTYSHEVSLTADSRGSHV
IFPQPNYADTLISQESCGKSEPLLIQEDICKEQDSFVQVR*
549 >lcl|XP_003124080.2|Plus1275956..278439 NW_003534376 protocadherin gamma-A10-like LOC100518298 __SEG__ Chr2 {Sus scrofa} MAAQRTRSDRSAQILLCLFLLLRWEAEARQIRYSIPEELDKGSFVGNISKDLGLEPRELGERGVRIVSRGRTQPFALNPRSGSLVTAGRIDREELCAQSRRCLVSFNILV
EDRVKLFGVEIEVIDINDNAPKFQAENLDVKINENVAPGMRFPLPEAADPDVGVNSLQSYQLSSNKHFSLAVQSRASGVKYPELVLERALDREEEAVHHLVLTALDGGDP
LRSGTVLISVTVFDANDNAPVFSLSEYRVNVLENLPVGAQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKNTGEIKLSENLDYEETSFYEIEIQAEDGGAYLAT
AKVLITVEDVNDNSPEVTITSLFSPLVEDSPLGSVIALLNVHDLDSGQNGQVTCSISGDLPFKLEKSIDSYYQLVTHKALDREQVSSYNITVTATDGGSPPLSTETHFTL
QVADINDNPPTFSHISYFTYIPENNPRGASIFSVTALDPDSEENARVIYSLVEDTIQGAPLSSYISINSDTGVLYALRSFGYEQFRDLQLQLTATDSGDPPLSSNVSLSI
FVLDQNDNAPEILYPTLPMDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPDVLADLDSLESPASPDNSGLTLYLVVAVASVSCVFLAFVIVLLALRLRRWHLSRVLQASGGGLGGVPASHFVGVDGVRAFLQTYSHEVSLTADSRGSHVIF
PQPNYADTLISQESCGKKDPLSLSDDSKFPIEDTPLVPVSSVFTPFCSFKNYDWFYF*
550 >lcl|XP_003124083.1|Plus1350858..353455 NW_003534376 LOW QUALITY PROTEIN: protocadherin gamma-C3 PCDHGC3 __SEG__ Chr2 {Sus scrofa} MVPEACRGGLVSTGRVVGVLLLLGALHKASAALIRYEILEEREKGFAVGNVVADLGLDLGSLSARRLRVVSGASRRFFEVNRETGQMFVNDRLDREELCGTLPSCTVTLE
LVVESPLELFSAEVVIQDINDNNPSFPTREMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKYAELVLERALDREREPDVQLVLTALDG
GTPARSASLPIRIIVLDANDNAPTFNQSLYRARVPEDAPPGTRVVQVRATDLDEGPNGEIIYSFGSHNRAGVRELFSLDLVTGMLTIKGRLDFEDVKLHEIYIQAKDKGA
NPEGAHCKVLVEVVDVNDNAPEITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSAALDRETVPEYNLSITARDAGAPSLSA
LTTVRVQVSDINDNPPQCPQSSYDVYVEENNLPGAPILNLSVWDPDAPQNARLSFSLLEQGAESGLVGRYFTINRDSGVVSSLVPLDYEDRREFELTAHISDGGTPVLAT
NISVNIFVTDRNDNAPQVLYPRPGQSSVEMLPRGTAAGHVVTRVVGWDPDAGHNAWLSYSLLGAPNQSLFAVGLHTGQVSTARPVQDTDSPRQTLTVLIKDNGEPSLSTT
ATLTVSVTEESPEARAEFPSGSAPREQNKNLTFYLLVALILVSVGFAVTVLGIIIFKVYKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLVPPHLYHQVYLTTDSRRS
DPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESSPPGQVRVSRSSWNDINAF*VLHHFQEGVGPFLHFQ**RFSFMMYPHFHPALPRSSFMP*
551 >lcl|XP_003124097.1|Plus160015..62471 NW_003534375 protocadherin beta-1-like LOC100521438 __SEG__ Chr2 {Sus scrofa} MAAARRKLLQSRQVGPLLLFLCFSVGGASTIRYSVAEEMESGSFVANVAKDLGLEVGKLATRGARLVSEGNKLHFRLHRKTGDLFMKEKLDRESLCGKADPCVLHFEIVL
VEPLQSFRVEVRVFDINDNAPIFLNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANEYFHLHTRFRSHGPKYAELVLDKPLDREVQPEVNLTITAVDGGSP
PKSGTAHIRVQVLDVNDHVPQFSRLVYRAQVPENSANGSLVATVTATDLDEGSNKAITYSLAQNPEVILQTFQIDPDTGEVRLRGALDFEVTETYDIDIQATDGGGLSAH
SKVLVEVVDVNDNPPEVTVSSVSSPLPEDSPLQTVVALFSVRDRDIRVGGKITCFLKEDLPFAVKPTFRNSYSLVTDRRLDREDVSGYNITLVATDTGPPTLSSETVIEV
LIADINDNPPVFQEDSYILTVRENNSPAVFIGKVHAEDLDLGENAQVTYSLLPPKSGDLSVFAYISINSDNGKLYALRTMDYEAIQDFQFVVKATDGGFVSLSSQVSVRV
VVLDDNDNRPMILYPLQNGTLPCNDLVPRSAEAGYLVTKVVAVDRDSGQNSWLSYHLLKATDAGLFSVQQQNGEIRTLRPISERDPRMQKLIILVQDHGQPALSTTASLN
ILLVDGFSEPYLQFQDPFKHPTRVNPSTKYLVISLAVLSFLFLLSVAVIFIIHICQKIKYREKFTIQEHFYDDCNFPNNLVPGGASGSISQPCPYEMCSATGTGASEFRF
LKRFMPNFPFPHGTGEVKTEAGSSLPPDSDRNRSQGPEGQARASDDYM*
552 >lcl|XP_003124098.1|Plus1148372..150729 NW_003534375 protocadherin beta-5-like LOC100521612 __SEG__ Chr2 {Sus scrofa} MEIPPAKTLQKRQVFFLVILLFWWEAGSEAIRYSMPEERESGSFVANLAKDLGLGVGQLATRGARIHYKGNKQLLQLDVKTGDLLLSEKLDREGLCGATDPCILHFQLLL
ENPVQFFQAELELTDINDHSPEFPDREMLLKIPENVQPGAVFPLKTAQDLDIGNNTVQRYAVSPNSHFHVVTHNRGDGRKFPELVLDKAVDREEQPKLSLILSALDGGAP
PRSGTTAVRIEVVDINDNAPEFLQSLYEVQIPENSPLNTLVAAVSARDLDAGTNGNVAYALFQGDEVTQPFVIDELTGEIRLQRALDFEETQRYTVEITATDGGGLSGKC
TVAIEVEDVNDNAPELTMSTLVSSTPENSPETVVAVFSVSDPDSGDNGRMVCSIQDDLPFLLKPTFKNFYTLVTERPLDREERAEYNITITVGDLGTPRRHTQHNLTVRV
ADVNDNAPAFSQPAYTLRVRENNSPALHIGTVRATDADAGANAQLTYSLLPPSDPHLPLASLVAINPDTGQLFALRALDYEALRAFDFQVRAADRGAPALSSQARVRVLV
ADAHDHAPVVLYPPPNASAPCTELLPRAAEPGYLLAKVVAVDGDAGQNAWLSYRLLQATEPGLFGVGAHSGEVRTARPLSERDAPRQRLLLLVRDHGEPPLSASVPLHVL
LVDGFSQPHLPPPEAPGRAPGAGADEPLTVALVGALACVSALLVGALLALAAGRLCRRGGAASAGGCAGPAEGGVPGQLLDVGGTGTLAHGYRYEVCLAGGSGLDEFKFL
KPILPSGLVQDIGQD*
553 >lcl|XP_003124107.1|Plus1178152..180629 NW_003534376 protocadherin gamma-A2-like LOC100523539 __SEG__ Chr2 {Sus scrofa} MAALLKLPPRSLVLLCLLVAAPWEAGAGQMRYSVPEEVEKGSFVGNIAEDLGLEPRELAERGVRIVSRGRTQLFALNARSGSLVTAGRIDREELCAQSAPCLVNFNILLE
DKLNIYSVEVEITDINDNAPRFGVEELELKISETTTPGFRIPLKSAHDADVGENTLQKYELNSNDHFSLDVRSGVDGNKYPELVLEGALDREEEAVHHLVLVALDGGDPV
KSGTSRIRVIVLDANDNAPVFTQPEYRVSVPENTPVGTRILTVTATDADEGYNAQVAYFLEKTPEEASEVFELKSSSGEITITKSLDYEDAKLHEIDIEAQDGPGLLTRT
KVIVMVLDVNDNAPEFYMTSATSSVPEDSPPGTVIALFNVHDRDSGQNAFITCSLPENLPFKLEKSVDNYHRLVTARVLDREQVSSYNITVTAKDGGNPSLSTDAHVLLQ
VADINDNPPTFLHTSYSAYIPENNPRGASIFSMTAHDPDSDDNAHVTYNVAEDTLQGAPLSSYISINSDTGVLYALRSFDYEQFRELQLWVTAQDGGSPPLSSNVSLSIF
VLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLT
VAVADSIPDVLADLGSLKPSADPNDSGLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHLSRVLQASGGGLGGVPASHFVGVDGVRAFLQTYSHEVSLTADSRGSHVIFP
QPNYADTLISQESCGKKDFLSEPQFLPEDKEETFSQVNFLRNVPVSNVAKIKKFT*
554 >lcl|XP_003124112.1|Plus1complement(136657..137910) NW_003534381 probable G-protein coupled receptor 151-like LOC100525100 __SEG__ Chr2 {Sus scrofa} MPPAALANSNSSTMNVSFAHLHFAGGYLPSDSKDWRSTVPALLVAVCLVGSVGNLCVVGVLLRGARKGKPSLIHSLILNLSLADLSLLLFSAPVRATAYSRGVWDLGWFV
CKSSDWFIHTCMAAKSLTIVAVAKVCCAHARDPAGQVSTHSCTIWSVLGAIWAVACLLPLPEWFFSTTRHHAGVEMCLVAVPAVAREFMSVFGKLYPILVFCLPSLFASF
YFWRAYGQCRKRGTKPQNLRDQMRSRQLTLMLLSVAVTSALLWLPEWVAWLWTWHLKAGGPAPPQGFIALSQLLMFSISSANPLIFLVASEEFREGREGLWKWVISKKRP
TASVSQETPAGDSQAFPDSVPASPASIPERGETGSPSSGRGKADKAEIPTLPDVEQFWHERDSAPCVQDSDPAPWEHDDQETGDRGK*
555 >lcl|XP_003124151.1|Plus110709..11650 NW_003534386 olfactory receptor 5D18-like LOC100517642 __SEG__ Chr2 {Sus scrofa} MIPSERNKSGATFTLLGFSDSPELQVPLFLIFLAIYSVTAVGNLGMMLIIQINPKLHTPMYFFLSHLSFVDFCYSSIVAPKTMVNLVVEDRTISLVGCVIQFFFFCTFVV
TESFVLAVMAYDRFVAICNPLLYTVAMSPKRCVLLVMGSYAWGVACSLILTCSVTPLSFCGFNTINHFFCEFSALLSLACSDTSLNQLLLFIFATFNEVSTLFIILLSYV
FIVVTILKMPSATGRRRAFSTCASHLTAITIFHGTILFLYCVPNSQNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKDTISKIMDTNIFSH*
556 >lcl|XP_003124152.1|Plus117897..18835 NW_003534386 olfactory receptor 5L1-like LOC100517814 __SEG__ Chr2 {Sus scrofa} MGKENCTSVTEFLLLGFSEVPELRVFLVLVFLVIYGVTVLGNLGMVGLIQVSPRLHTPMYFFLSHLSFVDLTYSTIIVPKMLANIINNDKAISFLGCVVQFYLFCLCVVT
EIILLAVMAYDRFVAICNPLLYKVTMSRNVCVELVSCCYLCGTVCSLIHLCLALKIPSYRSNVINHFFCDLPPLLSLACSDVTMNQLVIYIVATFNELITILIILTSYLF
ILVTILRMRSAEGRSRAFSTCASHLTAIIVFHGTILFIYCRPNSGNKSMATDKVATVFYTVVIPMLNPLIYSLRNKDVKESLRKVVNFKTFS*
557 >lcl|XP_003124154.1|Plus1122566..123495 NW_003534386 olfactory receptor 4P4-like LOC100518183 __SEG__ Chr2 {Sus scrofa} MEKRNNVTVFILLGLSQNKNIEILCFVLFFLCYIAIWMGNLLIMISITCSSLIDQPMYFFLYYLSLSSLCYTSTVMPKLMTDLLAERKTISYSNCMTQLFILHFLGGIEI
FILTGMAYDRYVAICKPLHYTSIMSRHRCNTVIIACCTGGFVHSASLFLLTIFLPFCGPNEIDHYFCDVYPLLKLACTNTYRIGLLVIVNSGMMGLVTFVVVMLSYFLIL
HTIRGYPARSRSKAFSTCSSHITVVVLFFVPILFIYIRPAETFPEDKVFALFYTIFAPMFNPLIYTLRNLEMKNAVRKVWYEPLLLEGK*
558 >lcl|XP_003124155.1|Plus1133199..134137 NW_003534386 olfactory receptor 4P4-like LOC100518363 __SEG__ Chr2 {Sus scrofa} MENNNNVTQFILLGLSQNKKIKNMCFLLFLWCYIAIWMGNLIIMISITCSQLNGQPMYFFLNYLALSDLCYTSAVIPKLVTDLLAESNAISYTSCMVQLFAMHFFGGIEV
FILTAMAYDRYVAICKPLHYMIIMNRQKCYAIVGACCAGAFLHSFAQCLLTITLPFCGPNEIDHYFCDVYPLLKLACTDTYSVGILVVANSGMMGLVTFVIVMLSYFLIL
HTIRGYPTESRSKALSTCSSHITVVVLFFAPVLFIYIRPATTLPEDKVFALFYTIIAPMFNPLIYTLRNMEMRNALRKMWCQKRFLTGRQII*
559 >lcl|XP_003124157.1|Plus1complement(150223..151161) NW_003534386 olfactory receptor 4P4-like LOC100518722 __SEG__ Chr2 {Sus scrofa} MEHRNNITEFILLGFSPIKEIEVLCFLLFLLCYLAILIGNLLVMISITGSPLIHQPMYFFLSYLSLSDLCYTSTVTPKLIVDLLAVEKTISYNGCMTQLFTMHFFGGIEV
FILTGMAYDRYVAICQPLHYTSIMTRQKCGAMIAASCAGGFLHSFGQFLLAIFLPYCGPNVIDHYFCDVYPLLKLACTDTRRIGLLVIANSGLMGLVTFVVLLISYAVIL
YTVRSYSVENRHKALSTCSSHITVVVLFFAPLFFIYIRPATTLPEDKVFALFYTIITPMLNPLIYTLRNTEMKNAIKKLWRHSFLPSQEERK*
560 >lcl|XP_003124160.1|Plus1184460..185407 NW_003534386 olfactory receptor 5D14-like LOC100519244 __SEG__ Chr2 {Sus scrofa} MEKANQSVGITFILLGFSEYPHLRVPLFLVFLAIYTVSVVGNVGMIAIIRINPKLHTPMYFFLSHLSFLDFCYSSAITPKLLETLVVNIGTISYMGCMMQFFFGCTFVIT
EMFMLAVMAYDRFVAVCNPLLYTVAMSPKLCIRLVASTYSWGGLCSLTLTCSLLELSFCGSNILNHFGCEYSAIISASCSDTYFILMLIFIMSIFSEACSLLIILSSYLF
IIVTVTKMPFAGGLRKAFSTCASHLTTITIFHGTLFLLYSVPSSKRSLLFIKVASVFYAVVIPMLNPLIYSLRNNDVKETIRGLINAKQLFSHST*
561 >lcl|XP_003124164.1|Plus135103..36029 NW_003534386 olfactory receptor 1020-like LOC100520296 __SEG__ Chr2 {Sus scrofa} MENSTLKIKFFLVGFSDHPELQGALFAVFLFIYSVTLMGNLGMILLITTSAPLHTPMYFFLCVLSFIDACYSSVIAPKLLADLLSDEKTISYDGCVAQLYFFCSLVDMES
FLLAAMAYDRYVAIRSPLLYSVIMSKRICCQLAFGAFLGGTVSSVIHTTNTFYLSFCSREINHFFCDISPLFSLSCSDTYIHDVVLVVFASLVEAICLLTVLLSYVCIIA
AILKTGSAQGRRKGFSTCASHLTVVTIYHGTLIFTYLRPSAGHSLDIDKVTSVFYTLIIPMLNPLIYSLRNKDVKNAFRKMMSRKLLD*
562 >lcl|XP_003124165.1|Plus1complement(41912..42850) NW_003534386 olfactory receptor-like protein OLF2-like LOC100520482 __SEG__ Chr2 {Sus scrofa} MEAENCTRFTEFTFLGLSSRQDVQQGLFVLFLLVYGITVVANLGMILLIQMDPRLHTPMYYFLSNLSFCDVCYSSSVSPKMLADFLSEQKRIPYNLCAVQMYLFGTFADV
ECLMLAVMAYDRYVAICNPLLYTMAMSRRVCTQLVAIVYIEGLVDSAIHTCCTFRLSFCNSNIIEHFFCEIPPLLALSSSDTTFNEIMLLISSCCVVGCSIITVLLSYSY
ILTTILRMNSAEGRRKAFSTCASHLTAVAVFHGTLLFMYFRPSSSYSMDTDKIASVFYTVVIPMLNPLIYSLRNKDVKDALKKTVSTKLCAG*
563 >lcl|XP_003124170.2|Plus1525275..526216 NW_003534386 olfactory receptor 8K5-like LOC100521546 __SEG__ Chr2 {Sus scrofa} MGQQNLSSLTEFILMGVTRQPELQAPLFGIFLTIYTVTVVGNLGMIILTQMDSHLHTPMYFFIKHLAFIDLGNSTVICPKMLVNFVVDPNTTSYYACATQLAFFTMFIIS
EFFILAAMACDRYVAICNPLLYKVIMSQRLCYMLVGIPYLYGTFQALMFNIKIFTLTFCGSNVINHFYCDGVPLILMLCSNAQEIELLIIFFSAFNLISSLLVILVSYLL
ILIAIFRIQSAKGRKKAFSTCGSHLTVVVVFYGSLLFMYVQPNSTHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKNAFYRVFKNQCKLYI*
564 >lcl|XP_003124171.1|Plus1complement(820664..821620) NW_003534386 olfactory receptor 1038-like LOC100521717 __SEG__ Chr2 {Sus scrofa} MAGNNTYVTEFILKGITDRPELQAPCFVVFMVIYLVTVLGNLGLITLIRIDTRLHTPMYYFLSHLAFVDLCYSSAITPKLMVNFVVEHNTIPFHACATQLGCFLTFMITE
CFLLASMAYDRYVAICSPLRYSTRMSKRVCFQLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCDDLPLLALSCSDTHMKELLIFAFAGFDMICSSSIVLTSYIFI
IAAILRIRSTQGRRKAVSTCGAHMVAVSIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNREVKGASKKALEKGCEILKILKLRK*
565 >lcl|XP_003124172.1|Plus1complement(736697..737635) NW_003534386 olfactory receptor 1030-like LOC100521891 __SEG__ Chr2 {Sus scrofa} MLKNNHTAVTEFILLGLTDRAELQPLLFVVFLVIYLITVIGNVSMILLIRSDSRLHTPMYFFLSHLAFVDLCYATNITPQMLVHFFSKRRTISFLGCFLQFHFFIALVIT
DYYLLTVMAYDRYMAICKPLLYGSKMSQSVCLALVATPYIYGFANGLAQTILMLRLSFCGPNEINHFYCADPPLLVLACSDTYVKETAMFVVAGFNLTCSLTIILISYIF
IFTAILRIRSAEGRRKAFSTCGSHLTAVTVFYGTLFCMYLRPPSEASVEQGKIVAVFYIFVSPMVNPLIYSLRNKDVKGAIRRMFQRKLFVK*
566 >lcl|XP_003124173.2|Plus1complement(719519..720451) NW_003534386 olfactory receptor 1030-like LOC100522065 __SEG__ Chr2 {Sus scrofa} MARGNFTLVTEFVLLGLTDDPDLQPILFVLFLGIYLITVGGNLGMLLLIRIDSRLHTPMYFFLASLSCLDLCYSTNVTPKMLINFLSEEKTISYTACLIQCYFFIAMVIT
EYYMLAVMAYDRYMAICNPLLYSSKMSKGVCICLIAGPYVYGFLSGLMEIMWTYRLTFCGSNVINHFYCADPPLIRLSCSDTFIKETSMFVVAGFNLSNSLLIILTSYIF
ILIAILKMRSAEGRRKAFSTCGSHLMAVTVFYGTLFCMYVRPPTDKSVEQSKVIAVFYTFVSPMLNPIIYSLRNKDVKQAFRKLIRRNVL*
567 >lcl|XP_003124175.1|Plus1688791..689723 NW_003534386 olfactory receptor 5M3-like LOC100522425 __SEG__ Chr2 {Sus scrofa} MLNFTDVTEFILLGLTTRPEWQVLFFILFLVIYIITLVGNIGMIMLIKVSPQLSSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSKTKTISYAGCLVQCFFFIALVHVEV
FILAVMAFDRYMAIGNPLLYGSKMSRIVCIRLISFPYMYGFLTSLAATLWTHGLYFCGKVEINHFYCADPPLIKIACAGTFVKEYTMIILAGINFTYSLTVVIVSYLFIL
VAILRRHSAEGRRKAFSTCGSHLTAVIVFYGTLIFMYLRRPSEESVEQGKVVAVFYTTLIPMLNPMIYSLRNKDVKEAMSKVISRTGLTK*
568 >lcl|XP_003124176.1|Plus1650417..651358 NW_003534386 olfactory receptor 8K3-like LOC100522603 __SEG__ Chr2 {Sus scrofa} MDKWNQTVLSEFILVGITDLRELQAPFFGLFLSIYAISVVGNLGMVILTKLDSRLQTPMYFFLRHLAFIDLGYSTAVGPKMLVNFVADQNTISYHWCAIQLAFFILFIIS
ELFILSAMAYDRYVAISHPLRYAVVMSQRVCWVLVAVPYLYSASLSLITTIKIFISSFCGYNVIRHFYCDSLPLLALLCSSTLEIELFIQICSVFNLGSSLLIVLVSYIL
ILKAILRMNTAQGRHKAFSTCGSHLTVVVVLYATLSFMYMQPKSSHSFDTDKMASVFYTLVIPMLNPMIYSLRNKEVKGALHRIWKNLHKHPL*
569 >lcl|XP_003124179.1|Plus1552161..553108 NW_003534386 olfactory receptor 8H3-like LOC100523172 __SEG__ Chr2 {Sus scrofa} MGRRNATHVSDFILLGLTDSEAVQRILFMLFLLIYLMTLLGNVGMILIIHLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLGNLLTSTKYISYMNCFTQMYFFVFLAAA
ECFLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFIGFMDSFVNVLCMSRLDFCDSNVIHHFFCDTSPILALSCTDVQGIEIMIFILAGSTLAVSLTITVVSYVS
ILSTILKITSTSGKQRAFSTCASHLLGVTIFYGTMIFTYLKPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVMQKTVGSRQLK*
570 >lcl|XP_003124183.1|Plus1complement(578953..579915) NW_003534386 olfactory receptor 8J3-like LOC100523893 __SEG__ Chr2 {Sus scrofa} MAPGNFTWVSEFILTGVSERPDLQLPLFFVFLVLYGLTVAGNLTIITLTRVDPRLQTPMYFFLRHLAIINLGNSTVIAPKMLTNFLGKRHTTSYYECATQLGGFLVFIVA
EVFMLAVMAYDRYVAICHPLLYMVVVSRRLCLLLVSLTYVYSFSTSVVISSSVFSVAYCSSNVINHFYCDSVPLLALSCSDTSFPETVVFISAATNLVSSIIIVVVSYFN
IVLSILRIRSSEGRKKAFSTCASHMVAVTIFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALKRFMTNSCCSLSRCEFRTL*
571 >lcl|XP_003124184.1|Plus1complement(533013..533975) NW_003534386 olfactory receptor 8J3-like LOC100524074 __SEG__ Chr2 {Sus scrofa} MAPGNFTWVSEFILTGVSERPDLQLPLFFVFLVLYGLTVAGNLTIITLTRVDPRLQTPMYFFLRHLAIINLGNSTVIAPKMLTNFLGKRHTTSYYECATQLGGFLVFIVA
EVFMLAVMAYDRYVAICHPLLYMVVVSRRLCLLLVSLTYVYSFSTSVVASSSVFSVAYCSSNVINHFYCDAVPLLALSCSDTSFPETVVFISAATNLVSSIIIVVVSYFN
IVLSILRIRSSEGRKKAFSTCASHMVAVTIFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALTRFVTNSCCSLSRCEFRTL*
572 >lcl|XP_003124187.1|Plus1596971..597933 NW_003534386 olfactory receptor 8K3-like LOC100524611 __SEG__ Chr2 {Sus scrofa} MGKHNGTVLSDFILLGITDRPELQAPLFGLFLLIYVISVVGNLGMVILTKVDARLQTPMYFFLRHLSLTDFGYSTTVGPKMLVSFVVDENKISYYFCATQLAFFIMFFIS
ELFILSAMAYDRYVAICHPLLYTVIMSPRLCRVLVVIPYIYSVILSSLTILKIFTSLFCDSNVIRHFYCSSLSLIALLCSDTQEIQLIILTFSTFNLVSSLLIVLVSYIL
ILVIILRMNSAESRNKAFSTCGSHLTVITVFYGTLFFMYVQPKSSESFDTDQVASLFYTLVIPMLNPMIYSLRNKEVKNAVCRTWNMCANVLLKIPWRIH*
573 >lcl|XP_003124189.1|Plus1785334..786281 NW_003534386 olfactory receptor 8J3-like LOC100524977 __SEG__ Chr2 {Sus scrofa} MALGNFTWVSEFILTGVSERPDLQLPLFFVFLVLYGLTVAGNLTIITLTRVDPRLQTPMYFFLRHLAIINLGNSTVIAPKMLTNFLGKRHTTSYYECATQLGGFLVFIVA
EVFMLAVMAYDRYVAICHPLLYMVVVSRRLCLLLVSLTYVYSFSTSVVASSSVFSVAYCSSNVINHFYCDIVPLLALSCSDTSFPETVVFISAATNLVSSIIIVVVSYFN
IVLSILRIRSSEGRKKAFSTCASHMVAVTIFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALKRFMTNSCGSFKPL*
574 >lcl|XP_003124191.1|Plus1806315..807283 NW_003534386 olfactory receptor 1044-like LOC100525331 __SEG__ Chr2 {Sus scrofa} MTQINCTQVTAFILVGLTDRQELKMPLFVVFLSVYLFTVVGNLGLILVIRTDPRLNTPMYFFLSNLAFVDFCYASVITPKMLGSFLYKQNIISFNACAAQLGCFLAFMTA
ECLLLASMAYDRYVAICNPLLYMVVMSPGICIQLVAAPYSYSFLVALFHTILTFRLSYCHSNIINHFYCDDMPLLRLTCSDTHSKQLWIFACAGVTFISSLLVVFVSYTY
IISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKVIINRNQAFIFMKLRRQLE*
575 >lcl|XP_003124192.1|Plus1812454..813395 NW_003534386 olfactory receptor 5AL1-like LOC100525509 __SEG__ Chr2 {Sus scrofa} MAKGNHSAITEFILLGLTDNPELEAILSCVFLLMYLVTALGNLGLIVLIQISPQLHSPMYFFLCHLAFVDFYGTSSITPNTLVNSLREIKSVSFYACATQVCCFITFSVW
EVSMLSVMAYDRYVAICHPLLYVVLMPRKLCIRMVTSSYIYGFTVGLVQAVATFRMSFCDSNVINQFYCDDVPLIALACSDTRVKELMLLFIAGFNVFCSFIIVLISYVF
IVFAILRIRSSVGRQKAFSTCASHLFSISIYYGTLSFMYLQPKSSHSLDKDKFASVVYAIVIPMLNPLIYSMRNQEVKNALKKIIEKMHSSHR*
576 >lcl|XP_003124193.2|Plus1817943..818884 NW_003534386 olfactory receptor 5AL1-like LOC100525686 __SEG__ Chr2 {Sus scrofa} MAKGNYSAVSEFILLGLTDNPELQAVFFGVFLVIYVASVTGNLGLIVLIRISPQLHTPMYFFLSHLAFVDFSFTSSVTPNTLVNFLCEVQSITFYACAVQVCCFITFVVC
EQYLLSIMAYDRYVAICNPLLYVILMPKNLCNRIIASTYVYGCIVGLVQTVATFHLSFCGSNRINHFYCDDVPLVALACSDTRVKELLLLTIAGFNTLCSLLIVIISYGF
ILFAILRIRSAEGRQKAFSTCASHLTSITIFYGTVIFMYLLPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKNALKRMIEKLSVAIK*
577 >lcl|XP_003124194.1|Plus1758730..759692 NW_003534386 olfactory receptor 8J3-like LOC100525862 __SEG__ Chr2 {Sus scrofa} MAPGNFTWVSEFILTGVSERPDLQLPLFFVFLVLYGLTVAGNLTIITLTRVDPRLQTPMYFFLRHLAIINLGNSTVIAPKMLTNFLGKRHTTSYYECATQLGGFLVFIVA
EVFMLAVMAYDRYVAICHPLLYMVVVSRRLCLLLVSLTYVYSFSTSVVISSSVFSVAYCSSNVINHFYCDSVPLLALSCSDTSFPETVVFISAATNLVSSIIIVVVSYFN
IVLSILRIRSSEGRKKAFSTCASHMVAVTIFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALKRFMTNSCCSLSRCEFRTL*
578 >lcl|XP_003124195.1|Plus1773008..773970 NW_003534386 olfactory receptor 8J3-like LOC100526041 __SEG__ Chr2 {Sus scrofa} MAPGNFTWVSEFILTGVSERPDLQLPLFFVFLVLYGLTVAGNLTIITLTRVDPRLQTPMYFFLRHLAIINLGNSTVIAPKMLTNFLGKRHTTSYYECATQLGGFLVFIVA
EVFMLAVMAYDRYVAICHPLLYMVVVSRRLCLLLVSLTYVYSFSTSVVASSSVFSVAYCSSNVINHFYCDAVPLLALSCSDTSFPETVVFISAATNLVSSIIIVVVSYFN
IVLSILRIRSSEGRKKAFSTCASHMVAVTIFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALTRFVTNSCCSLSRCEFRTL*
579 >lcl|XP_003124198.2|Plus1complement(706505..707440) NW_003534386 olfactory receptor 5M8-like LOC100511186 __SEG__ Chr2 {Sus scrofa} MRRNSTSVAEFILLGLTSRLELQVLFFVLFLGIYMVTVAGNLGMIVLIRVSVRLHTPMYFFLSHLSFVDLCFSSNVTPKMLGIFLAERKTISYPACLVQCYFFIALVHVE
IYILAVMAFDRYMAICNPLLYGSRMSKGVCTSLIVVPYVYGALTGLMETMWTYSLVFCGPNEINHVYCADPPLIKLACSDTYNKELSMFVVAGCNLSFSLLIILISYIYI
FPAILRVRSTEGRRKAFSTCGSHLTSVIIFYATLFFMYLRPPSKESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVREALTKELLRKKIFS*
580 >lcl|XP_003124199.1|Plus1complement(698414..699352) NW_003534386 olfactory receptor 1030-like LOC100511373 __SEG__ Chr2 {Sus scrofa} MLQRNYTEVTEFILLGLTSHPELRVAFFVLFLVVYLVTVIGNLGMIVLIRIDARLHTPMYFFLSSLSVLDLCFSTNVTPKMLENFLSEKKTISYAGCLVQCYVVIAVVLT
EHCMLAVMAYDRYMAICSPLLYSSKMSKRVCVRLVIIPYVYGFLLSVMETSRTYNLSFCGDNEINHFYCADPPLIKLACSDTYNKELSMYVVAGYSNVQSLLIILTSYVF
ILVAILRSRSAEGRKKAFSTCGSHLTVVTIFYGTLFCMHLRRPTEESVEQGKVVAVFYATVIPMLNPMIYGLRNKDVKEALRRAIGKQKLGK*
581 >lcl|XP_003124200.1|Plus1complement(871268..872221) NW_003534386 olfactory receptor 1020-like LOC100512095 __SEG__ Chr2 {Sus scrofa} MIRYNKEVQGKNQTEVTEFILLGLSDNSDLQVVLFGLFLLIYMTTMVGNLGMILLIKIDPCLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLVAESKAISFNGCAAQFYF
FGSFLGTECFLLAMMAYDRYAAIWNPLLYPVLMSGRICFLLVATSFLAGFGNAAIHTGMTFRLSFCGSNKINHFYCDTPPLLKLSCSDTHINGIVIMAFSSFNVISCVTI
VLISYLCILIAILKMPSLEGRHKAFSTCASHLVAVTIFFGTILFMYLRPTSSYSMEQDKIVSVFYTVVIPMLNPLIYSLKNKDVKEALKKILQKQII*
582 >lcl|XP_003124201.1|Plus1complement(883193..884134) NW_003534386 olfactory receptor 1019-like LOC100512271 __SEG__ Chr2 {Sus scrofa} MEKMDKENHSMVTEFVFMGITQDPQLQIIFFVVFLLVYLVNVVGNVGLIVLIITDTRLHTPMYLFLCNLSFVDLGYSSAIAPRMLADFLTKRKVISFSSCAAQFAFFVGF
VDAECYVLAAMAYDRFVAICRPLHYSTLMSKRVCLALMLGSYLAGLVSLVAHTSLTFSLSYCGSNIINHFFCEIPPLLALSCSDTHISEILLFSLCGFIEFSTILIIFIS
YTFILIAIIMMRSAEGRLKAFSTCGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAAFRKLIGKKPQ*
583 >lcl|XP_003124202.1|Plus1complement(905408..906352) NW_003534386 olfactory receptor 140-like LOC100512461 __SEG__ Chr2 {Sus scrofa} MDLPLPPNNVTEFVLLGLTQNPHLRKILYVVFLFIYLVTLLSNLFIVIIISLSPTLSTPMYFFLTHLSFIDASFSSITTPKITIDLLHQRTTISWGGCLTQLFLEHFLGG
SEIIVLIVMSCDRYVAICKPLHYTTIMRHGFCQLLVVVAWVGGLLHAIVQIHLVLDLPFCGPNVIDHVMCDFFSLLELACTDSYWRGIVVSANSGGMCLVFFFMLIISYM
VILNSLKSHGSEGRRKALSTCGSHFIVVVLFFVPCIFSYVRPVATYPVDKLVSLFYGSFTPILNPIIYTVRNTEVKNAVKILLKRRVTWVVHDA*
584 >lcl|XP_003124203.1|Plus1complement(896457..897398) NW_003534386 olfactory receptor 4C6-like LOC100512650 __SEG__ Chr2 {Sus scrofa} MDLLMPPNNVTEFILLGFTWNSQLWKILSMVFLFIFLFTLLASLFTVITISLSPTLLAPMFFFLTYLVVVDASFSSVTTPKITINLLYQRTTISWGGCLTQLFLEHFLGG
SEIIVLISMAYDRYVAICKPLQYTTIMRHGLCQLLVVAWISGIIHATVQIHLVLDLPFCGPNVIDHVMCDFFSLMELACTDSYWRGIVVSANSGGMCLVFFFMLIISYIV
ILCSLKSHGSEGRRKALSTCGSHFIVVVLFFVPCIFSYVRPVATYPVDKLVSLFYGSFTPILNPIIYTVRNTEVKNAVKILLKRRVTWVVHDV*
585 >lcl|XP_003124204.1|Plus1916034..916978 NW_003534386 olfactory receptor 140-like LOC100512830 __SEG__ Chr2 {Sus scrofa} MDLALPPNNVTEFVLLGLTQNPHLRKILYVVFLFIYLVTLLSNLFIVIIVSLSPTLSTPMYFFLTHLSFIDASLSSLNTPKITIDLLHQRTTISWGGCLTQLFLEHFLGG
SEIIVLIAMSCDRYVAICKPLHYTTIMRHGLCQLLVVVAWVGGLLHAIVQIHLVLDLPFCGPNVIDHFMCDFFSLMELACTDSYWRGIVVSANSGGMCLVFFFMLIISYI
VILNSLKSHGSEGRRKALSTCGSHFIVMVLFFVPCIFTYIRPVATYSGDKLVSLFYGSFTPMLNPIIYTVRNTEVKNAVKILLKRRVTWVVHDA*
586 >lcl|XP_003124209.1|Plus1complement(865901..866839) NW_003534386 olfactory receptor 1020-like LOC100513785 __SEG__ Chr2 {Sus scrofa} MNNHSSVTEFILLGFSDHPELQCLLFTVFLVIYMITVFGNLGMILIIKMDSRLHTPMYFFLSNLSLIDFCYSSVITPNMLVNFWVKNPIISFNGCATQFFFFGSFAGIEG
FLLTVMAYDRYVAICKPLLYTVTMSPYLNVLLVLATYLAGFINAAIHTGLTFQLSFCHSNVIHHFFCDTPPLLQLSCSDTRVNEVVIFAFASFNELSCLLTVLMSYLYIL
TAIVRISSAEGRRKAFSTCASHLVGVTIFFGTILFMYLRPSSSYAMDQDKVVSVFYTAVIPMLNPLIYSLRNKEVKTSLGKIFKTTSFRFCI*
587 >lcl|XP_003124210.1|Plus1932418..933332 NW_003534386 olfactory receptor 1013-like LOC100514157 __SEG__ Chr2 {Sus scrofa} MEKNNHMVTEFILVGFTTDPVVHLVLFVVFLCVYAVTMVGNTTLMVLICYDSRLHTPMYFFIGNLSFLDLWCSSVYTPKILVTYISEDKTISFAGCVAQFFSGGLWYIEC
YLLAAMAYDRYMAISKPLLYAQAMSIKLCAFLVAASYLGGFINTSIITKKSFTMNFCNDNVIDDFFCDLLPLVKLACGRKEGYQALMYFLLASNVIAPAVLILASYLFII
TTILRIRSTQGCLKAFSTCSSHLISVTLYYGSILYIYSRPQSSYSLDRDKIVSTFYTVVFPMLNPMIYSLRNKDVKEALNKLLK*
588 >lcl|XP_003124214.1|Plus1complement(850755..851702) NW_003534386 olfactory receptor 5M10-like LOC100514897 __SEG__ Chr2 {Sus scrofa} MSSPNHTVATEFILLGLTDDPGLEKILFGVFLGIYLVTLVGNLGMILLIRTNPHLQTPMYFFLSHLSFVDICYSSNVTPNMLRNFLAHQKTISYAGCFTQCLLFIALVIT
EFYILASMALDRYVAICSPLHYSTRMSKHICLSLVTVPYTCGFLHGLSQTLLTFRLSFCGSLAINHFYCADPPLIMLACSDTYVKKMAMFAVAGFTLSSSLFVILLSYLF
IIAAILRIRSAEGRHKAFSTCGSHLMTVTLFYGTLFCMYLRPPSEKSVEESKIVAVFYTFLSPMLNPLIYSLRNKHVINSMKQMFKGNLFHRSAV*
589 >lcl|XP_003124215.1|Plus1252275..253204 NW_003534220 olfactory receptor 4X2-like LOC100515076 __SEG__ Chr2 {Sus scrofa} MANTHNVTEFIFLGLSPDPKVQKVCFVIFLLLYTAIVLGNFIIVLTVMTSRSLGSPMYFFLSSLSFVEICCSSTTAPKLISDFLAERKAISLWGCMSQVFFIHFFAGTEM
FLLTVMAYDRYVAIFKPLNYATIMNGQVCAFLVGVAGAGAFVHSSTQILLIFRLPFCGPNVIDHYFCDVFPLLKLACSDTFLIGLLMVANGGTLSVVSFLVLLVSYAVIL
LHLRTQSSEGRRKALSTCGSHIAVVTLFFGPCLFIYLRPSTILPVDKVVAVFYTGITPLLNPVIYSLRNAEMKKAVKRLWIRTVKLEEK*
590 >lcl|XP_003124217.2|Plus1278789..279718 NW_003534220 olfactory receptor 4S1-like LOC100515430 __SEG__ Chr2 {Sus scrofa} MGTKSNVTEFVLFGLFQSREMQHVCFVVFSLIHVLTVLGNLLVIITINASKTLKAPMYFFLSHLSFADMCYPSATTPKMIADTFVERKTISFNGCMSQLFSAHFFGGTEI
FLLTAMAYDRYVAICRPLHYTTIMDRWKCGLLAGASWVAGFLHSILQTLLTVQLPFCGPNEIDNFFCDVHPLLKLACADTYVVGLIVVANSGMISLVSFIVLIISYVVIL
LNLRSRSSESRHKALSTCGSHIITVLLVLVPPMFMYIRPSTTLAADKLVILFNIVMPPLLNPLIYTLRNNEVKNAMRKLFRVKGSLGEK*
591 >lcl|XP_003124218.1|Plus1138964..139896 NW_003534220 olfactory receptor 4C16-like LOC100515602 __SEG__ Chr2 {Sus scrofa} MQLNNNVTEFILLGLTQDPVRKKIVFAIFLIFYLGILLGNLLILATIKTSRALGSPMYFFLFYLSLTDTCFSTSIAPRMIVDALLKKTTISFSECMFQVFTFHFFGCLEI
FILILMAVDRYVAICKPLHYTTIMSHRVCGVLMALAWVGSCVHSSAQIFLALSLPFCGPNVIDHYFCDLQPLLKLACADTYVTNLLLVSNSGAICTVSFVMLMVSYVIIL
YSLRNHSAEGRKKALSTCISHIMVVILFFGPCIFIYTRPATTFSTDKMIAVFYTIGTPLFNPLIYTLRNAEVKNAMRMLWNKKLVSDDQR*
592 >lcl|XP_003124219.1|Plus1complement(34535..35464) NW_003534220 olfactory receptor 4C46-like LOC100515773 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFVLLGLTQNPKMQKVIFVVFLIIYIISMGGNVLTMVTITTSPLLKSPMYFFLAHLSFIDACYSCVTTPKLIVDSLHEKKTSPFNECMTQIFGEHFFAGADI
IVLTSMAYDRYVAICKPLHYTTIMNWQLCWLLVGVSWVGGFLHGFIQILFIFRLPFCGPNVINHFMCDLNPLLDLACTDTHTLGLFVAANSGFICLLIFLLLIGSYTVIL
HSLRTQSFEAKQKALSTCVSHITVIVLFFVPSIFVYMRPSANLPVDKAVAVFYSMIAPMLNPLIYTLRNSEMKNAIRKFCSRKVISSDQ*
593 >lcl|XP_003124220.1|Plus1complement(10860..11789) NW_003534220 olfactory receptor 4C46-like LOC100515945 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFVLLGLTQNPQMQKVIFVVFLIVYIISMVGNILTMVTITLSPLLKCPMYYFLAHLSFIDACYSCVNTPKLIVDSFYEKNTSPFNECMTQIFGEHLFAGADV
ILLTAMAYDRYVAICKPLHYTTIMNWRLCGLLVGVSWVGGFLHATIQILFIFRLPFCGPNVIDHFMCDLNPLLDLACTDTHTLGLFVAANSGFICLLNFLLLVGSYTVIL
HSLRTQSLEARQKALSTCVSHITAVVFFFVPCIFVYLRPATTLPIDKAVAVFYTMITPMLNPLIYTLRNDQMKNAIRKLCRRKVMPGDQ*
594 >lcl|XP_003124222.1|Plus1complement(162498..163427) NW_003534219 olfactory receptor 4C46-like LOC100516317 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFVLLGLTQNPEMQKLISAVFSVIYIITMVGNVLIVITITASPSLGSPMYFFLAHLSFIDACYSSVSTPKMIIDSLHGKKTILFEECMTQIFGEHFFGGAEV
ILLTVMAYDRYVAICKPLHYMTIMNRRVCGLLLGVSWVGGCLHATIQILFISRLHFCGPNVIDHFMCDLNPLLDLACTDTHTLGLFVAANSGLICLLNFLLLLVSYVVIL
RSLKTYSLEARHKALSTCISHITVVVLFFVPCIFVYLRPAGTLSIDKAVALFYTTITLMLNPLIYTLRNAQMKNAIRKLCGRKAILGDK*
595 >lcl|XP_003124223.1|Plus1140935..141867 NW_003534219 olfactory receptor 4C16-like LOC100516486 __SEG__ Chr2 {Sus scrofa} MQLNNNVTEFLLLGLAQDPVKKKIVFVTFLIFYLGTLMGNLLIITTIRTSRALGSPMYFFLFNLSLTDTFLSTSIAPRVIADALLKNATVSFNECIVQVFSSHFFGCLEI
FILILMAVDRYVAICKPLHYTTIMSHRVCGVLMAVAWVGSCVHSSAQIFLALSLPFCGPNVIDHYFCDLQPLLKLACADTYVTNLLLVSNSGAICTVSFVMLMVSYVIIL
YSLRNHSAEGRKKALSTCISHITVVILFFGPCIFIYTRPATTFPMDKMIAVFYTVGTPLINPLIYTLRNAEVKNAMRMLWNKQFISGDKK*
596 >lcl|XP_003124224.1|Plus1123383..124315 NW_003534219 olfactory receptor 4C16-like LOC100516666 __SEG__ Chr2 {Sus scrofa} MWLNNNVTEFILLGLAQDPVRKKIVFVTFFIFYLATLIGNLLIIATVKTSRTLGSPMYFFLFHLSLSDTCFTTSIAPRMIVDALLKNATISFNECIMQVSSFHFFGCLEI
FILILMAVDRYVAICKPLRYTTIMSHGVCGVLVAVAWVGSCVHSLTQIFLALSLPFCGPNVMDHYICDLQPLLKLACADTYVTNLLLVSNSGAICTVSFVMLMVSYVFIL
YSLRNHSAEGRKKALSTCISHITVVILFFGPCIFIYTRPATTFSMDKMITVFYTIGTPLLNPLIYTLRNAEVKNAMRMLWSKKLISDDKR*
597 >lcl|XP_003124225.1|Plus1complement(42759..43691) NW_003534219 olfactory receptor 4C11-like LOC100516851 __SEG__ Chr2 {Sus scrofa} MQPNNSVTEFVLLGLTPDPMRQKIVFVIFFIFYMGTLVGNLLIIVTIRSSQTLGSPMYFFLFYLSIADTCFSTSIAPRLIVDSLSAKKIISYNGCMTQVFALHIFGCMEI
FVLILMAVDRYMAIRKPLHYPTIMRRQVCIILIVLAWIGSFIHSMAQIILALRLPFCGPNLIDHYCCDLQPLLKLACMDTYMINLLLVSNSGAICSSSFVILMISYFIIL
RSLRNHSAEGRKKALSTCTSHIIVVILFFGPCIFMYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHVRITSESKR*
598 >lcl|XP_003124226.1|Plus1754..1683 NW_003534219 olfactory receptor 4C46-like LOC100517215 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFVLLGLTQNPEMQKLISAVLFVIYIITMVGNVLIVITITASPSLGSPMYFFLAHLSFIDACYSSVSTPKMIIDSLHGKKTILFEECMTQIFGEHFFGGAEV
ILLTVMAYDRYVAICKPLHYMTIMNRRVCGLLVGVSWVGGFLHGFIQILFISRLPFCGPNIIDHFMCDLNPLLDLACTDTHTLGLFVAANSGLICLLNFLFLLVSYVVIL
CSLRTYSLEARHKALSTCISHITVVVLFFVPCIFVYLRPAGTLSIDKAVALFYTTITLMLNPLIYTLRNAQMKNAIRKLCGRKAILGDK*
599 >lcl|XP_003124227.1|Plus176347..77273 NW_003534218 olfactory receptor 4C15-like LOC100517394 __SEG__ Chr2 {Sus scrofa} MDFLTLPNNVTEFVLLGLTQNPHLRKILFMVFLSIFLFTLLANLFIVITISLSPTLSAPMYFFLTYLAFIDASFSSVTTPKMIFDLLYQRTTISWGGCLTQLFLEHFLGG
SEMIVLIAMAYDRYVAICKPLHYTTIMRHGFCQLLVVVAWVGGILHATVQIIFTCELTFCGPNVIDHFMCEFFSLLELACSNTYRLGIVVATNTGGMCLLIFSILIVSYI
VILSSLKSHGSEGRYKALSTCGSHFTVVLLFFVPSFFIYIRPVATYHADKLVCLFYATFTPMLNPIIYTVRNQEVKIAMKRLLKRRVT*
600 >lcl|XP_003124228.1|Plus1complement(122693..123622) NW_003534218 olfactory receptor 4C46-like LOC100517579 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFVLLGLTQNPEMQKLLSAVFSVIYIITMVGNVLIVVTITASPSLGSPMYFFLAHLSFIDACYSSVSTPKMIIDSLHGEKTILFEECMTQIFGEHFFGGVEI
ILLTVMAYDRYVAICKPLHYTTIMNRRVCRLLMGVSWVGGFLHATIQILFISRLPFCGPNVIDHFMCDLNPLLDLACTDTHTLGLFVAANSGLICLLNFLLLLVSYVVIL
RSLRTYSLEARHKALSTCISHITVVVLFFVPCIFVYLRPASTLSIDKAVALFYAIITPMLNPLIYTLRNAQMKNAIRKLCGWKAILGDK*
601 >lcl|XP_003124229.1|Plus1131336..132265 NW_003534218 olfactory receptor 4C12-like LOC100517754 __SEG__ Chr2 {Sus scrofa} MEKKRNVTEFILIGLTQNPQMQNVVFVVFLVVYMITLSGNLLIVVTLTTSQALNSPMYFFLTHLSLIDTIYSSSSAPKLIVDTLNKKKSISFIGCMAQVYAEHIFGATEI
ILLMVMAYDRYVAICRPLHYTTIMSHRLCIVLLGVAWTGGFLHATIQILLIVRLPFCGPNVIDHFMCDLYPLLKLVCMDTQTLGLFVVANSGFICLLNLLLLLVSYAVIL
CSLKHYSLEGRRKALSTCVSHITVVVLSFVPCIFVYLRPATTLPIDKAVAVFYTMVAPMLNPLIYTLRNAEVKNAMRKLWRKKVTSNND*
602 >lcl|XP_003124230.1|Plus1154474..155385 NW_003534218 olfactory receptor 4C12-like LOC100517934 __SEG__ Chr2 {Sus scrofa} MERTNNVSEFILLGLTQNMELQKFSFVVFLMVYLVTLAGNLVIMITISTSKALGSPMYFFLSYLSLLDSCCSSSMTPKMLADTLTVRKIISFRGCMTQVFAEHLFGAAEI
ILLTVMAYDRYVAICKPLHYMTIMSRQVCNLLIGVAWAGAFIHATIQLLFTVWLPFCGPNVIDHFMCDLNPLLKLVCMDTHTLGLFVAANSGLICLLNILCLMVSYVVIL
HSLRTYSLEGRRKALSTCASHISVVILFFVPCIFVYLRPVRTFSIDKVVAVFYTMITPMLNPLIYTLRNAEVKNAMKQLWIKR*
603 >lcl|XP_003124231.1|Plus1complement(22281..23213) NW_003534218 olfactory receptor 4C11-like LOC100518299 __SEG__ Chr2 {Sus scrofa} MWLNNNVTEFILLGLAQDPVRKKIVFVTFFIFYLATLIGNLLIIATVKTSRTLGSPMYFFLFHLSLSDTCFTTSIAPRMIVDALLKNATISFNECIVQVFSFHFFGCLEI
FILILMAVDRYVAICKPLRYTTIMSHGVCGVLVAVAWVGSCVHSLTQIFLALSLPFCGPNVMDHYICDLQPLLKLACADTYVTNLLLVSNSGAICTVSFVMLMVSYVFIL
YSLRNHSAEGRKKALSTCISHITVVILFFGPCIFIYTRPATTFSMDKMITVFYTIGTPLLNPLIYTLRNAEVKNAMRMLWRKKLISDDKR*
604 >lcl|XP_003124233.1|Plus1complement(208006..209037) NW_003534220 olfactory receptor 4S2-like LOC100518653 __SEG__ Chr2 {Sus scrofa} MENNVTEFILMGLTQNQEAQQICFFLFILFYMILMTGNFLIIMTIQRSPNLNSPMYFFLSFLSFVDICYSSVTAPKMITDFQVKVKRISLVGCMAQLFFVHLLGGTEIFI
LTVMAYDRYVAICKPLHYLTIMDWKFCSILVVSCWLGGFVHTFIQTMLTVHLPFCGPSLIDHYFCDVHPLLKLACTDTYVVGLIVVANSGMISLISFVILVGSYTVILLS
FKTRSSKGRRKALSTCASHITVVILYFVPCIFIYLRPSTTFPEDKMVALFYTIITPMLNPLIYSLRSVEVKNAMRRLWIKRLLGRNRRDPDGKFDGIGTVVPAPKNVVGN
LSVISPQSYHTNT*
605 >lcl|XP_003124234.2|Plus1169473..170408 NW_003534220 olfactory receptor 4P4-like LOC100518829 __SEG__ Chr2 {Sus scrofa} MENQRNISEFILLGPSYDQNIQTFCFVLFSFCYISLLIGNLLILICIQCSPLFNQPMYYFLTHLSSIDICYTSSVTPKLIGDLLVGRKTISYDNCMLQVFAMHFFGSIEV
FILTAMAFDRCIAICKPLHYMLIVNRTKCNLIALAAWGGGAVHSFPQLSMTLQLPFCGSNEIDHYFCDIFPLLKIACTDTYITGVLVVANSGTIAFVSFVVLFVSYVIIL
FALRNYSTEGKRKALSTCASHISVVILFFGPSVFGYLRPPISYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVLCQRLFSKESHN*
606 >lcl|XP_003124235.2|Plus1155628..156539 NW_003534220 olfactory receptor 4P4-like LOC100519014 __SEG__ Chr2 {Sus scrofa} MESQSNVSEFILVGLSSDENIQTFCFVLFSFCYIGLLIGNFLILISIKCSPLFQQPMYYFLSHLSSMDICYTSSVTPKLIGDLLVERKTISYGNCMLQVFSMHFFGMIEV
LILTVMAFDRYVAICKPLHYMSIMSWTRCNFLVLASWAGGAVHAFPQFSMIIQLPFCGPNEIDHYFCDIFPLLKVACTDTYITGVIMLVNSGMVTLTFVVLFFSYVIILF
TLRHHSAEGRRKALSTCGTHITVIVLFFGPSIFAYLRPPTTFPEDKVFALFYTIIAPMFNPLIYTLRNSEMKNTMRKAWCQTS*
607 >lcl|XP_003124236.1|Plus1145554..146477 NW_003534220 olfactory receptor 4P4-like LOC100519187 __SEG__ Chr2 {Sus scrofa} MENQNNVTEFVFMGLWGNKTIELVLFFLFLLCYLAVLMGNFFILLTITCSHLIQQPMYYFLCHLSLMDLCYTSTVVPRLIRDLAAARKNISYNNCLTQLFTAHLLAGVEI
FILVSMAFDRYVAIVKPLHYLVIMNRQRCNMLIIMAWVVGFWHAIALLLMVLKLPFCGPNQIDHYICDVKPLLKLVCRDIHVVSILVIANSGMVVVVIFLVLVASYVVIL
YNLKTHTSAGRRKALSTCSSHVTVVVLFFVPCIYTYVLPAGSENKDKEISVFYTVIAPMLNPLIYTLRNVEMKIAMRKVWSKVAHWV*
608 >lcl|XP_003124237.1|Plus1complement(125296..126225) NW_003534220 olfactory receptor 4C46-like LOC100519541 __SEG__ Chr2 {Sus scrofa} METRNDVMEFILLGLTQNSHMQKVIFVVFLLIYTVSLGGNVLTMVTITTSPLIGCPMYFFLAHLSFIDACCSCMATPKLVVDSLSEKKTSTFHGCMIQIFGEHFFGGADI
ILLTMMAYDRYVAICKPLYYATIMNRQLCGLLVGVSWLGGFLHAFIQILFIFRLPFCGPNIIDHFMCDLIPLLNLACTDTHTLWLFDAANSGFICLLIFPILVGSYGVIL
KTLSTQSLEARHKALSTCVSHITAVVIFFVPCIFEYMRPAVTSPIDKAVAVFYSMITPMLNPLIYTLRNAQLKNAIRKLFCRKAISSEI*
609 >lcl|XP_003124238.1|Plus1complement(117638..118567) NW_003534220 olfactory receptor 4C46-like LOC100519707 __SEG__ Chr2 {Sus scrofa} METKNNVTVFILLGLTQNPHMQKVIFVVFLLIYTVSLGGNVLTVVTIATSPLIRCPMYFFLAHLSFIDACYSCTATPKLVVDSLHEKKTSTFHGCMIQIFGEHFFGGADI
ILLTMMAYDRYVAICKPLYYATIMNRQLCGLLVGVSWLGGFLHAFIQILFIFRLPFCGPNVIDHFMCDLIPLLNLACTDTHTLGLFVAANSGFICLLIFLILVGSYGVIL
HTLSTQSLEARRKALSTCVSHITAVVIFFVPCIFEYMRPAVTLPFDRAVAVFCTMITPMLNPLIYTLRNAQLKNAIRKLFSRKVISSEI*
610 >lcl|XP_003124239.1|Plus1complement(104709..105380) NW_003534220 olfactory receptor 4C11-like LOC100519893 __SEG__ Chr2 {Sus scrofa} MQQNNSITEFILLGLTQDPKKQKMVFVIFFIFYVGTLGGNLLIIVTIKSSQTLGSPMCFFLFYLSLVDACFSTSIAPRLIAYSLSTKKIISYNECLTQVFALHLFGCMEI
FVLVLMAMDCYVAICKPLNYPTIMRRQVCIILIVLAWIGSFIHSMAQIILALRLPFCGSNLIDHYCCDMQPSLKLTCIDTDVMDLLVAFNSRALCASSFVILMISYIVTL
HLL*
611 >lcl|XP_003124240.1|Plus1complement(21903..22832) NW_003534220 olfactory receptor 4C46-like LOC100520069 __SEG__ Chr2 {Sus scrofa} METRNNVTEFILLGLTQNPQMQKVIFIVFLIVYMVSMVGNVLTVVTITLSPLLKSPMYYFLAHLSFIDACYSCVNTPKLIVDSLYEKKTSLFNACMTQIFGEHFFGGADV
ILLTVMAYDRYVAICKPLYYATIMNRQLCGLLVGVVWVGGFLHGFIQILFIFRLPFCGPNVIDHFMCDLNPLLDLACTDTHTLGLFVAANSGFICLLNFLLLMGSYVVIL
NSLRTQSLEARQKALSTCVSHITAVILFFVPCIFVYMRPAATLPIDKAVAVFYTMITPMLNPLIYTLRNAQMKNAIRKLCSRKLISGEI*
612 >lcl|XP_003124241.1|Plus147796..48734 NW_003534220 olfactory receptor 4P4-like LOC100520237 __SEG__ Chr2 {Sus scrofa} MESRRNISEFIFLGLSYDQNIQIFCFIFFFFCYLALLVGNLLILVSIQCSPLCSQPMYYFLSHLSFIDICYTSSVTPKLIGDLLAERKTISYGNCMLQVLIMHFFGGTEI
FILTAMAFDRYIAICKSLHYVMIMNRTRCNLLLLAAWAGGAVHALPQFFTAIRLPFCGPNELDHYFCDIFPLLKIACTDTYITGILVIAFAGMIALVTFAVLSVSYGIIL
FSLKNHSAEGRQKALSTCGSHITVVILFFVPVIFIYLRPPTTFPEDKIFALFYTIIAPMFNPLIYTLRNTEMKTTLKKLVSNVIFKGSAQLL*
613 >lcl|XP_003124242.1|Plus1complement(55388..56317) NW_003534220 olfactory receptor 4C46-like LOC100520424 __SEG__ Chr2 {Sus scrofa} METRNNVTEFILLGLTQNPHMQKVIFVVFLLIYAVSLGGNVLTIVTITTSPLIGCPMYYFLAHLSFIDACYSCVDTPKLVVDSLYEKKTSTFHGCMMQIFGEHFFAGADI
ILLTVMAYDRYVAICKPLYYATIMNRRLCGLLVGVSWLGGFLHGFIQILFIFRLPFCGPNVIDHFMCDLIPLLHLACTDTHTLGLVVAANSGFICLLIFLLLVGSYGVIL
NSLRKQCLEARRKALSTCVSHITAVVIFFVPCIFEYMRPAVTLPIDKAVAVFYTMITPMLNPLIYTLRNAQLKNAIRKLFSRKVISSEI*
614 >lcl|XP_003124243.1|Plus1complement(63784..64713) NW_003534220 olfactory receptor 4C46-like LOC100520607 __SEG__ Chr2 {Sus scrofa} METRNNATEYILLGLTQNPHMQKVIFVVCLLIYTVSLGGNVLTIVTITTSPLIGCPMYFFLAHLSFIDACYSCVDTPKLVVDSLYEKKTSTFHGCMMQIFGEHFFAGADI
ILLTVMAYDRYVAICKPLYYATIMNRWLCGLLVGVSWLGGFLHGFIQILFIFRLPFCGPNVIDHFMCDLISFLKLACTDTHTLVLIVAANSGSLCMLKFLLLVGSYVLIL
HTLRTQSLEARRKALSTCVSHITAVVIFFVPCIFEYMRPAVTIPIDKAVAEFYTMITPMLNPLICTLRNAQLKNAIRKLFSGKALTGEI*
615 >lcl|XP_003124244.1|Plus1complement(81972..82910) NW_003534220 olfactory receptor 4C46-like LOC100520951 __SEG__ Chr2 {Sus scrofa} MNHRETRNNVTEFILLGLTQNSHMQKVIFVVFLLIYAVSLGGNVLTIVTITTSPLIGCPMYYFLAHLSFIDACCSCVDTPKLVVDSLYEKKTSTFHGCMMQIFGEHFFGG
ADIILLTAMAYDRYVAICKPLYYATIMNRQLCGLLVGVSWLGGFLHGFIQILFIFRLPFCGPNVIDHFMCDLIPLLKLACTDTHTLGLFVAANSGFICLLNFLLLLGSYG
VILHTLRTQSLEARRKALSTCVSHITAVVIFFVPCIFVYMRPAVTLPFDKAVAVFYSMITPMLNPLIYTLRNAQLKNAVRKLFHRNAISGEI*
616 >lcl|XP_003124248.1|Plus1complement(56280..57212) NW_003534219 olfactory receptor 4C11-like LOC100522184 __SEG__ Chr2 {Sus scrofa} MQPNASISEFILLGLTQDPKKQKMVFVIFFVFYVGTLVGNLLIIVTIRSSQTLGSPMYFFLFYLSIADTCFSTTTAPRLIVDSLSEKKIISYNECLTQIFALHLFGCMEI
FVLVLMAIDRYVAICKPLHYPTIMRRQVCIILIVLAWIGSLIHSTAQIILALRLSFCGSNLIDHYCCDMQPLLKLSCIDIYVMNLLVVFNSGAICTSSFVILMISYIVIL
DSLRNHSAEGRKKALSTCTSHIIVVVLFFGPCIFMYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLCHVRITSESKR*
617 >lcl|XP_003124249.1|Plus1213288..214226 NW_003534218 olfactory receptor 140-like LOC100522543 __SEG__ Chr2 {Sus scrofa} MDLPTSPNNVTEFVLLGFTQNPHLQKILFTVFLFIFLVTLLANLFIVIIISLSPTLSTPMYFFLTYLAVIDASFSSVTTPKIDLLYQRTTISWGGCMTQLFLEHFLGGSE
IIVLIAMAYDRYVAICKPLHYTTIMRHGLCQLLVVVAWISGILHATVQIHFVLDLPFCGPKVIDHFMCEFFSLLELACTDTYWRGIVISVNTGGMCLLFFFLLIISYMVI
LNSLKSHASEGRRKALSTCGSHFTVMVLFFVPCIFIYIRPVATYPVDKLVSLFYGTFTPLLNPIIYIVRNTEVKNAMKCLLKRRVTWVLPNA*
618 >lcl|XP_003124250.1|Plus140041..40979 NW_003534218 olfactory receptor 140-like LOC100522729 __SEG__ Chr2 {Sus scrofa} MDLPTSPNNVTEFVLLGFTQNPHLRKILFMVFLFIFLVTLLANLFIVITISLSPTLSTPMYFFLTYLAVIDASFSSVTTPKIDLLYQRTTISWGGCMTQLFLEHFLGGSE
TIVLIAMAYDRYVAICKPLHYTTIMRHGLCQLLVVVAWISGILHATVQIHFVLDLPFCGPKVIDHFMCEFFSLLELACTDTYWRGIVISVNTGGMCLLIFFMLLISYMVI
LRSLKSHGSEGRRKALSTCGSHFTVVVLCFVPCIFIYIRPVATYPVDKLVSLFYGTFTPFLNPIIYTVRNTEVKNAMRSLLKRRVTWVVHDA*
619 >lcl|XP_003124251.1|Plus154145..55089 NW_003534218 olfactory receptor 140-like LOC100522923 __SEG__ Chr2 {Sus scrofa} MDLPLPPNNVTEFVLLGFTQNPHLRKILFMVFLFIFLFTLLSNLFIIITISLSPTLSTPMYFFLANLAVIDAAFSSVTTPKITIDLLYQRTTISWSGCMTQLFLEHILGG
SEIIILIAMSYDRYVAICKPLHYTTIMQHGLCRLLVVMAWIGGILHGIVQIHFVLDLPFCGPNVIDHFMCEFFSLFELACTDTYWRGIVVSANSGGMCLLFFFMLLISYM
VILRSLKSHGSEGRRKALSTCGSHFTVVVLFFVPCEFIYIRPVATYPVDKLVSLFYGTFTPLLNPIIYTVRNTEVKNAMKCLLKRRVTWVVHDA*
620 >lcl|XP_003124252.1|Plus169101..70045 NW_003534218 olfactory receptor 140-like LOC100523117 __SEG__ Chr2 {Sus scrofa} MDLLMPPNNVTEFILLGFTQNPHLRKILSMVFLFMFLFTLLANLFIVITISLSPTLLAPMYFFLTYLAVIDAAFSSVTTPKITIDLLYQRTTISWGGCMTQLFLEHFMGG
SEIIVLIAMAYDRYVAICKPLHYTTIMRHGVCQLLVMVAWVGGILHGIVQIHFVLDLPFCGPNVINHFMCDFFALFELACSDTYWRGMVVSANSGGICLLIFFMLLISYI
VILTSLKSHGSEGRRKALSTCGSHFTVVVFFFIPCIFTYVRPVATYPVDKLVSLFCGTFTPMLNPIIYTVRNTEVKNAMKCLLKRRVTWFVHDV*
621 >lcl|XP_003124253.1|Plus193077..94021 NW_003534218 olfactory receptor 140-like LOC100523306 __SEG__ Chr2 {Sus scrofa} MDLHMPPNNVTEFVLLGFTQNPHLQKMLFMVFLFIFLFTLMANLFIVITISLSPTLSAPMYFFLTHLSFIDASFTSVTTPKITIDLLYQRTTISWGGCITQLFLEHFLGG
SEIIVLIAMAYDRYVAICKPLHYTTIMRHGLCQLLIGVAWIGGIIHATVQILFVLDLPFCGLNVIDNFMCDFFSLLELACSDTYWRGIVISANTGGMCLLIFFMLLISYI
VILSSLKSHGSEGRYKALSTCGSHFTVVVLFFFPCIFTHVRPVATYPVDKLVTLFYATFTPMLNPIIYTVRNTEVKIAMKTLLKRRVSETAHDS*
622 >lcl|XP_003124254.2|Plus1103511..104443 NW_003534218 olfactory receptor 4C15-like LOC100523488 __SEG__ Chr2 {Sus scrofa} MSPNNVTEFVLLGLTQNPHLQKILFMVFLFIFLVTLLANLFIVITISLSPTLSAPMYFFLTHLSFIDASFSSVTTPKITIDLLYQRTTISWGGCMTQLFLEHFLGGSETI
VLIAMAYDRYVAICKPLHYTTIMRHGLCQLLVVVAWIGGILHSTVQIFFTHELTFCGPNVIDHFMCDFFSLLELACSDTYWRGIVISANTGGMCLLIFFMLLTSYIVILS
SLKSHGSEGRYKALSTCGSHFTVVVLFFVPCIFTHVRPVATYPVDKLVTLFYATFTPMLNPIIYTVRNTEVKIAMKTLLKRRVSETVHGS*
623 >lcl|XP_003124255.1|Plus1complement(146035..146973) NW_003534218 olfactory receptor 4C46-like LOC100523664 __SEG__ Chr2 {Sus scrofa} MKYIKNMNNVTEFVLLGLTQNPKMQKIIFAVFFVIYIITVVGNVLIVVTITASPSLGSPMYFFLAYLSFIDACYSSVSTPKMIIDSLRGKKTILFDECMTQIFGEHFFGG
AEVILLTVMAYDRYVAICKPLHYTTIMNWRVCGLLLGVSWVGGFLHGTIQILFIFRLPFCGPNVIDHFMCDLNPLLDLACTDTHTLGLFVAANSGFICLLNFLLLLVSYV
VILCSLRTYSLEARRKALSTCVSHITVVVLYFVPCIFVYTRPAATLPIDKAVAVFYTMITPMLNPLIYTLRNAQMETAIRKLWNRKAISGDR*
624 >lcl|XP_003124256.2|Plus1176019..176951 NW_003534218 olfactory receptor 4C46-like LOC100524015 __SEG__ Chr2 {Sus scrofa} MPPNNVTEFVLLGFTQNPHLRKILFVVFLFIFLFTLLANLSIVITISLSPTLSAPMYFFLTYLAFMDAAFSSVTTPKITIDLFYQRTTISWGGCMTQLFLEHFLGGSEII
VLIAMAYDRYVAICKPLHYTTIMRHGLCQLLVVVAWVGGILHATVQILFVFDLPFCGPKVIDHFMCEFFSLLQIACSDNYWRAIVISANSGGICLLIFFMLLISYMVILR
SLKSHGSEGRRKALSTCGSHFTVVVLFFVPCIFVYVRPLATYPVDKLVSLFYGTFTPMLNPIIYTVRNMEVKNAMKCLLKRRVTWVVPDA*
625 >lcl|XP_003124257.2|Plus1188934..189866 NW_003534218 olfactory receptor 140-like LOC100524192 __SEG__ Chr2 {Sus scrofa} MPPNNVTEFVLLGFTQNPHLRKIFFIVFLFIFLFTLLSNMFIVIIISLSPTLSAPMYFFLTYLAFIDTSLSSVTTPKITIDLLYQRTTVSWGGCLTQLFLEHFLGGSEII
VLIAMAYDRYVAICKPLHYTTIMRHGLCQLLVVVAWIGGILHGTVQILFVLDLPFCGPNIINHFMCDFFSLFELACSDTYWRAIVISANSGGMCLLIFFMLLISYMVILS
SLKSHGSEGRRKALSTCGSHFTVVVLFFVPCIFIYVRPVATYPVDKLVSLFYGTFTPMLNPIIYTVRNTEVKNAMKGLLKRRVTWVVPGA*
626 >lcl|XP_003124258.1|Plus1202138..203064 NW_003534218 olfactory receptor 4C15-like LOC100524365 __SEG__ Chr2 {Sus scrofa} MDLPTSPNNVTEFVLLGFTQNPHLQKILFTVFLFIFLVTLLANLFIVIIISLSPTLSTPMYFFLTYLAVIDASFSSVTTPKITIDLLYQRTTISWGGCMTQLFLEHFLGG
SETIVLIAMAYDRYVAICKPLHYTTIMRHGLCQLLIGVAWISGILHATVQIHFVLDLPFCGPKVIDHFMCEFFSLLELACTDTYWRGIVISVNTGGMCLLFFFLLIISYM
VILNSLKSHGSEGRCKALSTCGSHFTVMVLFFVPCIYIYIRPMATYPMDKLVSLFYGTFTPMLNPIIYTVRNTEVKNAMKCLLKRRVI*
627 >lcl|XP_003124259.1|Plus1complement(255486..256421) NW_003299635 olfactory receptor 2Y1-like LOC100524734 __SEG__ Chr2 {Sus scrofa} MGNFNTSFGEGLILVGFSDWPQLEPILFVFISIFYSLTLFGNATIITLSLLQPQLHTPIYYFLSHLSFLDLCYTTSTMPQLLINLYGPDQTITYGGYVAQLFISLALGST
LSVLLVVMAFDCYTAVCHPIHYTTIMQSHLCHILVIASWVGGFMNSLIHTGLMMAMPLCGLHLLNHFFCEMPVLLKLACENREGTEAKMYVARAIILIVPTALILGSYLY
VVQVVLNVKSTAGRRKAFGTCGSHLLVVSLFYSSAMYTYLQPMHSYSETDGKFAALFYTIITPMLNTLIYTLRNKDVKVALMKVLWTRYSG*
628 >lcl|XP_003124261.1|Plus1172325..173254 NW_003299638 olfactory receptor 4C46-like LOC100526160 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFILLGLTQNPKTQKIIFVVFLIIDIISMVGNVLTLVIMTASPLLESPMYFFLAHLSFIDACYSCVNAPKLIVDSVYEKKTSPFNQCMTQVFGEHLFGGADI
ILLTVMAYDRYVAICKPLHYTNIMNWHVCWLLVGVVSVGGFIHSTIQILLIFRLPFCGPNVIDHFMCDLNPLLNLACTDTHTLGLFVDLNSGFLCLVNFVFLIGSYVLIL
LSLRTHSLEARYKALSTCVSHIIVVILFFVPCIFVYLRPAANLPIDKAVTVFYTMITPMLNPLIYTLRNAQMKNAIKNLCSQKAISGDN*
629 >lcl|XP_003124263.1|Plus1complement(7598..8509) NW_003299640 olfactory receptor 14C36-like LOC100514097 __SEG__ Chr2 {Sus scrofa} MSNSTMVTEFLLISFADTWKIRVLYSMLFLFIYLATLLGNLLIVTVTTFDQKLNTPLYFFLRNLSILDVCYITVTVPNACVYFLTGNRTISLAACATQVFLVIYFAYVEI
LFLTVMAQDRYMAICQPLHYTIIMNNKVCIQMTLVSLLSGLVYSGVHTGKTFQLTFCRSNVIHQFFCDVPSLLRISCSDTSSNFTLLLVSIIVVGGICFIFITVSYINIF
RTMLKFSIKEQGKAFSTCVPHIFVLTVFLSSIISVYLRPSVTSETINDMILSAFYTMVPPFLNPIIYSLRNTQIKEAVRRVIF*
630 >lcl|XP_003124264.1|Plus1108710..109642 NW_003299640 olfactory receptor 2M3-like LOC100514452 __SEG__ Chr2 {Sus scrofa} MALENQTFNSDFILLGIFDHSPTHIFLFSLVLGIFTMAFVGNTIMILLIYLDTQLHTPMYFLLSQLSLMDLMLICTTVPKMAYNYLSGSTSISFAGCATQIFFYTSLLGC
ECFLLAVMAYDRYSAICHPLRYTNLMSPKICGLMVASSWVLGSTDGVIDVAATFSFSYCGSREIAHFFCDFPFLLIISCNDTSIFEEVLFYCCIIMIVFPVAVVLVSYAR
VILAVIRMGSRKGCHKAFATCSSHLMVVGMYYGAGLFIYMRPTSNRSPTQDKMVSVFYTILTPMLNPLIYSLQNKEVARAFMKVLGKGKN*
631 >lcl|XP_003124266.1|Plus1275688..276635 NW_003299641 olfactory receptor 2M3-like LOC100515195 __SEG__ Chr2 {Sus scrofa} MAWENQSFNSEFILLGIFDHSPTHIFLFCLVLGIFTVAFMGNTVMVLLIYLDTQLHIPMYLFLSQLSLMDLMLICTTVPKMAFNYLSGRKSISLAGCGTQIFLYVSLLGS
ECFLLAAMAYDRYIAICHPLRYSVLMSQKICCLMAVPSWIIGLLDGVIVIAVALSFPYCGAREIPHFFCDVPALLTLSCTNTLLFERLMFICCVIMLLFPVAVIIASYTH
VILAVIRMRSGEGRSRAFATCSSHLMVVGMYYGAAMFIYMRPVSDRSPTEDRMVSAFYTILTPMLNPLIYSLRTREVXRAFIKVLRKGKSGEKIA*
632 >lcl|XP_003124267.1|Plus1complement(210401..211363) NW_003299642 olfactory receptor 2T29-like LOC100515886 __SEG__ Chr2 {Sus scrofa} MDNSTSMANHTGQMYFILVGFFLQSKHPAILCAVIFVIFLMALSGNSILILLIHSTAHLHTPMYFFISQLSLMDVMYISVTVPKMLMDQVMGMNKISAPECGMQMFLYLT
LGGSEFFLLAAMAYDHYVAICHPLHYSILMNHKVCLLLVSGCWFLGSVDGFMLTPVTMTFPFCRSREIHHFFCEAPVVMKLSCSDTSLYETLMYICCVLMILIPVTVISS
SYSFILLTIHRMNSAEGRKKAFTTCSSHMTIVILFYGAAVYTYMLPSSYHTPEKDMVVSVFYTILTPVLNPLIYSLRNKDVTVALRKMLNGEDVFQKTVK*
633 >lcl|XP_003124268.1|Plus1complement(251250..252203) NW_003299642 olfactory receptor 2T29-like LOC100516070 __SEG__ Chr2 {Sus scrofa} MDNSTSVANHTGQMDFILVGFFLQSKHPALLCAVIFVIFLMALSGNSILILLIHSTSHLHTPMYFFISQLSLMDVMYISVTVPKMLMDQVVGMNKISAPECGMQMFLYLT
LGGSEFFLLAAMAYDRYVAICHPLHYSILMNHKVCLLLVSGCWFLGSVDGFMLTPITMTFPFCRSREIHHFFCEVPAVMKLSCSDTSLYETLMYICCVLMLLIPVMIISS
SYYFILLTIHRMNSAEGQKKAFTTCSSHMTVVILFYGAAIYTYMLPSSYHTPEKDMVVSVFYTILTPLINPLIYSLRNKDVTGALSKMFNVESPRKL*
634 >lcl|XP_003124270.1|Plus1313166..314146 NW_003299642 olfactory receptor 2T3-like LOC100516426 __SEG__ Chr2 {Sus scrofa} MYSLYQNSQNQTSNADFILVGLFGETRHSILLYTVVFIFFLMALAGNTLLLILIHVEPRLHTPMYFFISQLSLMDLLYISVTVPKMLMSQVTGDHKISPSGCGIQMFFYL
TLAGAEFFLLSAMAYDRYAAICRPLHYPLLMNLRVCVCLVSGCWFLGMIDGLLLTPITMSFPFCHSRKILSFFCEAPALLKLSCSDISLYKMLMYLCCVLMLLLPIMIIS
SSYTLILWLIHRMSSSESRRKAFATCSSHMIVVLLFFGAAIYTYMLPGSYHTAEQDMRVSTFYTIITPVLNPLIYSFRNKDVTEALKSRMPSGLCFRKAVKGKTQE*
635 >lcl|XP_003124372.2|Plus173910..74872 NW_003534399 olfactory receptor 2AE1-like LOC100523238 __SEG__ Chr3 {Sus scrofa} MRQRNQTSSLADFILEGLFDDSLAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAANYISGTKSISFVGCATQDFLFLSLGG
AECILLTFMSYDRYVAICHPLRYAVLMNRMVGQMMAVMSWFGAAVNALIHTVILMHFPFCGPRNIHHFYCEFPAVVQLVCGDITVYESTVYISSILLLLLPIVLISASYI
FILRSVIHMRSAGSKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFYNFVTPTLNPLIYTLRNKDVAKALRRVLGREMITQNPKLRLP*
636 >lcl|XP_003124373.2|Plus156251..57213 NW_003534399 olfactory receptor 2AE1-like LOC100523431 __SEG__ Chr3 {Sus scrofa} MGQRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAINYISGTKSISFVGCATQDFLFLSLGC
AECILLTFMSYDRYVAICHPLRYAVLMDRKVGQMMAVMSWLGASVNSLIHTVILMHFPFCGHRNIHHFYCELPAVVQLVCGDITVYEIAVYIGDIVLLLLPIVLISASYI
FILHNVIHMHAAGGKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFYNFVTPTLNPLIYTLRNKDIAKALKRVLGREMITQNPKVRLP*
637 >lcl|XP_003124374.1|Plus196914..97894 NW_003534399 olfactory receptor 2AE1-like LOC100523597 __SEG__ Chr3 {Sus scrofa} MGQRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYILLSQLSLMDLMHVSTTIPKMAINYLSGTKSISFVGCATQYFLFLSLGC
AECILLTFMSYDRYVAICHPLRYAVLMNRKVGQMMAVMSWLGASVNSLIHTVILMHFPFCGPRNIHHFYCELPAVVQLVCGDITVYEIAVYIGDIVLLLLPIVLISASYV
FILHSVIRMHSAGGKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQHTPLQDKVGSVFYSIVTPTLNPLIYTLRNKDIAKALKRVLGREMITQNPKVQLPECASNG*
638 >lcl|XP_003124375.2|Plus1complement(3146..4108) NW_003534399 olfactory receptor 2AE1-like LOC100523780 __SEG__ Chr3 {Sus scrofa} MRQRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAINYLSGTKSISFVGCATQHFLFLSLGC
AECILLTFMSYDRYVAICHPLRYAVLMNRKVGQMMAVMSWLGAAVNSLIHTAILMHFPFCGHRNIHHFYCEFPAVVQLVCGDITVYESTVYISSILLLLLPIVLISASYI
FILHNVIHMHAAGGKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFYSIVTPTLNPLIYTLRNKDVANALRRVLGREMITQNPKVRLP*
639 >lcl|XP_003124377.1|Plus1219222..220184 NW_003534399 olfactory receptor 2AE1-like LOC100524140 __SEG__ Chr3 {Sus scrofa} MGQRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAANYLSGTKSISFVGCATQYFLFLSLGC
AECILLTFMSYDRYVAICHPLRYAVLMNRKVGQMMAVMSWLGASVNSLIHTVILMHFPFCGHRNIHHFYCEFPAVVQLVCGDITVYEIAVYIGDIVLLLLPIALISASYV
FILHSVIRMHSAGGKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFYTIITPTLNPLIYTLRNKDIAKALKRVLGREMITQNPKVWLP*
640 >lcl|XP_003124378.1|Plus1237194..238156 NW_003534399 olfactory receptor 2AE1-like LOC100524490 __SEG__ Chr3 {Sus scrofa} MRQRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAINYLSGTKSISFVGCATQHFLFLSLGG
AECLLLTFMSYDRYVAICHPLRYAVLMNRKVGQMMAVMSWLGASVNSLIHTAILMHFPFCGHRNIHHFYCEFPAVVQLVCGDITVYESTVYISSILLLLLPIVLISASYI
FILRSVICMRSAGGKRNAFATCSSHLTVVSFWFGACIFSYMRPRSQRTPLQDKVGSVFYSIVTPTLNPLIYTLRNKDVANALRRVLGREMITQNPKVRLP*
641 >lcl|XP_003124379.1|Plus1275632..276594 NW_003534399 olfactory receptor 2AE1-like LOC100524855 __SEG__ Chr3 {Sus scrofa} MGRRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAINYLSGTKSISFVGCATQYFLFLSLGC
AECILLTFMSYDRYVAICHPLRYTVLMNRKVGQMMAVTSWLGASVNSLIHTVILMHFPFCGHRNIHHFYCEFPAVVQLVCGDITVYETAVYISDIVLLLLPIILISASYI
FILHSVIRMHSAGSKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFYTIITPTLNPLIYTLRNKDIAKALRRVLGREMITQNPKVRLP*
642 >lcl|XP_003124382.2|Plus1complement(129234..130193) NW_003534399 olfactory receptor 2AE1-like LOC100525567 __SEG__ Chr3 {Sus scrofa} MWQRNQTSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYVLLSQLSLMDLMHVSTTIPKMAINYLSGTKSISFVGCATQHFLYLSLGCA
ECILLTFMSYDRYVAICHPLRYAVLMNRKVGQMMAVMSWLGASVNSLIHTEILMHFPFCGHRNIHHFYCEFPAVLKLVCGDITVYESTVYISSILLLLLPIVLISASYVF
ILHSVIHMRSAGGKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFNSIVTPTLNPLIYTLRNKDVAKALRKVLGREMITQNPQERLS*
643 >lcl|XP_003124383.2|Plus1complement(20790..21752) NW_003534399 olfactory receptor 2AE1-like LOC100525740 __SEG__ Chr3 {Sus scrofa} MGQRNQTSSLADFILEGLFDDSPAHAFLFSLTMVVFLIAVSGNTLTILLICADPRLHTPMYILLSQLSLMDLMHVSTTIPKMAINYLSGTKSISFVGCATQYFLFLSLGC
AECILLTFMSYDRYVAICHPLRYAVLMDRKVGQMMAVMSWLGASVNSLIHTVILMHFPFCGHRNIHHFYCEFPAVVQLVCGDITVYEIAVYIGDIVLLLLPIVLISASYV
FILHSVIRMHSAGGKRNAFATCSSHLTVVSLWFGACIFSYMRPRSQRTPLQDKVGSVFYTIITPTLNPLIYTLRNKDIAKALKRVLGREMITQNPKVRLP*
644 >lcl|XP_003124420.1|Plus1137934..138845 NW_003299656 olfactory receptor 14C36-like LOC100517216 __SEG__ Chr3 {Sus scrofa} MSNSTMMTEFLLISVADTWKLRVLYSMLFLFIYLATLLGNLLIVTVTTFDQKLNTPMYFFLRNLSVLDMCYITVTVPNTCVCFLTGNRTISVAACATQVFLVIYFAYVEI
LFLTVMAQDRYVAICQPLHYTITMNRKVCIQMTLVSLLSGLVYSGVHTGKTFQLTFCRSNVIHQFFCDVSSLLRISCSDTSSNFTLLLVSVIVVGGFCFIFITVSYINIF
RTMLKFSIREQRKAFSTCVPHIFVLTVFLSSIISVYLRPSVTSETIKDMILSAFYTMVPPFLNPIIYSFRNTQIKEAVRRVIF*
645 >lcl|XP_003124426.1|Plus1117591..118538 NW_003299656 olfactory receptor 2M3-like LOC100518301 __SEG__ Chr3 {Sus scrofa} MAWENQSFNSEFILLGIFDHSPTHIFLFCLVLSIFTVAFMGNTVMVLLIYLDTQLHIPMYLFLSQLSLMDLMLVCTTVPKMAFNYLSGRKSISLAGCGTQMFLFVSLLGS
ECFLLAAMAYDRYIAICHPLRYSVLMSQKICCLMAVPSWIIGLLDGVIVIAVALSFPYCGAREIPHFFCDVPALLTLSCTDTLLFERLMFICCVIMLLFPVAVIIASYAH
VILAVIRMRSGEGRSRAFATCSSHLMVVGMYYGAAMFIYMRPISDRSPTEDRMVSAFYTILTPMLNPLIYSLRNKEVYRAFIKVLRKGKSGEKIA*
646 >lcl|XP_003124427.1|Plus1170090..171022 NW_003299656 olfactory receptor 14C36-like LOC100518655 __SEG__ Chr3 {Sus scrofa} MSNSTMVTEFLLMSFADTWKLRVLYSMLFLFIYLATLLGNLLIVTATTLDQKLNTPMYFFLRNLSILDMCYITVTVPNACVYFLTGNRTISVAACATQVFLVIYFAYVEI
LFLTIMAQDRYVAICQPLHYTITMNRKVCIQMTLVSLLSGLVYSGVHTSKTFQLTFCQSNVIHQFFCDIPSLLRISCSDTSSNFILVLLSAIVVCGICFVFITVSYINIF
RAMLKFSIREQRKAFSTCVPHIFVLTVFLSSIISVYLRPSVTSETIKDMILSAFYTMVPPFLNPVIYSFRNTQVKEAGRRVIFLKFYSGR*
647 >lcl|XP_003124512.1|Plus1complement(621422..622402) NW_003534420 olfactory receptor 7A10-like LOC100521314 __SEG__ Chr3 {Sus scrofa} MEQENDTQFSDFILLGLSEEAAMQPLLFWLFLSMYLITLAGNLLIILTTIAASHLHTPMYFFLSSLSFSDICFISTTVPKMLLNLHIQDKSITYKGCLSQMYFFILFAEM
DIFLLSVMAYDRFVAICHPLRYATIMKPQLCGLLLLASWIMSLLDSLLRGLLVLRLSFCTDLEIPHYFCEINQVIQLACSDALLNVIEMYVATVLMGVIPLSGIAVSYSR
IVSSILRITSARGRYKAFSTCGSHLSVVCMFYGTGLGVYLSSATTPNSRARAFASVMYTVVTPMLNPFIYSLRNKDMKGALTSLVSTVTFSERSECFSWGRRSSHG*
648 >lcl|XP_003124704.1|Plus1551040..551978 NW_003534454 olfactory receptor 2C1-like LOC100516428 __SEG__ Chr3 {Sus scrofa} MERANATSLEGFILMGVSDHPQLERVFFVVILFSYLLTLVGNGTIILLSSLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLVNLWGSDKTISYGGCVTQLYVFLWLGAT
ECILLVVMAFDRYVAVCWPLHYTAVMNPRLCWLLAAIAWLGGLGNSGVQSTFTVQLPLCGNRRLDSFLCEVPAMIKMACGDTSLNEAVLNGVCTFFTAVPLSIILVSYCC
IARAVLEIHSAEGRRKAFNTCLSHLLVVLLFYGSAIYGYLLPAKTSSQDQGKFISLFYSVVTPMANPLIYTLRNKEVKGALRRLLGKGREVS*
649 >lcl|XP_003125000.1|Plus1complement(86623..88191) NW_003534480 leucine-rich repeat transmembrane neuronal protein 1-like LOC100520483 __SEG__ Chr3 {Sus scrofa} MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQ
KLRRVKELTLSSNQITQLANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHND
LVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLN
NFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEEGAEPTSGHLLSAVTNRSDLGSPASPATTLTDDREGQLDSTLEPATVALPGGEHAENAVQIHKVVTGTMALIFSFL
IVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV*
650 >lcl|XP_003125001.1|Plus1complement(195352..196920) NW_003534480 leucine-rich repeat transmembrane neuronal protein 1 LRRTM1 __SEG__ Chr3 {Sus scrofa} MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQ
KLRRVKELTLSSNQITQLANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHND
LVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLN
NFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEEGAEPTSGHLLSAVTNRSDLGSPASPATTLTDDREGQLDSTLEPATVALPGGEHAENAVQIHKVVTGTMALIFSFL
IVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV*
651 >lcl|XP_003125656.1|Plus11008350..1011100 NW_003534642 deubiquitinating protein VCIP135-like LOC100524801 __SEG__ Chr4 {Sus scrofa} MSQPPPPPPLPPPPPPPEAPQTPPSLAAAAAAAPGGLSKRRDRRILSGSCPDPKCQARLFFPASGSVSIECTECGQRHEQQQLLGVEEVTDPDVVLHNLLRNALLGVTGA
PKKNTELVKVMGLSNYHCKLLSPILARYGMDKQTGRAKLLRDMNQGELFDCALLGDRAFLIEPEHVNTVGYGKDRSGSLLYLHDTLEDIKRANKSQECLIPVHVDGDGHC
LVHAVSRALVGRELFWHALRENLKQHFQQHLARYQALFHDFIDAAEWEDIINECDPLFVPPEGVPLGLRNIHIFGLANVLHRPIILLDSLSGMRSSGDYSATFLPGLIPA
EKCTGRDGHLNKPICIAWSSSGRNHYIPLVGIKGAALPKLPMNLLPKAWGVPQDLIKKYIKLEEDGGCVIGGDRSLQDKYLLRLVAAMEEVFMDKHGIHPSLVADVHQYF
YRRTGVIGVQPEEVTAAAKKAVMDNRLHKCLLCGALSELHVPPEWLAPGGKLYNLAKSTHGQLRPDKNYSFPLNNLVCSYDSVKDVLVPDYGLSNLTACNWCHGTSVRRV
RGDGSIVYLDGDRTNSRSTGGKCGCGFKHFWDGKEYDNLPEAFPITLEWGGRVVRETVYWFQYESDASLNSNVYDVAMKLVTKHFPGEFGSEILVQKVVHTILHQTAKKN
PDDYTPVNIDGAHAQRVGDVQGQESESQLPTKIILTGQKTKTLHKEELNMSKTERTIQQNITEQASVMQKRKTEKLKQEQKGQPRTVSPSTVRDGPSSAPATPTKAPYSP
TTSKEKKIRITTNDGRQSMVTLKSSTTFFELQESIAREFNIPPYLQCIRYGFPPKELMPPQAGMEKEPVPLQHGDRITIEILKSKAEGGQSAAAHSAHAVKTEESAVTGK
LSSKELQEQADKEMYSLCLLATLMGKINLTQMVFLN*
652 >lcl|XP_003125723.1|Plus1144131..145060 NW_003299867 olfactory receptor 10J5-like LOC100517340 __SEG__ Chr4 {Sus scrofa} MQRKNFTEMAEFIFLGFSIFGKHQITLFVVFLTMYILVLAGNITIVTVICIDHRLHTPMYFFLSMLASSETVYTLVIVPRMLSGLIFHNQPISLAGCATQMFFFVVLATN
NCFLLTVMGYDRYVAICKPLRYTVIMNKGMCAGLVCGSFGTGLVMAVLHVTAMFRLPFCGSMVDHFFCDIYPVMKLSCIDTTVNEIINYGVSSFVIFVPVGLIFISYIFV
ISSILKIPSAKGRKKTFATCASHLTVVIVHYGCASIAYLKPKSENAIEKDLLLSVTYTIVTPLLNPVVYSLRNKEVKDALRRAVSRNIS*
653 >lcl|XP_003125729.1|Plus1332359..333303 NW_003534663 olfactory receptor 10K2-like LOC100519896 __SEG__ Chr4 {Sus scrofa} MEWVNETTVREFTFLGFSSLAGLQRLLFVVFLLVYLFTLGTNAIIISTIVLDRALHTPMYFFLGVLSCSETCYTFVIVPKMLVDLLAQKKTISFLGCAIQMFTFLFLGCS
HSFLLAAMGYDRYVAICNPLRYTVLMGYGVCVGLVAAACFCGFTVAQIITSMVFHLPFHSSNQLHHFFCDISPVLKVASHPTHFNQFIIIMLCALVLVIPLFLILVSYIH
IISAILQFPSTLGRYKAFSTCASHLIIVIVHYGCASFIYLRPKSHYSSSQDVLMSVSYTILTPLFNPIIYSLRNKEFKSALQRVVGRTISLLHH*
654 >lcl|XP_003125731.1|Plus1284418..285350 NW_003299867 olfactory receptor 10J1-like LOC100520241 __SEG__ Chr4 {Sus scrofa} MNIGNHTVVSEFVLQGFSSFHEHKLTLFVVFLTLYLFTLAGNVIIVTIISIDRHLHTPMYFFLAVLSTSETVYTLVVVPRMLSSLVGLSQPISLVGCATQMFFFITLAIN
NCFLLTAMGYDRYVAICNPLRYTVIMNKRVCAQLGWGACSIGLLVATIQISCVFRLPFCDREVAHYFCDIRPVMKLSCVDTTVHDIINVIVSSLVIVVPMGLVFISYVLI
ISTILKIASAEGRKKAFATCASHLTVVVVHYGCASTAYLKPKSENTQDQDQLISVTYTVFTPLLNPVVYTLRNKEVKDALLRVIGKKPLG*
655 >lcl|XP_003125732.1|Plus1complement(491401..492333) NW_003299867 olfactory receptor 10J1-like LOC100520785 __SEG__ Chr4 {Sus scrofa} MNIGNHTVVSEFVLQGFSSFHEHKLTLFVVFLTLYLFTLAGNVIIVTIISIDRHLHTPMYFFLAVLSTSETVYTLVVVPRMLSSLVGLSQPISLVGCATQMFFFITLAIN
NCFLLTAMGYDRYVAICNPLRYTVIMNKRVCAQLGWGACSIGLLVATIQISCVFRLPFCDREVAHYFCDIRPVMKLSCVDTTVHDIINVIVSSLVIVVPMGLVFISYVLI
ISTILKIASAEGRKKAFATCASHLTVVVVHYGCASTAYLKPKSENTQDQDQLISVTYTVFTPLLNPVVYTLRNKEVKDALLRVIGKKPLG*
656 >lcl|XP_003125807.1|Plus1complement(940576..941637) NW_003534667 c2 calcium-dependent domain-containing protein 4D-like LOC100515312 __SEG__ Chr4 {Sus scrofa} MWLLEKAGYRVGAAESRARWAPSSLFPKRRTPGQLARACPNVLTPDRIPQFIIPPRLSDPGGAEPPGGRDAGGRGLPTACSLPHLAGREGWAFLPESPHTRRRESLFHSP
PPAPAGGLSPAQSRLHVSAPDLRLCRAPDSDTASSPDSSPFGSPRPGPDRPRPPRPCSLSPEEASSADTSPYTPRRAGPPTPPLFHLDFLCCQLRPTKESVLRLEPRGGQ
LRFSAEYQAAHGRLRLRLVSAEGLPEPRAGPGCGGGGCCVVLRLRPRVRPRGQRSRVVKCSANPIFNEDFFFDGLGPPDLATRSLRAKVLDRGAGFRRDVLLGECETPLI
ALLPPLGGGLGPGTSLAPAHLSL*
657 >lcl|XP_003125914.1|Plus1complement(116235..117590) NW_003534691 probable G-protein coupled receptor 61-like LOC100514405 __SEG__ Chr4 {Sus scrofa} MESSPIPQSAGNASTLGRVPQTPGPSTASGVPEVGLRDVASESVALFFMLLLDLTAVAGNAAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDQDLF
GEVACRLYLFLSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVAVWVKALAMASVPVLGRVSREEGAPSVPLGCSLQWSHSAYCQLFVVVFAVLYFLLP
LLLILVVYCSMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSAQPTSTGQVESVVTWIG
YFCFTSNPFFYGCLNRQIRGELSKQFVCFFKQAPEEELRLPSREGSIEENFLQFLQGTGCPTESWVSRPVPSPKQEPAAVDFRIPGQIAEETSEFLEQHLTSDIVVSDGY
LRPAPSPRRES*
658 >lcl|XP_003125916.1|Plus1154103..155581 NW_003534691 amphoterin-induced protein 1-like LOC100514767 __SEG__ Chr4 {Sus scrofa} MQPQRDLRGLWLLLLSLYLLLFEVARAGRPVVSCPAACLCASNILSCSKQQLPSVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNHLNFISSEAFSPVP
NLRYLDLSSNQLRTLDEFLFSELQALEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLLDLQKLPAWIKNGLYLHN
NPLHCDCELYQLFSHWQYRQLSSVMDFQEDLYCMSAKKLHNVFNLSFLNCSEYKERAWEAHLGDTLTIKCDTKQQGMTKVWVTPSNERVLEEGANSTVTVSKDDGSLHFQ
RVQVEDGGVYTCYAMGEAFNETLSVELKVYNFTSHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDR
RVAFLDPAGSGQNGKLKPGNTLPVPEVTGKGQRRMSDPESVSSVFSDTPIVV*
659 >lcl|XP_003126089.1|Plus1complement(590334..592793) NW_003534725 leucine-rich repeat and fibronectin type-III domain-containing protein 6-like LOC100511563 __SEG__ Chr5 {Sus scrofa} MLRLGLCAAALLCVCRPGAVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDLRLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQL
GYNKLSNLTEGMLRGMGRLQFLFVQHNLIEVVTPAAFSECPSLISIDLSSNRLSRLDGATFASLASLMVCELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPRE
FAGYPLLVPRPYHSLNAITVLQAKCRNGSLPARPASHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHHVTFTSATLVVIIPHPYSKMYVLVQYNN
SYFSDVMTLKNKKEIVTLDKLRAHTEYTFCVTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLRKRRMQEEKQKSAKVKKTILE
MRYGADVDAGSVVHATQKLGEPPVLPVSRMSSIPSMIGEKLPTSKGLEAGLDTPKVATKGNYIEVRTGAAGDGLARPEDDLPELENGQGSAAEISTIAKEVDKVNQIINN
CIDALKLDSASFLGGGSSGGDPEMAFECQSLPAASTASSAAAPGALERPSFLSPPYKESSHHPLQRQLSADAAVARKTCSVSSSGSIKSAKVFSLDVPDHPAATGLAKGD
SKYIEKGSPLNSPLDRLPLVPASSSGSSTGGGVHHLEVKPAYHCSEHRHSFPALYYEEGTDSLSQRVSFLKPLTRTKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWE
RFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL*
660 >lcl|XP_003126257.1|Plus1969565..970506 NW_003534749 olfactory receptor 9K2-like LOC100522316 __SEG__ Chr5 {Sus scrofa} MGDKGGDNHSEVTDFILVGIRIRPELHSLLFLLFLIIYGMVLLGNLSMIGIIVTDPRLNTPMYFFLGNLSIIDLSYSTIIVPKAMVNILSQKKTISFVGCVAQLFLYALF
MVTEAFVLAAMAYDRFIAICNPLLYTVRMSRSLCIQLVAGSYLCGWVSSILQISVTFSMSFCASRVIDHFYCDSNPIEKISCSNVFMNKMVSLSLAILIILPTIVVIVVS
YMYIVSTVLKIRSSEGRKKAFSTCSSHLGVVSLLYGTVSFVYLTPPNNPELRKVASVCYILLTPMLNPLIYSLRNKDVKDAMKKVIWKKKVLL*
661 >lcl|XP_003126261.1|Plus1949125..950066 NW_003534749 olfactory receptor 9K2-like LOC100524142 __SEG__ Chr5 {Sus scrofa} MGDKGAGNHSDVTDFILVGFRVRPEFHILLFLLFLLVYGMVLLGNISMMAIIVTDSQLNTPMYFFLGNLSFIDLSYSTVIAPKAMVNFLSEKKTVSFVGCATQFFLFAFF
IVTEGFILAAMAYDRFIAICNPLLYSVHMSRRLCTQLVAGSYFCGWVSSILQVSITFSVSFCASRVIDHFYCDSYQIEKISCSNLFINKMVSLSLAAFIILPTIVVIVVS
YMYIVTTVLKIPSSEGRKKAFSTCSSHLGVVSLLYGTVSFVYLTPPSNPELRKVASVFYILVTPMLNPLIYSLRNKDVKQALRKILWKKKPLS*
662 >lcl|XP_003126267.1|Plus1complement(1025632..1026636) NW_003534749 olfactory receptor 9K2-like LOC100512466 __SEG__ Chr5 {Sus scrofa} MKDRVHLFILPCASQQVSAMGMGDRGTSNHSGVTDFILVGFRVRPELHTLLFLLFLLVYTMVLLGNVGMMAVIMTDPQLKTPMYFFLGNLSFVDLFYSSAIAPKAMINFW
SQSKTISLAGCLTQFFLFTLFIVTEGFLLAVMAYDRFIAICNPLLYSVHMSTRLCTQLVAGSYFCGCISSILQTSMTFTLSFCASRAIDHFYCDTRPLRRISCSDVFIHK
IISFSLSSIIILPTIIVIIVSYLYIVSTVLKIRSTEGRKKAFSTCSSHLGVVSILYGAVFFMYLTPDTFPELSKVASLCYTLVTPMLNPLIYSLRNNDVKAALNKLLEKK
STIL*
663 >lcl|XP_003126268.1|Plus11080992..1081933 NW_003534749 olfactory receptor 9K2-like LOC100512655 __SEG__ Chr5 {Sus scrofa} MGDKGAGNHSDVTDFILVGFRVRPEFHILLFLLFLLVYGMVLLGNISMMAIIVTDSQLNTPMYFFLGNLSFIDLSYSTVIAPKAMVNFLSEKKTVSFVGCATQFFLFAFF
IVTEGFILAAMAYDRFIAICNPLLYSVHMSRRLCTQLVAGSYFCGWVSSILQVSITFSVSFCASRVIDHFYCDSYQIEKISCSNLFINKMVSLSLAAFIILPTIVVIVVS
YMYIVTTVLKIPSSEGRKKAFSTCSSHLGVVSLLYGTVSFVYLTPPSNPELRKVASVFYILVTPMLNPLIYSLRNKDVKQALRKILWKKKPLS*
664 >lcl|XP_003126269.1|Plus11029687..1030634 NW_003534749 olfactory receptor 12-like LOC100512836 __SEG__ Chr5 {Sus scrofa} MKSELNRNYSEVTEFILLGFRTSPKIQILIFLLFLLIYVVIVVGNISMLAVIKIDSRLHTPMYFFLRNLSYLDLCYSTVIAPKTLATFLSKDKRISYNGCATQFFFFALF
VGTEGFLLAVMAYDRFSAICSPFLYPVRMSQQACVRLVIGSYICGCVNSMVQTGFTFSLHFCGENRLDHFFCDVPALIKISCVDTFMNEIVLFILSALIIITTTVIILVS
YACILSTILKIPSTHGRSKTFSTCTSHITVVSLFYGTVFFMYAQPGAISSPEKSKIIAVFYTLIIPMLNPLIYSLRNREVKNAVKRIVLRKVSSH*
665 >lcl|XP_003126270.2|Plus1complement(1052777..1053718) NW_003534749 olfactory receptor 10C1-like LOC100513011 __SEG__ Chr5 {Sus scrofa} MSGNQSLCTRFTLVAFSSLAELQPVLFVLVLAIYLFTVGGNLIIISLIRVTPALHTPMYFFLVNLSFLEMCYITSVVPQMLVHLLVETKTISVGGCAAQMYVFSILGLTE
CCLLAAMAYDRFIAICHPLHYTLLMGPPVCLKLAAASWTTGVVVEAAQITWIFTLPFCGTGEIQHFFCDIMPVVKLACVDTSRNEIVIFAVSVLFIMSPCFLILCSYARI
LVTIVRIPSAAGRRKAFSTCSSHILVVSLFYGTALFTYLQPKTAHTPASDKATALMYTVVTPALNPVIYTLRNKEVKEAFQKLTHRNSLRQMA*
666 >lcl|XP_003126275.1|Plus1201873..202808 NW_003299923 olfactory receptor 6C2-like LOC100519484 __SEG__ Chr5 {Sus scrofa} MKNHSAITSFILLGLTDDPRLQVFLSVFLFLTYIFTVVGNLVIILLTLVDSHLKTPMYFFLRNFSILEIILTTVCVPRFLYSMTTGDKNVTYNACAIQLFFVILIGATEF
FLLTAMSYDRYVAICKPLHYTAIMNGRICTVLVLGCWLIGLIVILPPLSLGVQLDFCDSNLLDHFGCDASPLLKIVCSDTQFVEQLVLIMAVLTLMVTLVCVIVSYTYII
KSILRLPSAQQRKKAFSTCSSHIIVVSITYGSCIFIYIKPAKEGVAINKAVSLLNTSVIPLMNPFIYTLRNKQVKQAFRDSIKKTAFLSKN*
667 >lcl|XP_003126277.1|Plus1complement(247873..248808) NW_003299923 olfactory receptor 6C2-like LOC100519839 __SEG__ Chr5 {Sus scrofa} MRNHSMITMFIILGLTDDPQLEILIFVFLLITYVFSVIGNLTIISLVLVDSHLKTAMYFFLQNFSFLEISFTTACVPTYLHIISSGDKTITISACFSQIFFFVLFGATEF
FLLAVMSYDRYVAICKPLHYMSIMNSRVCRNLILCCWVSGLLIILPPLGLSLHLEFCDSVIDHFVCDASPILKNSCSDTWFIEQLVIACAVLTFLVTLVCVILSYIYIIR
TVLRFPSAQQRKKAFSTGSSHMIVVSKTYGSCIFMYIKPSAKDEMAINKGASLLPISVAPLLNPFIYTLRNKQVKKSFHNTLKRFVFHSKK*
668 >lcl|XP_003126278.1|Plus1360898..361836 NW_003299923 olfactory receptor 6C2-like LOC100520381 __SEG__ Chr5 {Sus scrofa} MKNSTAITTFILVGLTDDPNLQILLFIFLFLTYLLSVVGNLTIITLTLVDSHLKTPMYFFLWNFSILEVSLTTVCIPRFLYTMASGDNTVTYNACTTQLFFIIVLGVTEF
FLLSAMSYDRYVAICKPLHYTTIMSSTVCIRFLLGCYVIALIIVLPPYIMGLDLEFCDSNVIDHFGCDAAPILKITCSDTAFIERFVLVLAVLTLLFTLVCVILSYTYII
RTILRFPSAQQRKKAFSTSSSHVIVVSITYGSCIFIYIKPSAKEGVAMNKVVSVLTTSVAPVMNPFIYTLRNKQVVQAFKDMIKSIAAVAKN*
669 >lcl|XP_003126280.2|Plus1486176..487114 NW_003299923 olfactory receptor 6C2-like LOC100521089 __SEG__ Chr5 {Sus scrofa} MRNHTRLTTFILLGLTDDPQLQALLFIFLLVTYMLSVTGNLTIISLTLVNSQLKSAMYFFLQNFSFLEISFTTVCIPRFLYSMSTGDKTITYNACASQLFFVIFFGSTEF
FLLAVMSYDRYVAICKPLHYVTIMNSRVCRRFVLSCWAGGLFIIIPPLSLGLNLEFCDSNVIDHFLCDASPILKISCSDTWFIDQMVIACAVMTFIMTLVCVVLSYVYII
KTILRFPSAQQRKKAFSTCSSHMLVVSITYGSCIFIYIKPSAKEEVDINKGVSVLTTSVAPMLNPFIYTLRNKQVKQAFSYSVKRMAFFSKK*
670 >lcl|XP_003126281.2|Plus190514..91452 NW_003534752 olfactory receptor 6C2-like LOC100523788 __SEG__ Chr5 {Sus scrofa} MRNHSAIRTFVILGLTGDPQLEILAFNFLLIAYMFSVIGNLTIISLVLVDSHLKTAMYFFLQNFSFLEISFTTACVPTYLHIISSGDKTITISACFSQIFFIILFGATEF
FLLAVMSYDRYVAICKPLHYMSIMNSRVCRNLILCCWVSGLLIILPPFGLSLRLEFCDTVIDQFFCDASPILKNSCSDTWFIEQLIVFSGVLTLIVTLVCVVLSYIYIIG
TVLRFPSAQQRKKAFLTCSSHMIVVSMTYSSCIFMYIKPSAKDEVAINKGVSLLPTSVAPLLNPFIYTLRNKQVRQSFYDTFKRLANVSKKF*
671 >lcl|XP_003126282.2|Plus1146148..147083 NW_003299923 olfactory receptor 6C2-like LOC100524494 __SEG__ Chr5 {Sus scrofa} MRNRTITTFILLGLTDDPELQVLIFIFLFLTYTLSVTGNLTIITLTFVDSHLKTPMYFFLKNFSFLEISLTTACVPRYLYSIATSDKIITYNACFIQVFFTDLCGVTEFF
LLAAMSYDRYVAICKPLHYVTIMSSRVCGILISSCWMAGLCVLIPPLSLGLNLKFCDSNRLDHFGCDAFPLVKISCSDTWLMEQTVIICAVLTLNMTLTCVVLSYAYIIK
TIFRFPSVQQRKKAFSTCSSHMIVVSITYGTCIFIYMNPTAKGEVTIKKVVSLIIFSVSPTLNPFIYTLRNNQVKKAFKDSIKRIALLSTK*
672 >lcl|XP_003126283.2|Plus1153161..154096 NW_003299923 olfactory receptor 6C2-like LOC100524678 __SEG__ Chr5 {Sus scrofa} MRNHTVTTFILLGLTDEPQLKALVFIFLFLTYMLSVTGNLTIISLTSTDSHLKTAMYFFLQNFSFLEIAFTSACIPQYLYNIATGDKTITYNSCATQLFFTDVFGVTEFF
LLATMSYDRYAAICKPLHYVTIVNHTVCRRLIFGSWLAGLLIIIPPLSLGLKLEFCDSNVIDHFVCDAAPLLKISCSETWLIEQMVIVCAVLTFIMTLVCVVLSYVHILK
TILQFPSAQQRKKAFSTCSSHMIVVSISYGSCIFTYVKPSAKESVAVNKGVTILTTSIAPMLNPFIYTLRNKQVKQAFNDAIKRFALFLKK*
673 >lcl|XP_003126284.1|Plus1complement(191946..192884) NW_003299923 olfactory receptor 6C2-like LOC100525221 __SEG__ Chr5 {Sus scrofa} MRNHTSLTCFILLGLTDDPHMQILIFLFLLLTYMLSLTGNLIILLLILVDSHLKTAMYFFLQNFSFLEISFTSACIPRFLYSISTGDRAITYNACACQLFFTYMFAVTEF
FLLAAMSFDRYVAICKPLHYVTIMDHRVCRRIVFCCWMATLLIISPPFSFGLALEFCDSTVIDHFVCDVNPLLKIACSETRFIEQMTLAGSVLIFILTLVCVVLSYVYII
RTILGFPSAQQRTKAFSTCSSHIIVVSITYGSCIFVYIKPSAKDEMTINKGVTILTTSISPMLNPFIYTLRNKQVKQAFNDLVQRIISLSKN*
674 >lcl|XP_003126285.2|Plus1complement(11341..12276) NW_003534751 olfactory receptor 6C2-like LOC100525920 __SEG__ Chr5 {Sus scrofa} MRNHTITTFILLGLTDDPRIKVLIFIFLFFTYMLSAAGNLTIISLTFIDCHLRTAIYFFLQNFSFLEISFTMACIPRFLYNIATGDKIITYAACAAQIFFTYLFGITEFF
LLAIMSFDRYVAICKPLHYVTIMNNRVCNRLIISCWMAGLCIIIPPLSLGLSLEFCDSNVIDHFFCDATPLLKVSCSDTRFIERMILVCAVLTFIMTLVCVVLSYIYIIM
TILRFSSSQQRKKAFSTCSAHMIVVSITYGSCIFIYIKPSAKKEVALNKGVSLLISSISPTLNPFIYTLRNKQVKKALNDLIKRITFFFKK*
675 >lcl|XP_003126287.2|Plus1323423..324361 NW_003299923 olfactory receptor 6C68-like LOC100510905 __SEG__ Chr5 {Sus scrofa} MGNHTAITTFILLGLTEDPRLQLLLFLFLFLTYILSVAGNLTIITLTLLDPHLKIPMYFFLQNFSFLEISFTTACIPRFLYSISTGDRTITYNACFIQLFFTDLFGITEF
FLLATMAYDRYVAICKPLHYMTIMSNKLCKTMVVCCWGAALLIFLPLLSLDIQLEFCDSNLIDHFICDASPLLKISCSDTWLIEQMVIASAVLTFIITLVCVVLSYINII
RMILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLVSSISPVLNPFIYTLRNKQVKQAFHDTLKKTAFLLRK*
676 >lcl|XP_003126288.2|Plus1299262..300200 NW_003299923 olfactory receptor 6C68-like LOC100511450 __SEG__ Chr5 {Sus scrofa} MRNHTAITTFILLGLTEDPRLQLLLFLFLFLTYILCITGNLTIITLTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYSISTGDRTITYNACAIQLFFIDLFGVTEF
FLLATMAYDRYVAICKPLHYMTIMSNKLCKTMVACCWLAALLIILPPLSLGFHLEFCDSNFIDHFGCDASPLLKISCSDTWLIEQMVIACAVLTFIITLVCVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPMLNPFIYTLRNKQVKQAFHDTLKKTAFLLGK*
677 >lcl|XP_003126289.1|Plus1complement(264175..265110) NW_003299923 olfactory receptor 6C2-like LOC100511812 __SEG__ Chr5 {Sus scrofa} MRNHSMITMFIILGLTDDPQLEILIFVFLLITYVFSVIGNLTIISLVLVDSHLKTAMYFFLQNFSFLEISFTTACVPTYLHIISSGDKTITISACFSQIFFFVLFGATEF
FLLAVMSYDRYVAICKPLHYMSIMNSRVCRNLILCCWVSGLLIILPPLGLSLHLEFCDSVIDHFVCDASPILKNSCSDTWFIEQLVIACAVLTFLVTLVCVILSYIYIIR
TVLRFPSAQQRKKAFSTGSSHMIVVSKTYGSCIFMYIKPSAKDEMAINKGASLLPISVAPLLNPFIYTLRNKQVKKSFHNTLKRFVFHSKK*
678 >lcl|XP_003126291.2|Plus1429938..430876 NW_003299923 olfactory receptor 6C68-like LOC100512715 __SEG__ Chr5 {Sus scrofa} MRNHTAITTFILLGLTEDPRLQLLLFLFLFLTYILCITGNLTIITLTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYSISTGDRTITYNACAIQLFFIDLFGVTEF
FLLATMAYDRYVAICKPLHYMTIMSNKLCKTMVACCWLAALLIILPPLSLGFHLEFCDSNFIDHFGCDASPLLKISCSDTWLIEQMVIACAVLTFIITLVCVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPMLNPFIYTLRNKQVKQAFHDTLKKTAFLLGK*
679 >lcl|XP_003126292.2|Plus1454098..455036 NW_003299923 olfactory receptor 6C68-like LOC100513280 __SEG__ Chr5 {Sus scrofa} MGNHTAITTFILLGLTEDPRLQLLLFLFLFLTYILSVAGNLTIITLTLLDPHLKIPMYFFLQNFSFLEISFTTACIPRFLYSISTGDRTITYNACFIQLFFTDLFGITEF
FLLATMAYDRYVAICKPLHYMTIMSNKLCKTMVVCCWGAALLIFLPLLSLDIQLEFCDSNLIDHFICDASPLLKISCSDTWLIEQMVIASAVLTFIITLVCVVLSYINII
RMILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLVSSISPVLNPFIYTLRNKQVKQAFHDTLKKTAFLLRK*
680 >lcl|XP_003126293.1|Plus1495823..496770 NW_003299923 olfactory receptor 6C2-like LOC100513471 __SEG__ Chr5 {Sus scrofa} MRNHTITTFILLGLTDDPRMKVLIFIFLFFTYMLSAAGNLTIISLTFIDCRLRTAMYFFLQNFSFLEISFTTACIPRFLYNIATGDKIITYAACAAQIFFTYLFGITEFF
LLAIMSFDRYVAICKPLHYATIMNNRVCNRLIISCWMASLCIIIPPLSLGLNLEFCDSNVIDHFFCDATPLLKISCSDTRFIERMILVCAVLTFILTFVCVVLSYIYIIM
TILRFSSSQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKKEVALNKGVSLLIFSISPTLNPFIYTLRNKQVQKALNDLIKRLHSSKSKKKGT*
681 >lcl|XP_003126338.1|Plus1105789..106898 NW_003534754 G-protein coupled receptor 182-like LOC100512467 __SEG__ Chr5 {Sus scrofa} MSTTGPSVGPASDLGEIHNWTELLHFFNHTLPECHMELSEDTKRVALFVLYLAIFVVGLVENLLVICVNWHSSDRAGLLRPYVLNMAIADLGIVLSLPVWMLEVTLDYTW
LWGSFSCRFTHYFYFVNMYSSIFFLVCLSIDRYVTLTNAFPTWQRHQHRGRRAVCMGVWVLAALIPLPEVVHIQLVDSFEPMCLFMAPFETYSTWALVAALSTTVLGFLL
PFPLMVVFNVLTACRLRQAGQPEGRRHCRLVCAYITVFVICWLPYHVTLLLITLHGTHISLHCYLAHLLYFFYDIIDCFSMLHCVVNPILYNFLSPSFQGRLLNAVVHYL
PKVQDREGRHASSSSSTQHSIVITKEGIQPPAAGPHHRV*
682 >lcl|XP_003126679.2|Plus1complement(563787..565352) NW_003534830 amphoterin-induced protein 2-like LOC100152349 __SEG__ Chr5 {Sus scrofa} MSLRLRALPTLPRVVRPGCRELLCLLVITVTVSRGTSGVCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWLPVSFVKLNTLIIRHNNITSISTD
SFSTTPNLKCLDLSSNKLKTVKSAVFQELKVLEVLLLYNNHISYLDPSAFGGLPHLQKLYLSGNFLTQFPMDLYLGRFKLAELMFLDVSYNRISSLPMHHINLVPGKQLR
GIYLHGNPFVCDCSLYSLLIFWYRRHFSSVMDFKNDYTCRLWSDTRHFHQVLLLQDSFLNCSDSIVNGSFRALGFIHEAQVGERLIVHCDSKTGNSNTDFMWVGPDNRVL
EPEKEMKNFHVFPNGSLVIESPRFEDAGVYSCIAMNRQRLLNETVDVTINVSNFTMNRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCKPKRQKHMLNQSSVQ
ASILAPGPDSDAPADERKASAGKRVVFLEPLKDTAAGQNGKVRLFPSETVIAEGILKSSRVKSDSDSVNSVFSDTPFVAST*
683 >lcl|XP_003126683.1|Plus1697586..698521 NW_003534833 olfactory receptor 8S1-like LOC100512902 __SEG__ Chr5 {Sus scrofa} MALGNHSTITEFLFRGLSADPHIQAALFVLFLEIYLLTVTGNLMMMLVIGADSHLHTPMCFFLSHLSFLDLCLSSVTVPKMLKDLLFEKKSISVKGCLAQSFFVFTIAGT
ECFLLSAMAYDRYAAICYPLLYGQMMKKQLCVQLVWGSWGLGSLNAFINILLASNLDFCGNHIISHYSCEMPSLYLLSCSDVSTNLLVLLCSSLLHGFGTLLPIFFSYAR
IVSTILSISSTSGRSKTFSTCSSHLIAVSFFFGSGFLRYLTPTSGTPLELIFSVQYCVVTPMLNPLIYSLKNREVKAGVRRTLRKYLPWSR*
684 >lcl|XP_003126699.1|Plus1complement(436226..437185) NW_003534833 olfactory receptor 8S1-like LOC100516735 __SEG__ Chr5 {Sus scrofa} MKNVSIITEFVFLGLSSDPHIQTMLFVLFLWIYLLTLMGNLMMILIIKADLQLHTPMYFFLGHLSFLDLSFSSVTVPKMIENFLSQKKSISVWGCLTQSFFFTLSGGTEA
CLLSAMAYDRYAAICHPLVYTIIINRPLCIVTVSIAWAVGFLISLMNSLFIHKLHFCGSNIIPHFSCELPPLFPLSCTDPTVNEILLAVSCAFLGVLTLPLILFSYSKII
SVILNIHSSDGQGKAFSTCSSHLTVVLLFYGTALFRYIGPASGSVWEQVVSIQYGVITSLLNPLIYSLKNQEVKAALQRMLRQQVCHRVRKSCVILLRK*
685 >lcl|XP_003126700.1|Plus1complement(453054..453983) NW_003534833 olfactory receptor 8S1-like LOC100516910 __SEG__ Chr5 {Sus scrofa} MKNLSIIEEFVLLGLSDDPDIQTLLFVLFLGMYFLTLMGNLTMILVIRADSHLCMPMYVFLGHLSFLDMCHSSVTMPKMLQNFLSQKKTISVWGCIMQSFFFTLSGGTES
CLLSAMAYDRYAAICHPLLYTVIMNRPLYTAMVSAAWVMGFLNSLVNNLCIQNLQFCGPNIISHFSCELPSLFPLSCTDTTANTILLAGSTAFLGLLTLPLILFSYSKII
FAILSISSSKNQGKAFSTCSSHLTVVLLFYGTALFRYISPSSGSVLERVVSIQYGVITSLINPLIYSFKNQEVKAALQRMLRQQIWVSG*
686 >lcl|XP_003126701.1|Plus1complement(483306..484217) NW_003534833 olfactory receptor 8S1-like LOC100517094 __SEG__ Chr5 {Sus scrofa} MNNFTFFTEFILLGLSDDPHSRALLFALFLGIYLLTLIGNLVMILVIRGDSHLHIPMYFFLGHLSFIDICFSSVTMPKMLQNFLSQKKSISVWGCITQSFFFLLNGCTEA
SLLSAMAYDRYAAVCHPLLYTMVMNRTLCNAMVSAAWVMGFLNSLVNNIFIHKLHFCGSNIISHFCCELPSLFPLSCTDPAANEFLLSGTSAFLGLLTLPLILFSYSRII
PAILNIHSSEGQGKAFSTCSSHLTVVLLFYGTALFRYISPASGSVLEQMVSIQYGVITSLLNPLIYSLKNQEVKAALQRMLRQ*
687 >lcl|XP_003126702.1|Plus1complement(535007..535936) NW_003534833 olfactory receptor 8S1-like LOC100517469 __SEG__ Chr5 {Sus scrofa} MENRSMISEFILLGFSADPQTQILLFVLFLVIYLLTLMGNLVMLLVIRIDPHLHTPMYFFLRQLSFLDLCHSSVTVPKMLENLLSESKTIFVESCLAQAFFVFATGGTEA
CLLAVMAYDRYVAISSPLLYGQVMSNQLCVGLVWGSWGLAFVDALINILLAVNLDYCEDHTIPHFSCELSSLFPLSCSDTATNFTLLLCSSVLHFFGTFIMIVSSYARIV
STILSISSTSGRSKAFSTCSSHLTTVILFYGSGFLSYLLPASGSPLEMVFSLQYSVVTPMLNPLIYSLQNKEVKAAMRRMLRRYVNIFT*
688 >lcl|XP_003126703.1|Plus1complement(556387..557316) NW_003534833 olfactory receptor 8S1-like LOC100517652 __SEG__ Chr5 {Sus scrofa} MKNYSATSEFVLLGLSVDPHIQAVLFMLFILIYLLTLMGNFLMMLMIRADFHLHTPMYFFLRQLSFLDLCHSSVTVPKMLENLLSESKTIFVESCLAQAFFVFATGGTEA
CLLAVMAYDRYVAISSPLLYGQVMSNQLCVGLVWGSWGLAFVDALINILLAVNLDYCEDHTIPHFSCELSSLFPLSCSDTATNFTLLLCSSVLHFFGTFIMIVSSYARIV
STILSISSTSGRSKAFSTCSSHLTTVILFYGSGFLSYLLPASGSPLEMVFSLQYSVVTPMLNPLIYSLQNKEVKAAMGRMFRKYFHSLL*
689 >lcl|XP_003126709.1|Plus1730132..731082 NW_003534833 olfactory receptor 8S1-like LOC100519257 __SEG__ Chr5 {Sus scrofa} MALGNHSTVTEFILLGLSADPHVQALFFVLFLAIYLLTLLGNMTMMLVIQVDSHLHTPMYFFLSHLSFLDFCFSSATVPKMLEILLSQKKTISVVGCLTQVFSVFYLGGT
EACLLSVMAYDRYAAICHPLLYDQKMSNQVYNKLVWGSWSLSFLDAFTNIILAMNLDFCRNQSIPHYSCELPSLFPLSCSDVSTNFTVLLFFGLLHGLGTCLLIIFSYTP
IISTILSISSSSGRSKAFSTCSSHLTGVILFYGSAFLLYLMPISGSPLELIFSVQYSVITPLVNPFIYSLKNNEVKAAMRRTFRKYLQHHLTKDRR*
690 >lcl|XP_003127026.1|Plus1complement(291935..292675) NW_003300054 calpain small subunit 2-like LOC100518072 __SEG__ Chr6 {Sus scrofa} MFLAKALLEGADQGLGQALGGLLGGGGQRRGGGNIGGIVGGIVNFISESAAAQYTPEPPPTQQHFTNVEANESDEVRRFRQQFAQLAGPDMEVGATDLMNILNKVLSKHK
DLKSDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCIYKQYDRDQSGSLGSSQVRGALQAAGFQLNEQLYQTIIRRYAEEDGRMDFNSFISCLVRLDAMFRA
FRSLDRDADGLIQVYIQEWLQLTMYS*
691 >lcl|XP_003127091.1|Plus173870..74772 NW_003534949 free fatty acid receptor 1 FFAR1 __SEG__ Chr6 {Sus scrofa} MDLPPQLSFALYVAAFALGFPLNCLAIAGAVSQARLRLTPSLVYALHLGCSDLLLATSLPLKAAEVLAGGAWPLPAVLCPILALAHFAPLYTGGSFLAALSVGRYLGAAF
PLGYQAARRPRYSWGVCVAIWALVLCHLGLVFGLEAPGGWLDNTTSSLGINTPVNGSPVCLEAWDPASVGPARLSLSLLFFFLPLIITAFCYVGCLRALARSGLSHRRKL
RAAWVAGGALLTLLLCLGPYNASNVAGFLNPNLGGYWRKLGLITGAWSVVLNPLVTGYLGGGTGRGTTCVARTKGGPSQK*
692 >lcl|XP_003127094.1|Plus1107037..108026 NW_003534949 free fatty acid receptor 2 FFAR2 __SEG__ Chr6 {Sus scrofa} MLDLHSSVILTAYILIFLTGLPANLLALRAFVGRVRQPHPAPIHILLLSLTLADLLLLLLLPLKITEAASNFRWYLPGIVCALMGFGFYSSIYCSTWLLAGISIERYLGV
AFPVQYKLSRRPLYGVIAALVAWIMSFGHCTVVFIVQYLNSTQKAEGMNVSTCYENFTKEQLDVVLPVRLELCLVLFFIPMVVTIFCYSRFVWIMLAQPHVGAQRRRRAV
GLAVVTLLNFLVCFGPYNISHLVGFHTKESPKWRAEAVVFSSLNASLDPLLFYFSSSVVRRTFGKGLQALRNQGSLLLGRRGKETEEAANGDRGVSQTEGAPSSDFTTD*
693 >lcl|XP_003127100.1|Plus1206274..207263 NW_003534949 free fatty acid receptor 2-like LOC100517472 __SEG__ Chr6 {Sus scrofa} MAPSPRSLGLLFIYVLSFLFGLPANLLALRAFVGRVRQPHPAPIHILLLSLTLADLLLLLLLPFKVIEAAYDFRWPLGDTLCALTGYGFYSGIYCSTWLLAGISIERYRS
VAFPVQYKLSRRPLYGVIVALVSWIMSFGHCSIVIIVQYLPTNTSTGNAEGLISCYDNFTKEQLDVVLPVRLELCLVLFFIPMVVTIFCYWRFVWIILSQPHVESRKRWR
AVGLVVVTLFNFLVCFGPYNVSHVVGYFQKTSESWRACAVMLSTLNACIDPLIFYFSSSAVRKAFDKKLRKLRSWGASLLGFWRRRAGKPAAERGHGSLGTANGSFTGD*
694 >lcl|XP_003127293.1|Plus11180223..1181236 NW_003534958 c5a anaphylatoxin chemotactic receptor C5L2-like LOC100515612 __SEG__ Chr6 {Sus scrofa} MENASLSYEYGDYGEIPDVPVDCADGTCTSIDPLHAAPLLLYAAVFLVGMPGNAMVAWVTWKEARQRAGATWFLHLAMADLLCCLSLPILAVSVAHGGRWLYGAVGCRTL
PSVILLSMYTSVLLLAGLSADLCLLALRPTWWGAAQRACRVRVACGAAWTLALLLTVPSAIYRRLHQEHFPRRLECVVDYGGSTVAENSVTAIRFIFGFLGPLVIVAGCH
GALLCRAARHRWPLGIAVVVGFFICWAPYHALGLVLTMAAPHSTLLAGALRAEPLVVGLALAHSCLNPMLFLYCGRTQLRQSLPAACRWALKESQSKDESVVSKKSTSHD
FVSDVEV*
695 >lcl|XP_003127701.2|Plus1595736..596266 NW_003534984 rho guanine nucleotide exchange factor 10-like protein-like LOC100525818 __SEG__ Chr6 {Sus scrofa} MVSLNGHCGPVAFLAVATSILAPDILRSDQEEAEGPQAEEDKLDGQAHEPAPIPASHVGRELTRKKGILLQYRLRSTAHLPGPLLSVREPEPMDGSALEHSEEDGSIYEM
ADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSAPGGSGKPAPCGETDSALLIWQVPLML*
696 >lcl|XP_003127750.2|Plus1complement(117354..117902) NW_003300137 hypothetical protein LOC100521456 LOC100521456 __SEG__ Chr6 {Sus scrofa} MALSMPLNGLKEEDKEPIIELFVKVRARRRPAPPSARRPPGPRGGGVPCRFLSPGAPRSAPARRSSPGGRESLPPRPRPIVLGPPAPSRHGGRRGSRGGTGTPESQRSRP
PAAPPAARAPADAAPSSRVRVGLAAPLGPWDPGGVGPCHHHPPSATARARPHPTPELSKFTPGQGGEAWSPW*
697 >lcl|XP_003127771.1|Plus1159577..160281 NW_003534998 TMF-regulated nuclear protein 1-like LOC100511386 __SEG__ Chr6 {Sus scrofa} MPGCRISACGPGAQEGTAEPGSPPPPPREPLSSPEPPPSTPTLTPTPAQASPLPEVVPESAGSAEGQELQRWRQGASGGAGGTGPAGGAGGGPSKVAAAAAGSGGRALEL
AEARRRLLEVEGRRRLVSELESRVLQLHRVFLAAELRLAHRAESLGRLSGGVAQAELYLAAHGSRLKKGSRRGRRARPPALLASALGLGGCVPWGAGRLRRGHGPEPDSP
FRRSPPRGPASPQR*
698 >lcl|XP_003127778.1|Plus1complement(391594..392586) NW_003534998 G-protein coupled receptor 3-like LOC100512611 __SEG__ Chr6 {Sus scrofa} MMWGAGSPLAWLSAGPGNVNMSSIGSTEGPTDPDAPLPSPRAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVMHFAAVFCIGSAEMSL
VLVGLMAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDAPATCGVVYPLSKNHLVVLAVAFFMVFGIMLQLYAQICRIV
CRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAQSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
*
699 >lcl|XP_003127831.1|Plus1complement(182815..183873) NW_003300148 platelet-activating factor receptor-like LOC100523973 __SEG__ Chr6 {Sus scrofa} MTSCPLQPIRMEPNDSWRVDSEFRYTLFPIFYSIIFVLGVIANSYVLWVFARVYPSKKLNEIKIFMLNLTMADLLFLVTLPLWIIYYYHEGNWILPKFLCNLAGCFFFIN
TYCSVSFLAVITYNRFQAVTRPIKTAQATTRKRGISLSLIIWVAMVAAASYFFVLDSTNIELSKTGAGNLTRCFEHYEKGSMPVLIIHIFLVFSFFLVFLVILFCNLVII
RTLLTQSVQMQRNAEVKRRALWMVCTVLAVFIICFVPHHIVQLPWTLAELGFQSGNFHQAINDAHQITLCLLSTNCVLDPIIYCFLTKKFRKHLSEKFYSLRGSRKCSRV
TTETGTEVVVPLSQVPVNSLKK*
700 >lcl|XP_003127938.2|Plus1775306..776262 NW_003535045 kelch-like protein 14 KLHL14 __SEG__ Chr6 {Sus scrofa} MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPPLGGGVGGQDGLGAPKDPQQQQQPPQQPPQQQQPPPQEEPGTPS
SSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNF
EEMRALLDSLPPPVESELALFQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMNYHLMPFRQHCRQSLASR*
701 >lcl|XP_003128137.1|Plus1complement(211830..212828) NW_003535124 putative olfactory receptor 2B3-like LOC100521802 __SEG__ Chr6 {Sus scrofa} MQDFLLRNHSSLAEFILLGFSSNTEINVILFSVFLFLYLITLSGNGLIFTLIRMDSRLHTPMYFFLSVLSILDMGYVTTTVPQMLVHLVCKKKTISYVGCVAQMYIFLML
GITESWLFAIMAYDRYVAICHPLRYKVIMSPLLCGSMVAFCGFWGISCALIYTVSAMVLPYCGPNEINHFFCEVPAVLKLACADTSLNDRVDFILGFILLLVPLSLIVIV
YINIFTAVLRIRSSQGRLKAFSTCASHITVVTMFSVPCMVMYMRPGSEASPEEDKKLALFYNVISAFLNPIIYSLRNKDVKGAFLKATGWGNAPARSQRSMGTSSKPRTR
PT*
702 >lcl|XP_003128138.1|Plus1205238..206176 NW_003535124 olfactory receptor 2D2-like LOC100521977 __SEG__ Chr6 {Sus scrofa} MQELNQSIVTEFILLGFASDPRTDPLLFVFFLVFYLLILVSNSLLITLIHQDSHLHTPMYFFISVLSMLDVCYTTTTVPQMLVHILSRKRAISFARCVAQMYLFLLFGVT
ESWLFSIMSVDRYLAICHPLRYKVIMSHRVCLLMVGICAAYGVVGGLSYTFFAMRLPYCGPNEIDHYFCEVPAVLKLACADTSLNDLVDFLTGFNVIVVPLSLVAIVYAN
IFATIMKIRSAQGRLKAFSTCTSHIAVVTMFAAPCVVMYMSPGSDSLSNSGKKMALFYNIATAFLNPVVYSLRNKDVKRAFLKLTGQGKAPE*
703 >lcl|XP_003128139.1|Plus1194013..194960 NW_003535124 olfactory receptor 5V1-like LOC100522147 __SEG__ Chr6 {Sus scrofa} MQSLSKENRSSVSEFILLGFSTESQVRMALFTFFLLLYLITLVGNGLIVALTYLDARLHTPMYFLLSTLSLVDVSYVSTTVPQMLVNLVYPRRTISWGACVAQMFIFLVL
GIAECVLYAAMAYDRYIAICFPLRYTLLLSGPICVKMVTACCSIGIAGALIYTVFTMRLPYCGPYKINHFFCEVPAVLKLACADTSLNDRLDFILGFILLLVPLSCILAS
YICIFASILRIRSSQGRLKSFSTCASHITVVTMFYGPAMVMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSLRNKRVKRAFLKVLGDRGTAP*
704 >lcl|XP_003128144.1|Plus189405..90352 NW_003300209 olfactory receptor 2A2-like LOC100523072 __SEG__ Chr6 {Sus scrofa} MWMPPGQNQSWVSEFILRGFSCDPMSNRILFIAFLLLYLSSVLGNGLIVILICLDVNLHTPMYFFLCILSLLDVGCVTTTVPQMLVHLLAQSQTIAFAGCWLQMYVFGAL
GLTECLLFVVMAYDRYVAICYPLHYTVLLSWGLCTRLAAGTWACGFFSSLIHTFSTMRLPYCGPNVVNHYFCEGPSVRSLACTDTHLIAMVDLVISVFMVVVPLSLILAS
YISIVQAILKIKSTQARCKAFSTCASHLTVVTFFYAPATYIYMRPNSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDIKGAFFKVMGRGRVAW*
705 >lcl|XP_003128145.1|Plus1complement(146990..147937) NW_003300209 olfactory receptor 2A2-like LOC100523256 __SEG__ Chr6 {Sus scrofa} MWMPPGQNQSWVSEFILRGFSCDPMSNRILFIAFLLLYLSSVLGNGLIVILICLDVNLHTPMYFFLCILSLLDVGCVTTTVPQMLVHLLAQSQTIAFAGCWLQMYVFGTL
GLTECLLFVVMAYDRYVAICYPLRYTVLLSWGLCTRLAAGTWACGFFSSLIHTFSTMRLPYCGPNVVNHYFCEGPSVRSLACTDTHLIAMVDLVISVFMVVVPLSLILAS
YISIVQAILKIKSTQARCKAFSTCASHLTVVTFFYAPATYIYMRPNSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDIKGAFFKVMGRGRVAW*
706 >lcl|XP_003128151.1|Plus110090..11037 NW_003300209 putative olfactory receptor 2B3-like LOC100524204 __SEG__ Chr6 {Sus scrofa} MQDFPWENQSSVSEFILLGFSSDSQINAILFNIFLFLYLSTLVGNGLIVTLIHRDSRLHTPMYFFLRVLSTLDMSYVTTTVPQMLVHLVCQKKTISYAGCVAQMYIFLVL
GITEGWLFSAMAYDRYVAICYPLRYKVIMTPWLCGAMVLFCGLWGISCSLVYTVFTMRLPFCGPSEINHFFCEVPAVLKLACADTSLNDRVDFILGFILLLIPLSFILAS
YFRIFATILRIRSAQGRLKAFSTCASHITVVTMFCGPAMFMYMNPGANASPERDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKLTGWGSTPE*
707 >lcl|XP_003128154.1|Plus1169948..170502 NW_003535127 cbp/p300-interacting transactivator 4-like LOC100525468 __SEG__ Chr6 {Sus scrofa} MADHLLLAEGYRLVPRPPPPAPAQGPHVLRTLQPYSGPGLDSGLRPRGTPLGPPPPPPPGALTYGAFGPPPPTFQSFPAVPPPPAASGAHLQPVATLYPSRATAPPGAPG
GPPGPQPAPGAPAPPPPPPAHALGCMDAELIDEEALTSLELELGLHRVRELPELFLGQSESTALGLGSAPPLAR*
708 >lcl|XP_003128202.1|Plus1complement(180330..181391) NW_003300217 putative protein phosphatase 1 regulatory inhibitor subunit 3G-like LOC100522260 __SEG__ Chr7 {Sus scrofa} MEPRGMELLSLEALGPVPFEDTPPAGEPPAPGVLSTDGGGDGGGTSKVPNPDAEPPFLQEEAALREQEELLESRRRRRARSFSLPADPILQAAKFLQQQPPPAPGTGSEG
SERAEGALRSPGSCCAKCKKRVQFADALGLSLASVKHFSETEEPQVPPAVLSRFRSFPARAEDLEQLPSLLAAAAAAAPLPAPPPRLQPLFELPEPSAVAERLRRQRVCL
ERVHCSEPGGVEVTGSGRVLGCPGPRAVAVRYTFTEWRSFLDVPAELRPEPGEPPPLAPSRGPGDAEDEPGAERFHFALCLPPGLLPKEGEDADAPGVAVHFAVCYRCAQ
GEYWDNNAGANYTLRYVRPADAL*
709 >lcl|XP_003128261.2|Plus1132240..133184 NW_003535165 olfactory receptor 2G6-like LOC100511138 __SEG__ Chr7 {Sus scrofa} MERANDSTFSGFILLGFSSRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCLTTCTVPQTVANFKGKDKSITYGGCVTQLFLALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGSSIVQTALTMTLPLCGKNQVDHFFCEVPAMLKLACTNTSINEAELFAVSVLFLVVPLSLILVSYGH
ITHAVLKLKSAQGRHKAFGTCGSHSMVVSVFFGTLISMYLQLPSSYSQDVNKSMALFYTLVTPLLNPLSYTLRNKEVKGALRRLVRRTPDSRQS*
710 >lcl|XP_003128262.1|Plus1complement(152056..153000) NW_003535164 olfactory receptor 2G6-like LOC100511332 __SEG__ Chr7 {Sus scrofa} MERANDSTFSGFILLGFSNRPQLETALSVLILIIYFLSFLGNGTIILLSLVDSHLHTPMYFFLSNLSFMDLCLTTCTVPQTVANFKGKDKSITYGGCVTQLFIALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMLIMHPQLCSQLVATAWLTGFGNSVVQTALTMTLPLCGKNQVDHFFCEVPAMLKLACTNTSINEAELFAVSVLFLVVPLSLILVSYGH
ITHAVLKIKSAQGRRKAFGTCGSHSMVVIVFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLLNPLIYTLRNNEVKGALRRLVRRTPDSRQS*
711 >lcl|XP_003128270.1|Plus1complement(238172..239113) NW_003535164 olfactory receptor 2B6-like LOC100514657 __SEG__ Chr7 {Sus scrofa} MNGINESIPLEFILLGFSERPWLEFPLFVVFFISYIVTIFGNLTIILVSRLDSRLHTPMYFFLTNLSLLDLCYTTSTVPQMLVNLYSARKVISYGGCVAQLFMFLALGAT
ECVLLAVMSFDRFVAICRPLHYSVIMHQRSCLQLAAASWITGFSNSVWLSTLTLQLPLCGPYILDHFLCEVPALLKLSCVDTRANEAELFFVSVLFHLVPLTLIFISYAF
IAQSVLRIQSAEGRQKALGTCGSHLIVVSLFYGTAISMYLQSPSHNSKDQGKMVSLFYGIIAPMLNPLIYTLRNKEVKEAFKRLVARVFSIKK*
712 >lcl|XP_003128271.1|Plus1179075..180013 NW_003535165 putative olfactory receptor 2B8-like LOC100515036 __SEG__ Chr7 {Sus scrofa} MEQRNGSSFTGFILLGFSDRPQLEQVLFVVLLIFYVFTLLANTAIIALSHADPHLHSPMYFFLSNLSFVDLCYTTSIVPQLLVNLRGSDKSISFGGCVVQLYISLGLGGT
ECILLGVMALDRYAAVCKPLHYTVIMHPCLCALMACASWITGFANSVLQTVLIFLLPLCGRNELDHFFCEVPPLLKLACVDTTVNESEIFFVSVITLFIPVAVIMFSYSQ
IVRAVLRIKSSAGQRKAFGTCGSHLTVVSLFYGSALYAYLHPSSNDSQDQGKFISLFYTIITPMINPLIYTLRNKEVKGAMRRVLWKDSVSR*
713 >lcl|XP_003128273.1|Plus1complement(249913..250854) NW_003535164 putative olfactory receptor 2W6-like LOC100516618 __SEG__ Chr7 {Sus scrofa} MEKDNTSSFEGFILVGFSDRPHLELILFVVVLTFYLLTLFGNMTIILLSVLDSRLHTPMYFFLSNLSFLDMCFTTGSIPQMLYNLWGPDKTISYLGCAIQLYFVLALGGV
ECVLLAVMAYDRYVAVCKPLHYTVIMHPCLCGKLASVAWLSGFGNSLIMAPQTLMLPRCGHRQVDHFLCEMPALIGMACVDTMTLEALAFALAIFIILAPLILILISYGY
IAQAVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYTIVTPSVNPLIYTLRNKDVKEAMKKVLGKGGAKAQ*
714 >lcl|XP_003128274.1|Plus1complement(192790..193710) NW_003535164 olfactory receptor 2W3-like LOC100516810 __SEG__ Chr7 {Sus scrofa} MTNQSCQEHFILLGFSDRPRLEQILFVFVLIFYLVTLVGNSVIILVSCLDPCLQTPMYFFLTNLSFLDLCFTTSSIPQLLFNLGSPDKTISYMGCAIQLFMFLGLGGTEC
VLLAVMAYDRFTAICKPLHYSILMHPQLCWTLVSVAWEVGLLNSLVMSPVTMKLPRCGRCRVKHFLCEMPALIKISCVDTVAVESTVFILSVIIVLVPLLFILISYSNIA
LAVLRIKSAAGRRKAFNTCGSHLTVVSLFYGNIIYMYMQPGNNSSQDQGKFLTLFYNLVTPMLNPVIYTLRNRDVKGALKRLVSRK*
715 >lcl|XP_003128281.1|Plus1complement(156170..157114) NW_003300225 olfactory receptor 2B11-like LOC100522686 __SEG__ Chr7 {Sus scrofa} MKHMNESFPKDFILMGFTKYPWLDLPLFFALLISYMFTLLGNIAIILVSQLDFQLQSPMYFFLMSLSFLDLCFTTTTVPQMLVNLGGPNKNITYIGCMIQAYVFHWLGCT
ECVLLGIMALDRYVAVCKPLRYSVIMNHKLCRQLSSTAWFIGLANSLLQSTLTIQLPLCGNQELDHFFCELPGLIKMACVDTTVNELTLSVVATFLIMGPLSMILTSYSY
IAQAVFRIPSADGRHKAFNTCSSHLLVVSLFYGPGIYIYMQPSGDSPQDLIKVLTLFYCVITPMANPFIYTLRNKDVKGALRRLLRRVFLFKRI*
716 >lcl|XP_003128288.2|Plus1complement(149610..150572) NW_003535166 olfactory receptor 2W1-like LOC100525053 __SEG__ Chr7 {Sus scrofa} MGQRNSTSLHDFILLGFSDHPKLEMALSGVVATFYLITLVSNTAIILASLLDSHLHTPMYFFLRNLSFLDLCFTTSIVPQMLVNLWGPHKTISYGGCVIQLYVYMWLGSI
ECLLLAVMSYDRFTAICKPLHYLVIMNPHLCLKMIIMVWSISLANSVVLCTLTLNLPRCGNNLLDHFLCELPAMLKVACIDTTAVELSVFALGIAIVLTPLILILISYGY
IAKAVLRMKSRAGQRKAINTCGSHLTVVSIFYGTIIYMYLQPGNSASKDQGKFLTLFYTIITPSLNPLIYTLRNKDMKEALKKLMTVDHKFTKSKRNWKS*
717 >lcl|XP_003128295.1|Plus1complement(289402..290328) NW_003535167 olfactory receptor 12D2-like LOC100515554 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLPIYLVIMAGNGAILMVVISEPRLHPPMYFFLGNLSCLDICYSTVTLPKMLGNFLSSHKEISFWGCISQLHFFHFLGSTEA
LLLAVMAFDRFVAICKPLRYTLIMNPRVCAQMAVTVWITGFLYALLQSVMTSRLYFCGSNYIHHFFCDIKPLLKLACGNIELNQWLLSIVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKGALRRVIRRRL*
718 >lcl|XP_003128300.1|Plus1complement(137194..138132) NW_003535167 olfactory receptor 14J1-like LOC100518077 __SEG__ Chr7 {Sus scrofa} MANFTAVSGFLLMGFSAKPELEALWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSSISLWECILQCLAFILCGSAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVVSGVMHTSATFSIHFCGANVIHQFFCEVPQLLKLACSDEYVSELGVTGFVSLVAFLCFLSIGFSYTRIF
STVLRIPSAEGRAKAFATCLPHLAVVTLFLSTGAFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKAMKAALQKFVKKRKAYLFC*
719 >lcl|XP_003128301.1|Plus1151211..152137 NW_003535167 olfactory receptor 12D2-like LOC100518258 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPRMLGNFLSSHKAISFWGCISQLHFFHFLGSTEG
LLLAVMAFDRFVAICKPLRYTLIMNPQICAQMAVTVWIIGFLYALMHSIMTSRLHFCGSNYIHHFFCDIKPLLKLACGNIELNQWLLNTVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKEVKGALSKLVKRRF*
720 >lcl|XP_003128302.1|Plus1complement(254672..255610) NW_003535167 olfactory receptor 14J1-like LOC100518434 __SEG__ Chr7 {Sus scrofa} MANFTTVSGFLLMGFSAKPELEVLWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSNISLWECILQCLAFVLCASAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVISGVMHTSATFSIHFCGANVIHQFFCEVPQLLKLACSNEYVRELGVTGFVSLVAFLCFLSIGFSYTRIF
STVLRIPSAEGRAKAFATCLPHLAVVTLFLSTGVFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKATKAALQRVVKRRKAYLFC*
721 >lcl|XP_003128303.1|Plus1complement(276036..276983) NW_003535167 olfactory receptor 14J1-like LOC100518792 __SEG__ Chr7 {Sus scrofa} MANFTTVRGFLLMGFSAKPELEVLWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSSISLWECILQCLAFTLCASAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVVSGVMHTSATFSIHFCGANVIHQFFCEVPQLLKLACSDEYVSELGVTGFLSLVAFLCFLSIGFSYTRIF
STVLRMPSAEGRAKVFATCLPHLAVVTLFLSTGVFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKAMKAALQKVVKRRKATSFAESL*
722 >lcl|XP_003128304.1|Plus1complement(54658..55584) NW_003535168 olfactory receptor 12D2-like LOC100519492 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLTIYLVIMAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKMLGNFLSSHKEISFWGCISQLHFFHFLGSTEA
LLLAVMAFDRFVAICKPLRYTLIMNPWVCAQMAVTVWITGFLYALLHSVMTSRLYFCGSNYIHHFFCDIKPLLKLACGNIELNQWLLSIVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKGALRRVIRRRL*
723 >lcl|XP_003128305.2|Plus1342546..343505 NW_003535167 olfactory receptor 6Q1-like LOC100522149 __SEG__ Chr7 {Sus scrofa} MERANSTLVTQFVFVRFSNSPRLQLLFFHLFLLVYLLSLVGNALIVLIVALDGHLHTPMYFFICNLSSVELWYTTVTVPKMLANFLSSPGVISVPNCITQYYFFFSLAAT
ELFILTTMAFDRYAAICRPLHYPLLLSPQTCGILAGVCWFMGFLCPMFPSFLLAKTSFCTPNQINHFFCDADQIFRLSCTDTYAIQAVGYAFSTVIILGTLVFTMASYAQ
ILATILGMASAAARRKTFSTCTAHLSVVTIYFGTLIFMYVRPAVKYESNINKIVAIFYSVITPLLNPLIYTLRNKDVKEALKVLVSRMQKFCCPSKETK*
724 >lcl|XP_003128309.1|Plus1complement(29123..30049) NW_003535168 olfactory receptor 12D2-like LOC100524504 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIMAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKMLKNFLSSHKAISFWGCISQLHFFHFLGSTEA
LLLAVMAFDRFVAICKPLCYTLIMNPRVCTQMAVTVWIIGFFHALLHSVMTFHLNFCGSNYIHHFFCDIKSLLKLACGNIELNQWLLNTVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKVALNWVIRRRF*
725 >lcl|XP_003128310.1|Plus1191967..192902 NW_003535169 olfactory receptor 2G3-like LOC100154493 __SEG__ Chr7 {Sus scrofa} MGTNSSTVEDNIILVGFSDQPSLEKILFGVVLASYLLTLVGNTVIILIASIDPNLKTPMYFFLTHLSLVDICFTTSIVPQLLWNLRGPAKTITALGCAVQLYVSLALGST
ECVLLAVMAFDRHAAVCKPLHYAAVMNPRLCQALAGVAWLSGVGNTVIQSTVTLWLPRCGHRRLHHFFCEVPSMIKLACVDIHTNEVQLFIASLVLLLLPLALILTSYGH
IVKAVTRIKSVQAWRKALGTCGSHVMVVSLFYGTITAVYIQPNSSYAHTSGKFISLIYTVLTPTLNPLIYTLRNKDVKGAMRRLLHRDLGS*
726 >lcl|XP_003128311.1|Plus1256392..257339 NW_003535169 olfactory receptor 2W1-like LOC100512543 __SEG__ Chr7 {Sus scrofa} MINDSYFGGFILLGFPGQPQLEMIISGVVFFFYTIALMGNIAIIALPLLDERLQTPMYFFLRSLAILDLCYTSNIVPQMLVNVWGKDKKISFGGCASQLFIDVTLCTVEC
MLLAVMSYDRFNAVCKPLHYMTIMNPQLCGGLVAMTWVIGIINCMILSPYAMSLPRCGNHHLDHYFCEISAMVKIACVDTTAMEETVFALCFFIFLTPLLLVLVSYGFIA
VAVLKIKSATGRQKAFGTCSSHLIVVSIFYGTVIYMYIQPGNSPNQDEGKLLSVFYSIVTPSLNPLIYTLRNKEFRGAMKRLIGKEKDSGETIGH*
727 >lcl|XP_003128312.1|Plus1complement(95938..96879) NW_003300228 putative olfactory receptor 2B3-like LOC100514059 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILEPKLHTPMYFFLTNLSILDLCYTTSTVPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNPWFCFKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKLIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTGIYMYLQPPSSTSKDWGKMVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRMMSIIFFYKK*
728 >lcl|XP_003128313.1|Plus153509..54471 NW_003300229 olfactory receptor 10C1 LOC396796 __SEG__ Chr7 {Sus scrofa} MTFNCSLWQDNSMSVKRFAFARFSEVTEQCFLLFTLILLMFLASLTGNALIATAIWTNPVLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
AFFGISECCLLAAMAFDRYMAICSPLHYATRMSRGVCDHLAMVSWGVGCMAALGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFVAATLCISSPFLLI
IASYGRILAAVLSMPSPEGRRKALSTCSSHLLVVTLFYGSASVTYLRPKASHSPGIDKLLALSYTVVTSMLNPIIYSLRNKDVKAALRRTLGKKKVLAHR*
729 >lcl|XP_003128314.1|Plus1124189..125130 NW_003300229 putative olfactory receptor 2B3-like LOC100516917 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNPWFCFKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTGIYMYLQPPSSTSKDWGKMVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRMMSIIFFYKK*
730 >lcl|XP_003128315.1|Plus1172459..173421 NW_003300229 olfactory receptor 10C1-like LOC100517103 __SEG__ Chr7 {Sus scrofa} MTFNCSLWQDNSMSVKRFAFARFSEVTEQCFLLFTLILLMFLASLAGNALIATAIWTNPVLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
AFFGISECCLLAAMAFDRYMAICSPLHYATRMSRGVCVHLAMVSWGVGCMVALGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFAVAILCISSPFLLI
IASYGRILAAVLSMPSPEGRRKALSTCSSHLLVVTLFYGSGSVTYLRHKASHSPGIDKLLALFYTVVTSMLNPIIYSLRNKEVKAALRRTLGKKKVLTHR*
731 >lcl|XP_003128316.1|Plus196427..97389 NW_003300229 olfactory receptor 2W1-like LOC100517661 __SEG__ Chr7 {Sus scrofa} MGQRNSTSLHDFILLGFSDHPKLEMALSGVVATFYLITLVGNTAIILASLLDSHLHTPMYFFLRNLSFLDLCFTTSIVPQMLVNLWGPHKTISYGGCVIQLYVYMWLGSI
ECLLLAVMSYDRFTAICKPLHYLVIMNPHLCLKMIIMVWSISLANSVVLCTLTLNLPRCGNNLLDHFLCELPAMLKIACIDTTAVELSVFALGIAIVLTPLILILISYGY
IAKAVLRMKSRAGQRKAINTCGSHLTVVSIFYGAIIYMYLQPGNNASRGQVIFLTLFYTIITPSLNPLIYTLRNKDMKEALKKLMRVDHKSTKSKRTWKS*
732 >lcl|XP_003128317.1|Plus1137041..138009 NW_003300229 putative olfactory receptor 2B3-like LOC100517832 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNPWFCFKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTSIYMYLQPPSSTSKDWGKIVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRLELLTFSIRNKCSIVTTIF*
733 >lcl|XP_003128319.1|Plus1complement(159889..160812) NW_003300229 olfactory receptor 2J3-like LOC100518201 __SEG__ Chr7 {Sus scrofa} MMEKINATLEGYFVLLGFSNWPHLEVILFVVILMFYLMTLIGNLFIIILSYVDAHLHTPMYFFLSNLSFLDLCYTTSSIPQLLINLWGPEKKISYNGCMTQLYFVLALGS
TECVLLVVMSYDRYAAVCRPLHYTVLMPPRFCHLLAVASWVSGFTNSALHSFLTFWVPLCGHRQVDHFLCEVPALLRLSCIDTHANKLTLMITSSIFVLIPLILILSSYG
AIARAVLRMQSTTGLQKVFGTCGAHLMVVSLFFIPVMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVRRLMG*
734 >lcl|XP_003128320.1|Plus1187067..188005 NW_003300229 olfactory receptor 2B11-like LOC100518380 __SEG__ Chr7 {Sus scrofa} MERINKSHPEEFILLGFADRPWLELPLFIILLLTYPMAMVGNRAIILVSTLDSRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFHLGRLKKTISYLGCAIQLYFFHIMGGT
ECLLLAIMSFDRYVAICKPLHYTLIMNRCTCILLVATVWLGGITYAVSEATVTLHLPLCGHNTLDHLACEVPVLIKAACGEKGSNELTLSVVCIFMLAVPLCFILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVFFFYGPAISMYLQPPSSISRDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGAWGNLVRSVFTSK*
735 >lcl|XP_003128322.1|Plus1complement(89848..90786) NW_003300230 olfactory receptor 2B11-like LOC100519261 __SEG__ Chr7 {Sus scrofa} MERINKSHPEEFILLGFADRPWLELPLFIILLLTYPMAMVGNRAIILVSTLDSRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFHLGRLKKTISYLGCAIQLYFFHIMGGT
ECLLLAIMSFDRYVAICKPLHYTLIMNRCTCILLVATVWLGGITYAVSEATVTLHLPLCGHNTLDHLACEVPVLIKAACGEKGSNELTLSVVCIFMLAVPLCFILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVFFFYGPAISMYLQPPSSISRDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGAWGNLVRSVFTSK*
736 >lcl|XP_003128323.1|Plus1complement(104432..105394) NW_003300230 olfactory receptor 10C1 LOC396795 __SEG__ Chr7 {Sus scrofa} MTFNCSLWQDNSMSVKRFAFARFSEVTEQCFLLFTLILLMFLASLAGNALIATAIWTNPVLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
AFFGISECCLLAAMAFDRYMAICSPLHYATRMSRGVCVHLAMVSWGVGCMVALGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFAVAILCISSPFLLI
IASYGRILAAVLSMPSPEGRRKALSTCSSHLLVVTLFYGSGSVTYLRHKASHSPGIDKLLALFYTVVTSMLNPIIYSLRNKEVKAALRRTLGKKKVLTHR*
737 >lcl|XP_003128324.1|Plus1complement(152724..153665) NW_003300230 putative olfactory receptor 2B3-like LOC100519609 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNPWFCFKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTGIYMYLQPPSSTSKDWGKMVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRMMSIIFFYKK*
738 >lcl|XP_003128325.1|Plus139289..40251 NW_003300230 olfactory receptor 10C1-like LOC100519962 __SEG__ Chr7 {Sus scrofa} MTFNCSLWQDNSMSVKRFAFARFSEVTEQCFLLFTLILLMFLASLMGNALIATAIWTNPVLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
AFFGISECCLLAAMAFDRYMAICSPLHYATRMSRGVCVHLAMVSWGVGCMVGLGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFVAATLCISSPFLLI
IASYGRILAAVLSIPSPEGRRKALSTCSSHLLVVTLFYGSASVTYLRPKASHSPGIDKLLALSYTMVTSMLNPIIYSLRNKEVKVALRRTVGKKKVLAHR*
739 >lcl|XP_003128330.1|Plus1117041..117964 NW_003300230 olfactory receptor 2J3-like LOC100521562 __SEG__ Chr7 {Sus scrofa} MMEKINATLEGYFVLLGFSNWPHLEVILFVVILMFYLMTLIGNLFIIILSYVDAHLHTPMYFFLSNLSFLDLCYTTSSIPQLLINLWGPEKKISYNGCMTQLYFVLALGS
TECVLLVVMSYDRYAAVCRPLHYTVLMPPRFCHLLAVASWVSGFTNSALHSFLTFWVPLCGHRQVDHFLCEVPALLRLSCIDTHANKLTLMITSSIFVLIPLILILSSYG
AIARAVLRMQSTTGLQKVFGTCGAHLMVVSLFFIPVMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVRRLMG*
740 >lcl|XP_003128332.1|Plus1complement(139844..140812) NW_003300230 putative olfactory receptor 2B3-like LOC100521906 __SEG__ Chr7 {Sus scrofa} MNRANESSSKEFILLGFSDKPWLQTPLLVLLLASYATTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLKNICQNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNPWFCFKMTAFSWLTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVSELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRRKAFGTCGSHMVVVSLFFGTSIYMYLQPPSSTSKDWGKIVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRLELLTFSIRNKCSIVTTIF*
741 >lcl|XP_003128333.1|Plus1complement(180540..181502) NW_003300230 olfactory receptor 2W1-like LOC100522084 __SEG__ Chr7 {Sus scrofa} MGQRNSTSLHDFILLGFSDHPKLEMALSGVVATFYLITLVGNTAIILASLLDSHLHTPMYFFLRNLSFLDLCFTTSIVPQMLVNLWGPHKTISYGGCVIQLYVYMWLGSI
ECLLLAVMSYDRFTAICKPLHYLVIMNPHLCLKMIIMVWSISLANSVVLCTLTLNLPRCGNNLLDHFLCELPAMLKIACIDTTAVELSVFALGIAIVLTPLILILISYGY
IAKAVLRMKSRAGQRKAINTCGSHLTVVSIFYGAIIYMYLQPGNNASRGQVIFLTLFYTIITPSLNPLIYTLRNKDMKEALKKLMRVDHKSTKSKRTWKS*
742 >lcl|XP_003128391.1|Plus12286046..2287452 NW_003535175 zinc finger and BTB domain-containing protein 9-like LOC100525704 __SEG__ Chr7 {Sus scrofa} MAASTPVPPGAPSPACNPAPRTIQIEFPQHSSLLLEALNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRL
PLDALPAHLLVASGLQMWQVVDQCSEILKELENSGGGLSARAATPFHALLSTTASPGGWCIRSSSFQTPAQASASTESPVVGDGSELGEVLQIQVEEEEEEEEEEEEEGQ
RSAASSQTPQPPRASGSFPRPPGSHTLPTSSTPRRLPEGDSALLEPPAPHTALPPKIFYIKQEPFEPKEEIVGGGTQSGGSKEETGVLPAGDVEGNGELGFLLPSGAGST
SGGGGPSWKPVDLHGNEILSGGAGPGGAGQAVHGPVKLGGAPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGVCNKRFKLKHHLTEHMKTHAGALHACPHCGR
RFRVHACFLRHRDLCKGQGWATAHWTYK*
743 >lcl|XP_003128544.1|Plus1complement(142219..143565) NW_003535207 immunoglobulin superfamily containing leucine-rich repeat protein-like isoform 2 LOC100152082 __SEG__ Chr7 {Sus scrofa} MPPAGPQGHVGGMSFSAGVRMQELCLLCWVVLVGLVQACPKPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPSLPEGAFREVLLLQSLWLAHNEIRTVA
AGALAPLGHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFEPLTALSHLQINDNPFDCTCSIMWFKTWALTTAV
SIPEQDNITCTSPHVLKGTRLNRLLPLPCSAPSVQLTYQPSQDGAELQPGFVLALHCDVDGQPAPQLHWHIQTPRGTVEIASPNVGADGRALPGALAASARPRFQAFANG
SLLIPDFGKLEEGTYSCLATNELGSAESSVNVALATPGEGGEDALGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRTGGPEAAATGEGVSAQQPPGLLLLGQSI
LLLVLTFF*
744 >lcl|XP_003128619.1|Plus135243..36199 NW_003535235 olfactory receptor 4E1-like LOC100526116 __SEG__ Chr7 {Sus scrofa} MEEAVLFNQTTLVMYFRLRDLSANQNVQMASFAMFLIFYVLTLIGNILIVITIIYDRRLHTPMYFFLSNLSFIDVCHSTVTVPKMLIDTWSEEKLIFFDACVTQMFFLHL
FACTEIFLLTVMAYDRYVAICNPLKYMAVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDNFFCDVPQVIKLACTDTYIIEILIISNSGLISVVCFVVLVV
SYAVILVSLRQQISEGRRKALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKVVSVFFTAVTPLLNPIIYTLRNEDMKNALNKLMGKIEGREKNDNN*
745 >lcl|XP_003128620.1|Plus1complement(45984..46925) NW_003535235 olfactory receptor 4E2-like LOC100510915 __SEG__ Chr7 {Sus scrofa} MDALNQTRVTEFVFLGLTDNWVLEILLFMAFSVMYVLTLLGNVLIMATIVFTPRLHTPMYFFLSNLSFIDICHSSVTMPKMLEGLLSERKTISFDNCIAQLFFLHLFACA
EIFLLTIMAYDRYVAICAPLHYPNVINMKVCVQLVFALWLGGTVHSLVQTFLTIRLPYCGPNVIDSYFCDVPPVITLACTDTHLTGMLIVSNSGTISLVCFLALVTSYMV
ILVSLRRQSAEGRRKALSTCSAHLMVVALFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPVLNPLIYTLRNEEVKIAMKHLRQGQVFFMKSCT*
746 >lcl|XP_003128626.1|Plus1251101..252042 NW_003535235 olfactory receptor 10G3-like LOC100512910 __SEG__ Chr7 {Sus scrofa} MERVNSTLLTEFFLTGIPYPPQLRTFLFVFFLLIYVLTQLGNLLILITVWVDPQLHARPMYIFLGVLSIIDMGISSIIVPRLMMNFTLDIKPIPFAGCVAQLYFYHFLGS
TQCFLYTLMAYDRYLAICQPLRYPVLMNAKLSSLLVAGAWVAGSLHGALQAILTFRLPYCGPNQVNYFFCDIPAVLRLACADTTVNELVTFVDIGVVVASCFSLILLSYV
QIIQAILRIRTADGRRRAFSTCGAHVIVVTVYYVPCAFIYLRPETNSPLDGAAALFPTAITPFLNPLIYTLRNQEVKLALKRMIGGPRTKSEV*
747 >lcl|XP_003128631.2|Plus1complement(15225..16163) NW_003535312 olfactory receptor 4F6-like LOC100516208 __SEG__ Chr7 {Sus scrofa} MYKTNYSLVSEFIFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFEPHLHSPMHFLLANLSFIDLCFSTLTVPKTLSDLCSACKTISFQGCVFQIFVLHILGGS
EMLLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGTWAIGLLHAVVQLAFVVHLPFCGPNEINSFYCDLPRFIKLACIDTYRMEFMVTANSGFISMGAFFLLIVSYVF
ILVTVWKRSSGGLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMRMAVRRLSSQLLSWQKIS*
748 >lcl|XP_003128632.1|Plus1complement(238120..239058) NW_003535238 olfactory receptor 4F6-like LOC100517104 __SEG__ Chr7 {Sus scrofa} MHKANYSSVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFDPHLHSPMYFLLANLSFIDLCFSTLTVPKTLSDLCSGRKTISFQGCVFQIFVLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGAWAIGLIHAVVQVAFVVHLPFCGPNEIDSFYCDLPRFIKLACIDTYRMEFMVTANSGFISMGAFFLLIVSYVF
ILVTVWKRSSGSLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMKMAVRRLSSQLLSWQKIS*
749 >lcl|XP_003128635.2|Plus1233581..234540 NW_003535235 olfactory receptor 10G2-like LOC100518203 __SEG__ Chr7 {Sus scrofa} MGKTRNTSLDTVVTDFILLGLSHPPSLRTLLFLVFFTIYILTQLGNLLILLTVRADPKLHARPMYMLLGVLSFLDMWLSSVIVPRLILNFTPASKAIPFGGCVAQLYFFH
FLGSTQCFLYTLMAYDRYLAICQPLRYPMLMNGRLCTFLVAGAWVAGSIHGSIEATLTFRLPYCGPNQVDYFFCDIPAVLRLACADTSVNELVTFVDIGVVAASCFLLIL
LSYANIVHAILRIRTADGRRRAFSTCGSHLTVVTVYYVPCIFIYLRAGSKSPLDGAVAVFYTVVTPLLNPLIYTLRNQEVKSALGRIAAGRGGGGENNK*
750 >lcl|XP_003128641.1|Plus1complement(149431..150402) NW_003535238 olfactory receptor 4K3-like LOC100524094 __SEG__ Chr7 {Sus scrofa} MDPVNNSRVAEFVLLGLSSSWELQYFFFMLFNLLYVTIVLGNLLIVLTVISEPALHTPMYIMLSNLSVLDVFLATYATPKMIHDFLYEPKTISFEGCMAQIFLLHVFAGG
EMMLLAAMAYDRYVAICKPLHYATIMNLCKCTGLVVGSWVIGVMHALSQLAFTVNLSFCGPNIVDSYYCDLTLVIKLACTDPYVPEVLMLLDSGLMGVTSFVLLLISYAV
ILVTVRQRSSVHMAKARSTLTAHIIVVTLFFGPCIFIYAWPFSNFPVDKVLSVFSTVFTPILNPIIYTLRNKEVKSAMYKLKTKYVNSRLLSQLSLSRLDLLS*
751 >lcl|XP_003128642.1|Plus1199959..200897 NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100512292 __SEG__ Chr7 {Sus scrofa} MDGANHSMVSEFVFLGITNSWEIQLLLFLFSSVFYVASMMGNSLILLTVTSDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHKVISFSGCITQIFFIHIIGGV
EMVLLIAMSFDRYVAICKPLHYLTVMSPRMCILFLVTAWIIGLIHSLVQLAFVVKLPFCGPNVLDSFYCDFPRFIKLACTDTYRLEFMVTANSGFISLGSFFILIISYIF
ILITVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFVYMWPHPTSHLDKFLAVFDAVLTPFLNSVIYTLRNKEMKMAMRKVFSQIFIYRRIL*
752 >lcl|XP_003128643.1|Plus1223369..224307 NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100512477 __SEG__ Chr7 {Sus scrofa} MEGANQSVVSEFVFLGITNSWEIQLLLLVFSSMFYMASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKCKVISFTGCIAQIFFIHVIGGV
EMVLLIAMAFDRYVAICKPLHYLTIMSPRLCISFLVAAWMTGLIHSMVQLAFVVNLPFCGPNVLDSFYCDLPQFIKLACIDADQLEFMVMANSGFISVGSFFILIISYIV
IILTVKKQSSLRSSKALSTLSAHITVVILFFGPLIFVYTWPSLSTPLDKFLAIFDAVLTPFLNSVIYTFRNQEMKVAMRRVCRQLMSYRKIS*
753 >lcl|XP_003128644.1|Plus1248651..249589 NW_003535240 olfactory receptor 4F3/4F16/4F29-like LOC100156302 __SEG__ Chr7 {Sus scrofa} MDGINHTVVSDFVFLGLTNSLEIQLLLCVFTSTLYMPSMMGNSLIMLTVTSDPHFHSPMYFLLANLFFLDLGAASVTSPKMVYDLFRKRKVISFSGCIVQIFFIHVIGGV
EGVVLLAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGPNVLDSFYCDLPRLLKLACTDTYQLESMVMANSGFISVGFFFVVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWSSPSIPLDKFLAIFDAVLTPFLNPVIYTFRNQEMKVAMKRICKQLVNYRKMS*
754 >lcl|XP_003128645.1|Plus1130903..131805 NW_003299465 olfactory receptor 4L1-like LOC100513411 __SEG__ Chr2 {Sus scrofa} MDLKNGSVVTEFILVGFSVGWELQFVFLVTFSLIYGATVLGNVLIMVTVTFSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMIRDLLTEHKVISMWGCMAQMFFMHCFGGA
EATLLVAMAFDRYVAICKPLHYRTIMSHKLLKGFVILSWTIGFIHTMSQMVLTVNLPFCGPHIIDNIFCDLPLVIKLACMDTYTLELFVIADSGLLSFICFLLLLVSYTV
ILVTVQQRSSGGLSKALSTLSAHITVVTLFFGPCIFIYAWPFSSFAGNKILSVFYTVITPLLNPIIYTLRNEKMQEAMRK*
755 >lcl|XP_003128646.2|Plus1complement(172462..173394) NW_003299465 olfactory receptor 4K14-like LOC100513603 __SEG__ Chr2 {Sus scrofa} MDLQNYSLVSEFVLHGLSNSQHLQKFFFIFFSGIYVAMVLGNLIIVVTVISDPHLYSSPMYFLLGNLSFLDIWLASFATPKMIRDFLSDRKLISFGGCMAQIFFLHFVGG
AEMVLLVTMAYDRYVAICKPLHYMTMMNRQTCIRLVSVSWVIGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACVDTYVLGILMISDSGLLSMSCFLLLLISYT
VILITVQQQAAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFSWFSVDKVLSVFYTIFTPLLNPLIYTLRNKDMKIAMKRLRNRHVTFH*
756 >lcl|XP_003128647.1|Plus1complement(36013..36939) NW_003299465 olfactory receptor 4K3-like LOC100513800 __SEG__ Chr2 {Sus scrofa} MDQENKSGVTEFVLHGLSGPRELQLFYFAFFTLLYLSIVLGNLLIVLTIISEPALHTPMYFLLSNLSFIDVCLSTFATPKMIVDFLEEHRTISFEGCMAQIFFLHVFAGG
EMMLLVAMAYDRYVAICRPLHYATIMSERRCTSLVVGSWLIGILHSVSQLVFTVNLPFCGPNQVDSFFCDLPLVIKLACTDTFTLEVLMLSDSGLIAMSSFVLLLVSYMV
ILVTVQRRSSAGMAKARATLTAHITVVTLFFGPCIFIYAWPFNNLPVDKVLSIFYTVFTPLLNPLIYTLRNKEVISAMQKLRHREVSS*
757 >lcl|XP_003128649.1|Plus159685..60623 NW_003535239 olfactory receptor 4F15-like LOC100514909 __SEG__ Chr7 {Sus scrofa} MDVRNHSIVSEFVFLRFTNSWEIQLLLFVFSFLFYSSSMMGNLVIVFTVTLDSHLHSPMYFLLANLPAIDMVFCSITAPKMIGNIFKKHKAISFCGCITQIFFTHAAGGT
EMVLLIAMAFDRYVAKCRPHHYLTIINPRICLCFLVTSWIIGLIHSMAQLFFVVDLPFRDLNVLDSFYCDLSRLLKLACTDTQELQFMVTVNSGLLSMGSFVLLIISYIF
ILFTIWKHASGGSSKALSTLSAHITMVVLYFGPLIFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTLRNKEMKVAMRRLFSHLVHYRNIS*
758 >lcl|XP_003128650.1|Plus1167950..168903 NW_003535239 olfactory receptor 4F21-like LOC100515784 __SEG__ Chr7 {Sus scrofa} MSTKPKEGENNSVVSEFVFLGITNSWEIQLLLFVFTSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKRKVISFSGCITQIFFIH
VIGGVEMVLLIAMAFDRYVAICKPLHYLTIMSPRLCIFLLVAAWIIGLVHSTVQLASVVNLPFCGPNVLDSFYCDLPRFIKLACVDTDQLEFMVTANSGLISVGSFFILI
ISYIVIILTVKKQCSVGSSKALSTLSAHITVVILFFGPLIFVYTWPSLYTPLDKFLAIFDAVLTPFLNSVIYTFRNQEMKVAMKRVCRQLMSYRKIS*
759 >lcl|XP_003128651.1|Plus1complement(384262..385200) NW_003535240 olfactory receptor 4K3-like LOC100518317 __SEG__ Chr7 {Sus scrofa} MDTGNLSIVSEFVLLGLCQSWTMQVLLLLIFSILFLIIVSGNIAIMILITIDTHLHYPMYFLLANLSFVDMWLCLITTPKMITDFVREKKTISFGGCMCQVLFVHFCGGG
EMVLLVVMAYDRYVAICKPLHYLTIMNVQKCIWLVAISWTIGFVHALSQMAVIMQLPFCGPREIDSFFCDIPLVIKLACIDSYNLGILMNADSGVLTMTCFIVLLISYTY
ILLTVRQSSKTGVSRALSTCTAHITVVVLFFGPCIFIYVWPLSITWVDKFLAVFYSVFTPLLNPAIYTLRNKEIKNAVKRFKSYYMHSKENI*
760 >lcl|XP_003128658.1|Plus1complement(45588..47186) NW_003300275 muscarinic acetylcholine receptor M5-like LOC100155818 __SEG__ Chr7 {Sus scrofa} MEGDSYHNATTINGTPVNHQPLERHGLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALD
YVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPPDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRET
EKRTKDLADLQGSDSVAEVEKSKPAHKVLLRSCFSCPRPPLAQRERNQASWSSSRRSTSTPGKPSQASCPSTEWAKAEQLTTCSSYPSSEDEDKPTTAPVFQVVYKSQAK
ESPREKFSAEETKETLANAQTEKNDYDTPKYFLSPASAQRPKSQKCVAYKFRLVVKADGTPDTNNGCHKVKIMPCSFPVSKDPSTKGLDPSLSHQMTKRKRMVLVKERKA
AQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVSLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP*
761 >lcl|XP_003128808.1|Plus121403..22341 NW_003300302 olfactory receptor 4F21-like LOC100524383 __SEG__ Chr7 {Sus scrofa} MDGANHSVASEFVFLGLTNSWEIQLLLFVFTSTFYVASMMGNSLIMLTVISDPHLHSPMYFLLANLSFLDLVAASVASPKMVYDLFRKRKVISFSGCITQIFFIHVIGGV
EGVVLLAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGPNVLDSFYCDLPRFLKLACTDTYQLESMVMANSGFISVGFFFIVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWPSPSIPLDKFLAIFDSVLTPFLNPVIYTFRNQEMKVAMKRVCKQLVSYRKIS*
762 >lcl|XP_003128809.1|Plus199403..100341 NW_003300302 olfactory receptor 4F6-like LOC100524571 __SEG__ Chr7 {Sus scrofa} MYKTNYSSVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFEPHLHSPMYFLLANLSFIDLCLSTLTVPKMISDLCSGRKTISFQGCVFQIFLLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGAWAIGLLHAVVQVAFVVHLPFCGPNEIDSFYCDLPRFIKLACIDTYRMEFMVTANSGFITMGTFFLLIASYVF
ILVTVWKRSSGSLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVEKFLAILDFMITPLLNPAIYTLRNKDMKMAVRRLSSQLLSWQKIS*
763 >lcl|XP_003128810.1|Plus1113824..114762 NW_003300302 olfactory receptor 4F6-like LOC100524752 __SEG__ Chr7 {Sus scrofa} MYKTNYSSVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFEPHLHSPMYFLLANLSFIDLCLSTLTVPKMISDLCSGRKTISFQGCVFQIFLLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGAWAIGLLHAVVQVAFVVHLPFCGPNEIDSFYCDLPRFIKLACIDTYRMEFMVTANSGFITMGTFFLLIASYVF
ILVTVWKRSSGSLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMRMAVRRLCSQLLSWQKIS*
764 >lcl|XP_003128811.1|Plus1complement(280427..281365) NW_003300302 olfactory receptor 4F21-like LOC100524943 __SEG__ Chr7 {Sus scrofa} MDGANHSVASEFVFLGLTNSWEIQLLLFVFTSTFYVASMMGNSLIMLTVISDPHLHSPMYFLLANLSFLDLVAASVASPKMVYDLFRKRKVISFSGCITQIFFIHVIGGV
EGVVLLAMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWMTGLIHSTVQLAFVVNLPFCGPNVLDSFYCDLPRFLKLACTDTYQLESMVMANSGFISVGFFFIVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWPSPSIPLDKFLAIFDSVLTPFLNPVIYTFRNQEMKVAMKRVCKQLVSYRKIS*
765 >lcl|XP_003128812.1|Plus1complement(268715..269653) NW_003300302 olfactory receptor 4F6-like LOC100525294 __SEG__ Chr7 {Sus scrofa} MYKTNYSSVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVSAVIFEPRLHSPMYFLLANLSFIDLCLSTLTVPKMISDLCSGRKTISFQGCVFQIFLLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGAWAIGLLHAVVQVAFVVHLPFCGPNEIDSFYCDLPRFIKLACIDTYRMEFMVTANSGFITMGTFFLLIASYVF
ILVTVWKRSSGSLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMKVAVRRLSSQLLSWQKIS*
766 >lcl|XP_003128813.1|Plus1453325..454248 NW_003300302 olfactory receptor 4N2-like LOC100525471 __SEG__ Chr7 {Sus scrofa} MENENSTVVAEFIFVGLTQSRNIQLLVFVLILIFYLIILPGNFLIILTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EMLLLVVMALDRYIAICRPLHYSTVMNLRACYALLVALWLGGFVHSIIQVALILHLPFCGPNQLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAV
ILCRVRGSSSEGKTKAMSTCTTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKTSLKRLLNQQLA*
767 >lcl|XP_003128814.1|Plus1462939..463898 NW_003300302 olfactory receptor 4K2-like LOC100525650 __SEG__ Chr7 {Sus scrofa} MEGANHSRVSEFVLLGLTDSPELQIFFFVMFSLFYLMSMLGNCLILLTVLFSPHLHSPMYFLLSNLSLIDMCLSSFATPKMIVDIFAQHKTISFEGCISQIFFLHLFTGT
EIVLLISMSFDRYIAICKPLHYSSVMSQSMCVGLVVASWTVGFLHTMTQLAFTLYLPFCGPNVVDSFFCDLPLVIQLACIDTYILGIFMISTSGMIALISFLLLLTSYIT
VLVTIKDHSSSGSSKALSTCTAHFIVVSMFFGPCIFIYVWPFTNFLMDKTLSIFYTIFTPFLNPLICTLRNQEVKTAVKKKLSNQYLNIGKTTPMYSVQ*
768 >lcl|XP_003128815.1|Plus1complement(188518..189468) NW_003300302 olfactory receptor 4F21-like LOC100511142 __SEG__ Chr7 {Sus scrofa} MSTKPKEGENNSVVSEFVFLGITNSWEIQLLFVFTSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKRKVISFTGCITQIFFIHV
IGGVEMVLLIAMAFDRYVAICKPLHYLTIMSPRLCIFLLVAAWIIGLVHSTVQLASVVNLPFCGPNVLDSFYCDLPRFIKLACVDTDQLEFMVTANSGLISVGSFFILII
SYIVIILTVKKQCSVGSSKALSTLSAHITVVILFFGPLIFVYTWPSLYTPLDKFLAIFDAVLTPFLNSVIYTFRNQEMKVAMKRVCRQLMSYRKIS*
769 >lcl|XP_003128816.1|Plus1complement(344754..345695) NW_003300302 olfactory receptor 4L1-like LOC100512060 __SEG__ Chr7 {Sus scrofa} MDLLNNTSSVSEFILLGLFSAQDIQMFLFAIFTLVYVAIIVGNLLIVISVISDNHLHSPMYFFLANLSFFDLCLSSTATPKVILDFFREHKTISWWGCMTQMFFMHFFGG
GEMSLLIAMAIDRYVAICKPLHYKTIMSHKVLIVFLLLSWAVGFIHTTSQMVFTVGLPFCGPNTVDSIFCDPPLVIRFACTDTYILELLVIVNSGLLSLVCFALLLISYT
VMLITIWQHSSSASSKALSTLSAHITVVTLFFGPAIFVYAFPFNSYSVDKFLSVFYSMITPLLNPIIYTLRNQEMKAAIKRLSRQHIGSCLIH*
770 >lcl|XP_003128818.1|Plus1complement(10062..11000) NW_003300306 olfactory receptor 4F21-like LOC100513553 __SEG__ Chr7 {Sus scrofa} MDGANHSVASEFVFLGLTNSWEIQLLLFVFTSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFLDLVAASVASPKMIYDLFRKCKVISFSGCIAQTFFMNVIGGV
EGVMLITMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWVTGLIHSMVQLAFVVNLPFCGPNVLDRFYCDLPRFLKLACTDTYQLESMVMANSGFISVGFFFIVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWPSPSIPLDKFLAIFDAVLTPFLNPVIYTFKNQEMKVAMKRVCKQLVSYRKIS*
771 >lcl|XP_003128820.1|Plus1complement(65654..66592) NW_003300306 olfactory receptor 4F3/4F16/4F29-like LOC100516627 __SEG__ Chr7 {Sus scrofa} MDGANHSMVSEFVFLGITNSWGIQLLLFLFSSVFYMASMMGNSLIMLTVTSDHHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKHKVISFSGCITQIFFLHLVGSV
EMALLIAMAFDRYVAICKPLHYLTVMSPRMCILFLVTAWIIGLIHSLVQLAFVVKLPFCGPNVLDSFYCDFPQFIKLACTDTYRLEFMVTANSGFISLGSFFILIISYIF
ILITVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFVYMWPHPTSHLDKFLAVFDAVLTPFLNSVIYTFRNKEMKMAMRKVCSQIFIYRRIS*
772 >lcl|XP_003128821.1|Plus1complement(173496..174434) NW_003535313 olfactory receptor 4F6-like LOC100516815 __SEG__ Chr7 {Sus scrofa} MYKTNYSLVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFDPHLHSPMYFLLANLSFIDLCFSTLTVPKMLSDLCSGCKTISFQGCVFQIFVLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGTWAIGLLHAVVQLAFVVHLPFCGPNEINSFYCDLPRFIKLACIDTYRMEFMVTANSGFITMGTFFLLNVSYVF
ILVTVWKRSSGSLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMKMAVRRLSSQLLSWQKIS*
773 >lcl|XP_003128822.1|Plus1complement(78402..79340) NW_003535313 olfactory receptor 4L1-like LOC100516985 __SEG__ Chr7 {Sus scrofa} MDLKNGSVVTEFILVGFSVGWELQFVFLVTFSLIYGATVLGNVLIMVTVTFSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMIRDFLTEHKVISMWGCMAQMFFMHCFGGA
EETLLIAMAFDRYVAICKPLHYRTIMSHKLLKGFVILSWTIGFIHTMSQMVLTVNLPFCGPHIIDNIFCDLPLVIKLACMDTYTLELFVIADSGLLSFICFLLLLVSYTV
ILLIVQQRSSGGLSKALSTLSAHITVVTLFFGPCIFIYAWPFSSFAGNKILAVFYTVITPLLNPIIYTLRNEKMQEAMRKLWFQNASSTQNF*
774 >lcl|XP_003128823.1|Plus1141347..142279 NW_003535313 olfactory receptor 4K14-like LOC100517172 __SEG__ Chr7 {Sus scrofa} MGLQNYSLVSEFVLHGLCNSQHLQNLFFIFFSGIYVALVLGNLIIVVTVISDPHLYSFPMYFLLGNLSFLDIWLTSFATPKMIRDFLSDRKLISFGGCMAQIFFLHFVGG
AEMVLLVTMAYDRYVAICKPLHYMTMMNQQTCIRLVSVSWAIGFVPSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACVDTYVLGVLMISDSGLLSMSCFLLLLISYT
VILITVQQQAAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFSWFSVDKVLSVFYTIFTPLLNPLIYTLRNKDMKIAMKRLRNQHVTFH*
775 >lcl|XP_003128824.1|Plus1complement(38017..38958) NW_003535313 olfactory receptor 4L1-like LOC100519158 __SEG__ Chr7 {Sus scrofa} MDLLNNTSSVSEFILLGLSSAQDIQMFFFAIFTLVYVAIIVGNLLIVISVISDNHLHSPMYFFLANLSFFDLCLSSTATPKVILDFLRERKTISWWGCMTQMFFMHFFGG
GEMSLLIAMAIDRYVAICKPLHYKTIMSHKMLIVFLLLSWAVGFIHTTSQMVFTVGLPFCGPNTVDSIFCDLPLLIRLACTDTYILELLVIVNSGLLSLVCFVLLLISYT
VMLITIWQHSSSASSKALSTLSAHITVVTLFFGPAIFVYAFPFNSYSVDKFLSVFYSMITPLLNPIIYTLRNQEMKAAIKRVSRQHIGSCLIH*
776 >lcl|XP_003128825.1|Plus1153717..154655 NW_003535313 olfactory receptor 4K3-like LOC100519495 __SEG__ Chr7 {Sus scrofa} MDTGNLSIVSEFVLLGLCQSWTMQVLLLLIICILFLIIVSGNIAIMILITIDTHLHYPMYFLLANLSFVDMWLCLITTPKMITDFVREKKTISFGGCMCQVLFVHCCGGG
EMVLLVVMAYDRYVAICKPLHYLTIMNMQKCIWLVAISWTIGFVHALSQMAVIMQLPFCGPREIDSFFCDIPLVIKLACIDSYNLGILMNADSGVLTMTCFIVLLISYTY
ILLTVRRSSKTGVSRALSTCTAHITVVVLFFGPCIFIYVWPLSITWVDKFLAVFYSVFTPLLNPAIYTLRNKEIKNALKRFKSYYMHSKENI*
777 >lcl|XP_003128826.1|Plus1complement(98214..99152) NW_003535313 olfactory receptor 4K3-like LOC100519667 __SEG__ Chr7 {Sus scrofa} MEKQNHSIVSEFILLGLTELHELQIFFFSFFSIIYIAILLGNLIIILVVKLDPHLNSPMYFLLANLSFIDMALASFATPKMISDLMSENKAISYEGCMAQMFFLHLFGGS
EMMLLVAMAIDRLTAICKPLNYKNIMSHRVCLRLALFSWTTGFVHTISQMVFTVTLPFCGPNVVDSFFCDLPQVIKLACTDTYTLELLVTTFSGLLSLFCFIFLFISYSI
ILITVQHHSSSGYSKAMSTLSAHITVVVLFFGPCIFIYIWPFSRVSIDKILSVFYTIFTPLLNPIIYSFRNKDMKKAIIKIKTRHVSCRSTF*
778 >lcl|XP_003128830.1|Plus1complement(483433..>484404) NW_003300307 olfactory receptor 11H12-like LOC100523076 __SEG__ Chr7 {Sus scrofa} LQVIDPMNVSEPDSSFAFVREFILLGFSCEWKIQILLFSLFLTTYALTITGNGAIVCALCCDRRLHIPMYMFLGNFSFLEIWYVSSTTPKMLINFLSDKKTISFVGCFLQ
FYFFFSLGTTECLLLAVMAFDRYLAICRPLHYPNLMTGHLCTKLVMTCWACGFLWFLIPIVLISQMSFCGSNIIDHVVCDPGPLFALACVSAPATQLLCYTLSSLVIFGN
FLFILGSYTLVLTAVLRMPSATGRHKAFSTCGSHLAVVSLFYGSLMVMYVSPGLGHSAAMQKVATLFYAMVTPLFNPFIYSFRNKEIKAALRKVLGYILRHIR*
779 >lcl|XP_003128831.1|Plus1436352..437320 NW_003300307 olfactory receptor 11H6-like LOC100523262 __SEG__ Chr7 {Sus scrofa} MKNPGGTNHSDPVSEFILLGFTCTWAMQIFLFSLFSVMYVLTLIGNLCITCTVWWDQHLHTPMYILLANFSFLEMWYVTSTVPSMLANFLSETKTISFYGCFLQFYFFFS
MGTTENFFLSAMAFDRYLAICRPLHYPTIMTVQRCIRMGACCWVCGFSCFLFPVYLISQLPFCGPNTIDHFLCDPGPLMKLSCVPAPATETICAIFNSVLIFSTFLFITS
SYTLVIRAVLRVPSAEGRRKAFSTCGSHLAVVSLFYGSIMVMYVSPTAGNPAGIQKIVTLFYSVMTPLFNPLIYSLRNKEMKEALRKLCRSMLFGQRQLLKY*
780 >lcl|XP_003128832.1|Plus1451911..452864 NW_003300307 olfactory receptor 11G2-like LOC100523452 __SEG__ Chr7 {Sus scrofa} MNVSSRETTHTVSHFILLGFPSHPRMQLLYFGLFSVAYTLTLMGNTAIVCAVRWDRRLHTPMYILLGNFSLLEICYVTTTVPNMLANFLSTSKSISFVSCFAQFYFFFSF
GCDEGFYLCIMAFDRYLAIYRPLHYPGIMTKQLCTGLIVFGWSCGFILFLTPVILISQLPYCGPNVINHFMCDPVPLIMLSCSEDTTTQFIYSTFNSIFMTGTFLFILCS
YALVILAVLRMPSAASKRKAFSTCASHLAVVILFFGSVMVMYVSPGSEHPVEMQKLVTLFYSVITPLCNPLIYSLRNKEMKAALKKVFGSEISVYKT*
781 >lcl|XP_003128833.1|Plus1466702..467670 NW_003300307 olfactory receptor 11G2-like LOC100523622 __SEG__ Chr7 {Sus scrofa} MSISEANNISGSVSEFILLGFPCRRDIQILLFVMFSLIYLLTLLGNTSIICAVWSSRKLHTPMYTLLANFSFLEICYVSSDVPKMLANIISQTKSISYAGCLLQFYFFFS
MCAAEGYFLSVMSFDRFLAICRPLHYPTIMTHHLCARLVVFCWAGGFLSILMPAVLMSQVPFCGPNIIDHFFCDLGPLLALSCAPVPKTTLTCATVSSLIIFVTFLYILG
SYTLVLRAVLRVPAGSGRNKAFSTCASHFLVVSLFYGSVMVMYVSPGSRTHPGTQKFVTLFYCMATPFFNPLIYSLRNKDMKDALKKVLGASSKEILKNTEK*
782 >lcl|XP_003128835.1|Plus1394181..395152 NW_003300307 olfactory receptor 11H12-like LOC100524156 __SEG__ Chr7 {Sus scrofa} MRTLESNISGSVSEFILLGFPCRRDIQIFLFVLFSVIYLLIIMGNTSVICAVWSSWKLHTPMYIFLANFSFLEICYVSSDVPQMLANVLSQTKSISYAGCLLQFYFFFSM
GAAECLFLSVMSFDRFLAICRPLHYPIIMTHSLCAWLVVFCWAGGFLWLLTPLILISQVPFCGPNTIDHFLCDLGPLLALSCAPVSGTTHICGIMSSLIIFLTFLYILGT
YYSILSVVLQMPSGSGRHKAFSTCASHLAVVSLFYGSIMMMYVSPGSGDYPGMQKFVTLFYALATPFFNPLIYNFRNKDVEEALKKILNVLFWEIFKGFKSHI*
783 >lcl|XP_003128837.1|Plus1complement(350664..351611) NW_003300307 olfactory receptor 4Q3-like LOC100524508 __SEG__ Chr7 {Sus scrofa} MRKENDSKVTEFVLLGLSSSWELQLFLFLIFVLLYMVIVLGNVLIMLTVWTDAYLLQLPMYFFLGHLSFLDLCLSCVTVPKMLGDFLQEGKVISFSGCLAQIYFLHFLGA
SEMLLLTVMAYDRYVAIGNPLHYLTVMNHQLCVQLVFACWCGGFIHSITQVTLVIQLPFCGPNELDNFYCDVPQVIKLACVDTYVIEVLMVSNSGLLSLICFLVLLFSYA
VILITLRTRFRQGQSKALSTCASHLTVVSLIFVPCVFIYLRPFCSFSVDKVFSVFYTVITPMLNPLIYTLRNADVKTAMKKLRKKHVTSCCHVKE*
784 >lcl|XP_003128838.1|Plus1362043..363029 NW_003300307 olfactory receptor 11G2-like LOC100524691 __SEG__ Chr7 {Sus scrofa} MNISGSGFYSESVHEFILLGFPCSREIQVILFMFFCIVYLLTLMGNGAIICAVCWDQKLHIPMYFLLGNFAFLEIWYVNSTVPNTLVNFLSKTKAISFTGCFLQLYFFFS
MGSTECFFLSAMSFDRYFAICHPLHYATVMTGQCCINLVISCWVCGFLWYLVPVILISQLPFCGPNVIDHFVCDSGPLLTLSCAPAPMSKLTSYTLSSLIILLSFLFILI
SYTLVLLAVLRLPLASSRHKAFSTCGSHLAVVLLFYGTIMVMHVSPGSSHSTLMPKIMTLFYAMVTPLFNPLIYSLRNKDMKNALWKVLEKSKLSLVAGPGGMWNNPA*
785 >lcl|XP_003128865.2|Plus11509055..1510437 NW_003300312 alpha-2C adrenergic receptor ADRA2C __SEG__ Chr8 {Sus scrofa} MASPALAAALAAAAAAGPNASGAGEAGSGGAANASGSAWGPPPGQYSAGAVAGLAAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLA
NELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFF
APCLIMGLVYARIYRVAKLRTRTLSEKREPAGPDGASPTTENGLGAGENGHCAPPRRPRADVEPEDSSAAAERRRRRGALRRGGRRRAGAKGAAGAEGTGTETGTAEPGT
LTAARSPGPSGRLSRASSRSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPDPLFKFFFWIGYCNSSLNPVIYTVFNQ
DFRRSFKHILFRRRRRGFRQ*
786 >lcl|XP_003128901.1|Plus1complement(17794..19209) NW_003535322 D(1B) dopamine receptor-like LOC100524631 __SEG__ Chr8 {Sus scrofa} MLPPGRNGTAYRTRARQQQLVQGGAVGGSEGVAPLGPAQVVTAGLLTLLIVWTLLGNVLVCAAIVHSRHLRAKMTNVFIVSLAVSDLFVALLVMPWKAVAEVSGYWPFGA
FCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFCYERTMTPRVALVMVGLAWTLSVLISFIPVQLHWHRDKVGSWGGVDPLSHLANGTPWEEAGEPDVREENCDSSLN
RTYAISSSLISFYIPVAIMVVTYTRIYRIAQGQIRRISCLERAAEHAQSCRSREACAPDTGLRASIRKETKVLKTLSVVMGVFVCCWLPFFILNCMVPFCGGPPEDFPCV
SETTFDVFVWFGWANSSLNPIIYAFNADFRKVFAQLLGCGHLCSRTQVETANISNELVSYHQDTALHKQIPAVSIHSIPSAATPGVAEVDKEEDESPFQRMSPIAQASPD
GDPAAQSIWELDCEGQISLGKITPFTPSGFH*
787 >lcl|XP_003129027.1|Plus1complement(16004..16399) NW_003535363 e3 ubiquitin-protein ligase LNX-like LOC100523319 __SEG__ Chr8 {Sus scrofa} MNLSDPADEPDLSPAPLCVVCGQAHSPEENHFYTYPEEVDDDLICHICLQALLDPLDTPCGHTYCTVCLTNFLVEKDFCPVDRKPVVLQHCKKSSILVNKLLNKLLVTCP
FTEHCEEVLQRCDLEHHFQTR*
788 >lcl|XP_003129059.1|Plus11492137..1493477 NW_003300372 neuropeptide Y receptor type 5 NPYR5 __SEG__ Chr8 {Sus scrofa} MGSEIPDYYNKTLASENNTVATRNSGFPVWEDYKGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMRKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFG
KVMCHIMPFLQCVTVLVSTLILISIAIVRYHMIKHPVSNNLTANHGYFLIATVWTLGLAICSPLPVFHSLVELQESFGSAWLSSRYLCVESWPSDSYRIAFTISLLLVQY
ILPLVCLTVSHTSVCRTISCGLSSQDSKLEENEMINLTLQPAKRSGPQAKLSHHPKWTYSFIRRHRRRYSKKTACVRPAPAGPALESREGRPPGKVGSMQSQPPPSNKFM
PGVPTCFEVKPEENSDVPEMRVSRSIMRLRKRSRSVFYRLTVLILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLMSLI
HCLHVS*
789 >lcl|XP_003129094.1|Plus1complement(3137385..3138317) NW_003535387 olfactory receptor 5W2-like LOC100510919 __SEG__ Chr8 {Sus scrofa} MEAGNCSSLTEFIFLGISNNTENKGTLFAMCLLVYLINLLANLGMITLIRMDPRLHTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAKNKAIPFYGCALQFLVFCTFADA
ECLLLAVMAYDRYKAISHPLLYTVSMSSRLCSLLVAGVYVVGVADALIHTTLAFRLCFCGSNEINHFFCDLPPLFLLSCSDIQVNELALFTVFGFIELSTILGVLVSYGY
IALSVLKIHSAEGKFKAFSTCASHLTAVAIFQGTMLFMYFRPSSSYSLDQDKMSSLFYTLVIPMLNPLIYSLRNKDVKEALEKLKLKRWF*
790 >lcl|XP_003129198.1|Plus1complement(839521..840600) NW_003300400 protein mab-21-like 2-like LOC100519500 __SEG__ Chr8 {Sus scrofa} MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTG
KQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALESAAKQTWRLAREILTNPKSLDKL*
791 >lcl|XP_003129287.2|Plus1complement(79170..79628) NW_003300449 calmodulin-like LOC100513102 __SEG__ Chr8 {Sus scrofa} TCSVADQLTEEQIAEVQEAFSLFDKDGDGTITTKKLGTVIRSLGQNPTEAELQGMINEGEAHGNGTTDFLEFLTMMAGKIKDTDSEEEIREVFCVLDKDGNGYISAGELR
HVMTNLGDKLADEEVDEMIREADIDGDGQVNYEEFVQMLTAK*
792 >lcl|XP_003129444.1|Plus1complement(67465..68409) NW_003300499 olfactory receptor 10A3-like LOC100520502 __SEG__ Chr9 {Sus scrofa} MKRHNQSSVVDFVLLGFSNFPELQGQLFGVFLVIYLVTLVGNAVIILIISLEQSLHVPMYLFLQSLSVVDLSISAVVMPEMLVVLSTEEMRISVSGCFAQMYFILLFGVT
ECFLLGAMAYDRFAAICHPLSYPVLMNQRVFVKLVGSSWVSGIMVATVQTSWVFSFPFCGPNEINHLFCETPPVLELACADTFLFEVYAFTGTILTVMVPFLLILLSYLR
ILLAILKMPPTTGRQKAFSTCGSHLTSVTLFYGTASMTYLQPKSGYSPDTKKLLSLAYTLLTPLLNPLIYSLRNSELKRALMKLWRRKVELHTF*
793 >lcl|XP_003129448.1|Plus1complement(192662..193594) NW_003300499 olfactory receptor 491-like LOC100521207 __SEG__ Chr9 {Sus scrofa} MEAGNHSSVTEFILLGLTEDPVLGVICFVIFLGIYVVTLVGNSSIIALIRSCAQLHTPMYLFLSHLAFVDMGYSTSVTPVMLIGFCRQGVAITTAGCEAQLCFVVLFGTA
ECFLLAAMAYDRYVAISLPLLYSTHMSPRVCVLLLGASYLGGCVNAWTFASCLLSLSFCGPNQIDHFFCDFSPLVKLSCSDVSVLELIPSISSGSIIVVTGIVIGLSYIR
ILITVLKMPSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSSYSTGQNKVVSVFYTVVIPMLNPLIYSLRNRDVKEALRKATVRIYN*
794 >lcl|XP_003129449.1|Plus1129059..129994 NW_003300499 olfactory receptor 480-like LOC100521386 __SEG__ Chr9 {Sus scrofa} METGNYTSVTEFIILGLTEDSTVGATLFIVFLGIYVVTLLGNGSIILLIRSSPQLRTPMYLFLSHLAFVDLGYSSSVSPVMLRGLLGEGNSLRVAGCVAQLCSAVTFGTT
ESFLLAAMAYDRYVAICSPLLYSTHMSSRVCILLVVMSYVGGSLNAWIFTGCVLGLTFCGPNKVNHFFCDYAPLLKLSCSHDFTSEIVPAASSGSIIVVTVFIIALSYVY
ILITVLKMPSTEGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNKEVKEAMRKLMARRHWF*
795 >lcl|XP_003129452.1|Plus1complement(169715..170653) NW_003300499 olfactory receptor 10R2-like LOC100522088 __SEG__ Chr9 {Sus scrofa} MGNHTAVSTFLLWGFSSFPDLQTLLFVTILFSHATILAANASVMVAIKCTHNLHTPLYFLLGGLSFSETCTTMAIIPRLLVDLLSESKTLSLSECATQMLFFFGLSCSNC
FIMSAMSYDRYTAIRNPLHYATLMTPKVCFQLMTASWVAGFLVSLCIVVIIFNLSFCDSNVIQHFFCDISPVMCLACDYTLYHEMAIFVFSAFVLGGSFILIMISYVFIG
SVVMKVPSATGRCKAFSTCSSHLTVVCIHYAFAGFVYLRPKDRDSPREDMLMAVAYTILTPLLNPIVYSLRNKEMQVALRKVLDKKVHPSDG*
796 >lcl|XP_003129454.1|Plus1385469..386407 NW_003300499 olfactory receptor 10R2-like LOC100522627 __SEG__ Chr9 {Sus scrofa} MGNHTAVSTFLLWGFSSFPGLQTLLFVTILFSHATILAANASVMVAIKCTHNLHTPLYFLLGGLSFSETCTTMAIIPRLLVDLLSESKTLSLSECATQMLFFFGLGANNC
FIMSAMSYDRYTAIRNPLHYATLMTPKVCFQLMTASWVAGFLVSLCIVVIIFNLSFCDSNVIQHFFCDISPVMCLACDYTLYHEMAIFVFSAFVLGGSFILIMISYVFIG
SVVMKVPSATGRCKAFSTCSSHLTVVCIHYAFAGFVYLRPKDRDSPREDMLMAVAYTILTPLLNPIVYSLRNKEMQVALRKVLDKKVHPSDG*
797 >lcl|XP_003129456.1|Plus1364986..365918 NW_003300499 olfactory receptor 491-like LOC100523388 __SEG__ Chr9 {Sus scrofa} MEAGNHSSVTEFILLGLTEDPVLGVICFVIFLGIYVVTLVGNSSIIALIRSCAQLHTPMYLFLRHLAFVDMGYSTSVTPVMLTGFCRQGVAITTAGCEAQLCSVVLFGTA
ECFLLAAMAYDRYVAISLPLLYSTHMSPRVCVLLLGASYLGGCVNAWTFASCLLSLSFCGPDQIDHFFCDFSPLVKLSCSDVSVLEIIPSISSGSIIVVTVIVIGLSYIC
ILITVLKMPSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSSYSTGQNKVVSVFYTVVVPMLNPLIYSLRNRDVKEALRKATVRIYY*
798 >lcl|XP_003129462.1|Plus1complement(16657..17601) NW_003535485 olfactory receptor 2AG1-like LOC100524451 __SEG__ Chr9 {Sus scrofa} MELWNSSLGSGFILVEILNDSGSPELLCAAIAVLYMLALTSNGLLLLVITVDARLHAPMYLLLGQLSLMDVMLASVVTPKTLVDYLCGENAISFGGCALQMFLVLTLGGA
EGLLLAFMAYDRYVAICHPLNYMILMRPQICWLLVATSWILAFLNSVIHTSYTMHLPFCTSRAIRHLLCEVPPLLKLACADTSGYEFMVYVSSATFLMPALAAILASYTS
VLAAVLRMSSGEGRQKALVTCSSHLTVVGMYYGAAMFMYLQPSSYHSPPQDNILSAFYIIVTPVLNPLTYSLRNKEIMGAFRRVLGRLPFVQGW*
799 >lcl|XP_003129467.1|Plus1127526..128482 NW_003535485 olfactory receptor 6-like LOC100525352 __SEG__ Chr9 {Sus scrofa} MWQENITHVSEFVLVGFPTSPGLQVLLFVLFLTTYLLVLLENLVIILTVWVTGPLHKPMYYFLSTMSFLEIWYISVTVPKMLAGFLLCPNTISFLGCMTQLYFFMSLACT
ECVLLAAMAYDRYVAICWPLRYPVMMTTGFCVQLTISSWVSGFTISMAKVYFISQVALCGSNILNHFFCDVSPILKLACMDSSVAETVDFVLAIVILVSPLSATVLSYGC
IVSAVLHMPSAAGQRKAFSTCASHLTVVVIFYTAVMFMYVRPRAIASFDSNKLISAIYAVLTPMLNPIIYCLRNKEVKDAIRKTMASGRALFLRDSLC*
800 >lcl|XP_003129473.2|Plus1114189..115133 NW_003535485 olfactory receptor 6-like LOC100511211 __SEG__ Chr9 {Sus scrofa} MPERNTTLVSEFILVGFPTAPWLQVLLFFLFLVVYLLVVVENLVIMLTVWVTGSLHKPMYYFLSSLSFLEVWYVSVTVPKMLEGFLLQRRHISFTGCMAQLYFFISLACT
ECVLLAAMAYDRYVAICHPLRYPVIMTTGYCARLVAFSYGTGFMVSVIKVYFISLVSFCGSNVMNHFFCDISPILKLACKDMSTAERVDFALAIVILVFPLTTTSLSYGY
IVSTILRIPSTQGRKKAFSTCASHLTVVVIYYTAMIFMYVRPRAIASFNSNKLISAVYAVLTPMLNPFIYCLRNQEVKNAIKRTMGGGQCPLLS*
801 >lcl|XP_003129476.1|Plus1complement(7155..8078) NW_003535485 olfactory receptor 2D3-like LOC100511766 __SEG__ Chr9 {Sus scrofa} MGTENQTCVTEFILVGLSSGQRTQIPLFMVFLAIYLLTVLGNLLIIVLIHTDSRLHTPMYFFLKNLSFTDLLFSTTIVPQMLFHLLVTRKTISIAGCSIQMIFSLVAGCT
ESSLLAVMSYDRYVAVCKPLRYATVMTQRVCVQLTVGSWASGAFVSLVDTTFTLSLSYHGQNMINHYFCEPPALLKLASEETSKAETAIFAMGVVILLGPLSLILFSYWN
IISTVIQIHAGERKLKVFCTCGSHLIVVVLFYGSTVFTYMRPNSTKMNEGDKVISVFYSVVTSMMNPFIYSLRNKDVRESFRKVLGR*
802 >lcl|XP_003129477.1|Plus1150046..150969 NW_003535485 olfactory receptor 2D3-like LOC100511945 __SEG__ Chr9 {Sus scrofa} MGTENQTCVTEFILVGLSSGQRTQIPLFMVFLAIYLLTVLGNLLIIVLIHTDSRLHTPMYFFLKNLSFTDLLFSTTIVPQMLFHLLVTRKTISIAGCSIQMIFSLVAGCT
ESSLLAVMSYDRYVAVCKPLRYATVMTQRVCVQLTVGSWASGAFVSLVDTTFTLSLSYHGQNMINHYFCEPPALLKLASEETSKAETAIFAMGVVILLGPLSLILFSYWN
IISTVIQIHAGERKLKVFCTCGSHLIVVVLFYGSTVFTYMRPNSTKMNEGDKVISVFYSVVTSMMNPFIYSLRNKDVRESFRKVLGR*
803 >lcl|XP_003129481.1|Plus1685958..686926 NW_003535485 olfactory receptor 52B2-like LOC100514118 __SEG__ Chr9 {Sus scrofa} MTHANLTLVHPAVFVLLGIPGLEAYHLWLSVPLCFMYVTAVLGNSVLIAVITTERRLHEPMYFFLSMLAATDILLSTTTVPKALAIFWFHAHAIAFEACVTKVFFVHTMF
VGESAILLAMAFDRFVAICNPLHYATVLTWPVVGRIGLAIVTRSFCIIFPVIFLLKRLPFCGTNLIPHSYCEHIGVARLACADITVNIWYGFSVPIVMVLLDAILIAVSY
SRILRAVFRLPSQDARHKALSTCGSHLCVILMFYGPSFFALLTHRFGRNVPRHIHILLANLYVVLPPMLNPLVYGVKTKQIREGVARRVFGIRVWCCASPLG*
804 >lcl|XP_003129483.1|Plus1complement(79119..80060) NW_003535486 olfactory receptor 56A3-like LOC100514479 __SEG__ Chr9 {Sus scrofa} MTPHRNVSTEVSDFLLNCFVRSPSWQLWLSLPLSLLFLLAMGANTTLLVTIRLEASLHQPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRAISFFACFLQMYIMNSFL
AMESCTFMVMAYDRYVAICHPLRYPSIITDQFVARAAIFILARNFIFTLPIPILSARLHYCGRNVIENCICANMSVSRLSCDDVTVNRLYQFALSWTMLGSDLILIFASY
TLILRAVLRLKAEGAVAKALGTCGSHFILILFFSTILLVFVLTHVAKKKVPPDVPVLLNVLHHVVPAALNPIVYGVRTQEIKQGIQRLLKKGW*
805 >lcl|XP_003129484.1|Plus1complement(91395..92342) NW_003535486 olfactory receptor 56A3-like LOC100514669 __SEG__ Chr9 {Sus scrofa} MTAHQNGTIATEVSHFLLNCFVRSPSWQLWLSLPLSLLLLLALGANTTLLVTIRLEASLHQPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRAISFSACFLQMFIMNC
FFAMESCTFMVMAYDRYVAICHPLRYPSIITDQFVAKAAIFILARNFILTLPIPILSSRLHYCGRNVIENCLCANMSVSRLSYDDITINRLYQFALSWTMLGSDLILIFA
SYTLILRAVLRLKAEGAVAKALGTCGSHFILILFFSTILLVFVLTHVAKKKVPPDVPVLLNVLHHVVPAALNPIVYGVRTQEIKQGIQRLLKKGW*
806 >lcl|XP_003129485.1|Plus1complement(114482..115429) NW_003535486 olfactory receptor 56A3-like LOC100514860 __SEG__ Chr9 {Sus scrofa} MTAHQNGTIATEVSHFLLNCFVRSPSWQLWLSLPLSLLLLLAMGANATLLVTIRLEASLHQPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRAISFSACFLQMFIMNS
FLAMESCTFMVMAYDRYVAICHPLRYPSIITDQFVAKAAIFILARNFIFTLPIPSLSGRLYYCGRNVIENCICANMSVSRLSCDDVTVNRLYQFAGGWTLLGSDLILIFA
SYTLILRAVLRLKAEGAVAKALGTCGSHFILILFFSTILLVFVLTHVAKKKVPPDVPVLLNVLHHVVPAALNPIVYGVRTQEIKQGIQRLLKKGW*
807 >lcl|XP_003129486.1|Plus1complement(135204..136145) NW_003535486 olfactory receptor 56A4-like LOC100515042 __SEG__ Chr9 {Sus scrofa} MTLPSNYSSAPVSEFLLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLVTIRLEASLHQPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRAISFFACFLQMFIMNSF
LTMESCTFMVMAYDRYVAICHPLRYPSIITDQFVARAAIFVVARNGLLFLPVPVLSSRLRYCAENVIQNCICTNLSVSKLSCDDITFNRLYQFVAGWTLLGSDLVLVVLS
YSFILKAVLRLRAEGAAAKALSTCGSHLILILFFSTVLLVLVITNLARRRIPPDVPILLNILHHLIPPALNPIVYGVRTKEVKQGIQKLLSRL*
808 >lcl|XP_003129488.1|Plus1complement(173208..174173) NW_003535486 olfactory receptor 52N2-like LOC100515396 __SEG__ Chr9 {Sus scrofa} MSGANSSSLTPGFFILSGVPGLEAAHVWLSLPFCFMYIVAVVGNCGLLYLIGHEEALHRPMYYFLALLSFTDATLCTTTVPNMLCIFWFNLKEIDFNACLAQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYATILTSPVIAKAGLATFLRGVMLIVPFTFLTKRLPYCRGNSIPHTYCDHMSVAKVSCGNVKVNAVYGLLAALLIGGFDIFCISGSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPAFFTFFTHRFGEHSIPHHIHIIVANLYLLLPPTMNPIVYGVKTKQIREGVIKFLLGDKVLFTQDK*
809 >lcl|XP_003129489.1|Plus1complement(196218..197180) NW_003535486 olfactory receptor 52N2-like LOC100515562 __SEG__ Chr9 {Sus scrofa} MSGANSSSLTPGFFILSGVPGLEAAHVWLSLPFCFMYIVAVVGNCGLLYLIGHEEALHRPMYYFLALLSFTDATLCTTTVPNMLCIFWFNLKEIDFNACLAQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYATILTSPVIAKAGLATFLRGVMLIVPFTFLTKRLPYCRGNSIPHTYCDHMSMAKVSCGNVKVNAVYGLLAALLIGGFDIFCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPALFTIFTHRFGEKSIPHHIHIIIANLYLMLPPMLNPIVYGVKTKQIREEVIKLLFKEKDISAMK*
810 >lcl|XP_003129490.1|Plus1217651..218616 NW_003535486 olfactory receptor 52N1-like LOC100515742 __SEG__ Chr9 {Sus scrofa} MSFLNGSRLTPASFILNGIPGLEEVHLWISFPLCAMYGIAITGNSGLMYLVYSDEALHRPMYIFLALLSFTDMLMCTSTLPNTLCVLWFDLKEIDFKACLAQMFFVHTFT
GMESGVLMLMALDRYVAICYPLRYATILTNPVIAKAGLLTFLRGVMLVIPFVFLTKRLPFCRGNVIPHTYCDHMSVAKISCGNVKVNAVYGLMVALLIGGFDILCITVSY
TMILRAVVSLSSAEARQKAFSTCTAHICAIIITYVPAFFTFFTHRFGGHSIPPHIHIIMANLYLLMPPTMNPIVYGVKTKQIRERVSKILLKEKDSSSHNI*
811 >lcl|XP_003129491.1|Plus1complement(271851..272822) NW_003535486 olfactory receptor 52N4-like LOC100515910 __SEG__ Chr9 {Sus scrofa} MIMKMLNKTDLTPASFLLTGIPGLEDLHLWISFPFCSMYVVAVVGNCGLLYLICCEDSLHRSMYYFLAMLSLTDLVMCSSTIPKALSIFWFHLKEISFEECLVQMFFIYT
FTGMESGVLMLMALDRYVAICYPLRYATILTNPVIAKAGLATFLRGVLLVIPLIFFTKRLPYCRGNIIHHTYCDQLSVAKLSCGNIKANVVYGLMVALLIGGFDILCITV
SYTMILRAVVSLSSAEARQKAFSTCTAHICAIVFSYSPAFFCFFSHRFGSHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDCVIRILSRSKDTKSHTI*
812 >lcl|XP_003129492.1|Plus1complement(294828..295787) NW_003535486 olfactory receptor 52N4-like LOC100516093 __SEG__ Chr9 {Sus scrofa} MLNKTDLVPCSFVLDGVPGLEDLHLWISFPFCSMYVVAVVGNCGLLYLICCEDSLHRSMYYFLAMLSLTDLVMCSSTIPKALSIFWFHLKEISFEECLVQMFFIHTFTGM
ESGVLMLMALDRYVAICHPLHYATILTNPVIAKAGLSTFLRGVFLIIPFTLLVKRLPFCRGNVIPHTYCDHMSVAKLSCGNIKVNVIYGLMVALLIGGFDILCITVSYTM
ILRAVVSLSSAEARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGSHTIPPSCHIIVANIYLLLPPTMNPVVYGVKTKQIRDCVIRILSGSKNIKSHSV*
813 >lcl|XP_003129493.1|Plus1complement(354554..355501) NW_003535486 olfactory receptor 52D1-like LOC100516280 __SEG__ Chr9 {Sus scrofa} MISASVPNASFHPSLFILLGIPGMRDQHIWAAIPFCSMYILALVANSAILYIVTRERTLREPMYLFLCLLSITDVFLCSTTLPKMLAIFWLKSHVISYRGCLTQMFFVHA
VFATESAVLLAMAFDRYVAICRPLHYTSILNAAVIGKMGLACVIRGSLFVFPFVILIERLPFCGHHIISHTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDAVLIAT
SYGLILRAVLRLPSKDAQCRAFSTCGAHVCVILVFYVPAFFSFFTHRFGHQVPPHVHIVLANLYLLLPPVLNPLVYGVNTKQIRLRIVGLFMGRR*
814 >lcl|XP_003129495.1|Plus1complement(392179..393189) NW_003535486 olfactory receptor 52B6-like LOC100516630 __SEG__ Chr9 {Sus scrofa} MPQGRALQSTMALFSAHNVAAVNDSDTRRAGCFLTGIPGLEHLQIWLSIPFCTMYVAALAGNGVLICVIVSQPRLHGPMYVFLSMLASADVLLSTATMPKALATFWLGSS
HISFDGCLTQMFFIHFLFVADSAVLLAMAFDRYVAICSPLRYTAILTSKVIGKVATATLARSFIIMFPSIFLLKCLHYCRVNVIAHTFCEHMGIARLSCSDISVNVWYGL
AAALLSTGLDVILVAVSYMHILRAVFHLPSRDARCKALSTCGSHVCVILLFYIPALFSVFAYRFGGRRIPRYVHILLANLYVVLPPVLNPIIYGVRTKQILEGAKQMFSK
LAKGSK*
815 >lcl|XP_003129496.1|Plus1425553..426500 NW_003535486 olfactory receptor 52H1-like LOC100516817 __SEG__ Chr9 {Sus scrofa} MAVDNLTGPNTASFTLLGIPGLEPYHVWISIPFCLIYLVAIVGNSILLYLIAVEHSLHAPMFFFLAMLAVTDLVLSTTCVPKTLSIFWLGPQKISFPGCLTQLFFLHYSF
VLDSAILMAMAFDRYVAICSPLRYTTILTPKTTVKMAVGIFLRSFCVIVPCVFLAHRLPFCGTRAIPHTYCEHIGVARLACADIAVNIWYGFCVPIMTVVSDVVLIAVSY
VLILCAVFRLPSQEARQKALGTCGSHVCVILMFYIPAFFSILAHRFGQNVPRGFHIVFANLYVIIPPALNPAVYGVKTKQIRDKVILLLFPKKSY*
816 >lcl|XP_003129497.1|Plus14585..5532 NW_003535487 olfactory receptor 52H1-like LOC100516987 __SEG__ Chr9 {Sus scrofa} MVIFNLSSSNPGSFILMGIPGLEQAHVWIGIPFCIIYIVAVVGNCILLYLIVVERSLHEPMFFFLSMLATTDLILSTAGVPKTLSIFWLGAREITFPGCLTQMFFIHCSF
VLDSAILMAMAFDRYVAICSPLRYNTILTPKTIIKIAVGISFRSFCIILPVVFLLTRLPFCRTRIIPHTYCEHIGVARLACADIAVNIWYGFCVPIMTVVSDVVLIAVSY
VLILCAVFRLPSQEARQKALGTCGSHVCVILMFYTPAFFSILAHRFGPNVSPTFHIMFANLYVVIPPALNPMVYGVKTKQIRDKVIILFYTKGTK*
817 >lcl|XP_003129499.1|Plus1complement(48841..49797) NW_003535487 olfactory receptor 52D1-like LOC100517356 __SEG__ Chr9 {Sus scrofa} MPASNSSEPGLPAALLLTGVPGLEWAHPWIALPFCALYLVALAGNTTLVLVIVTDRTLHAPVYLFLCLLSLTDLALSSTTVPKTLAILWLQAGEISSAGCLAQMFCVHSI
YALESSVLLAMAFDRYVAVCHPLRYTTILNHAVIGRIGLLGICRSITVVSPLIFLLRRLPYCGHRVMAHTYCEHMGVARLACADITVNIVYGLTVALLAMGLDSILIAVS
YGFILRAVFCLPSRDAQHKALSTCGSHLGVIVAFYVPAFFSFLTHRFGQHRVPRHVHIFLANLYVLVPPVLNPIIYGARTTEIRSRLPRLLHLAKISV*
818 >lcl|XP_003129500.1|Plus1100493..101437 NW_003535487 olfactory receptor 51I1-like LOC100517544 __SEG__ Chr9 {Sus scrofa} MLGLNGTPFQPATLQLTGIPGMQTGQAGVALVFCILYLISITGNLTILALVTGEPALHQPMYYFLSMLSLNDLGVSFSTLPTVLAVFCFNYHHVGFDACLVQMFFIHTFS
FMESGILLAMSLDRFVAICDPLRYASVLTHNRILAMGLGILAKSFTTLFPFPFLVKRLPFCKGNVLHHSYCLHPDLMKVACGDTHVNNIYGLFVVIFTYGVDSVFILLSY
ALILRAVLAIASREQRLKALNTCMSHICAVLAFYVPIIAVSMIHRFWKNAPPVVHVMMSNVYLFVPPMLNPIIYSVKTKEIRRTILQVFYKPQS*
819 >lcl|XP_003129511.1|Plus12173..3120 NW_003535486 olfactory receptor 52B2-like LOC100519674 __SEG__ Chr9 {Sus scrofa} MFGANLTIFHPTVFILLGMPGLEIYHTWLSIPFCLMSIVAVLGIGALILVVLSESTLHEPMHVFLSMLAGTDNLLSTTTVPKALAIFWFHAGEIAFDACITQMFFIHVAF
VAELGILLAMAFDRYVAICALLRYTAVLTPSTIVKLTLAIWGWGIGTIFPIIFLLKRLPYCRTNIIPHSYCEHIGVARLACADITVNIWYGFSVPMASVLVDVAFIAVSY
TLILQAVFRLPSQDAQHKALNTCGSHIGVILLFFIPSFFTFLTHRFGKNIPHHIHILLANLYVLIPPMLNPIIYGAKTKQIRDSLAHMLSRVGMS*
820 >lcl|XP_003129516.1|Plus155775..56716 NW_003535486 olfactory receptor 56A4-like LOC100520579 __SEG__ Chr9 {Sus scrofa} MASPGNHSSAPVSEFLLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLVTIRLEASLHQPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRAISFFACFLQMFIMNSF
LTMESCTFMVMAYDRYVAICHPLRYPSIITDQFVARAAIFVVARNGLFSLPVPVLSSRLRYCAEKVIQNCICTNLSVSKLSCDDITFNRLYQFVAGWTLLGSDLVLVVLS
YSFILKAVLRLRAEGAATKALSTCGSHLILILFFSTVLLVLVITNLARRRIPPDVPILLNILHHLIPPALNPIVYGVRTKEVKQGIQKLLSRF*
821 >lcl|XP_003129517.1|Plus163212..64198 NW_003535486 olfactory receptor 56A4-like LOC100520757 __SEG__ Chr9 {Sus scrofa} MASASNYSSAPVSEFLLFCFPNYQSWQHWLSLPFSLLFLLALGANATLLVTIWLEESLHQPMYYLLSLIAILDMVLCLTVIPKVLAIFWFDLRAISFSACFLQMFIVNSF
LPMESCTFMVMAYDRYVAICHPLRYPSIITDQFVARAAIFVVARNGLFSLPVPVLSSRLRYCAEKVIQNCICTNLSVSKLSCDDITFNRLYQFVAGWTLLGSDLVLIVLS
YSFILKAVLRLRAEGAAAKALSTCGSHLILILFFSTVLLVLVITNLARRRIPPDVPILLNILHHLIPPALNPIVYGVRTKEVKQGIQKLLSRLQAVKWVRTYLGNKNW*
822 >lcl|XP_003129519.1|Plus1complement(102482..103441) NW_003535486 olfactory receptor 56A3-like LOC100521107 __SEG__ Chr9 {Sus scrofa} MLSYSNTSLSPEVSEFLLNCFVRSPSWQLWLSLPLSLLLLLAMGANATLLVTIRLEASLHQPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRAISFSACFLQMFIMNS
FLPMESCTFMVMAYDRYVAICKPLHYPSIVTNQFVAKATVFILVRNTLLSAPIPILSAWLHYCGKNIIENCICANLSVSKLSCDSVALNKIYQLIAAWTLLGSDLILIFF
SYVFILRAVLRLKAKGAAAKALSTCGSHFILILFFSTILLVFVFTHMAKRKVSPDVPVLLNVLHHVIPAALNPIVYGVRTKEIQQGIWKFLRKGSDSRK*
823 >lcl|XP_003129520.1|Plus1complement(124440..125495) NW_003535486 olfactory receptor 52E5-like LOC100521285 __SEG__ Chr9 {Sus scrofa} MYLRDLREGRAWDWHLKSVGKLSSDHEDGSSHNSTQFHPSSFILLGIPGLEHVHLWIGFPFCAVYLIALLGNVAILFVIQAEPGLHQPMFYFLAMLACTDLSLSTATIPK
MLGIFWFNSREILFGACLAQMFVVHLCTGLESGILTVMAVDRYVAIGNPLRYTAILTNKAVAILGAVTIVRSFLFVIPFVFLLLLLSFCGARIIPHTYCEHMGVARLSCA
SIRANHVFGMVAFSVGFVDLVIIGFSYGKILCTVLHLPSWKARSKALHTCGSHLCVMLIFYVPAFFSFLTHRFGHSIPGYLHIFLANLYMVAPPALNPIIYGVRTKQIRM
QVLRILNPKDLMLSRPNHADI*
824 >lcl|XP_003129522.2|Plus1complement(151744..152685) NW_003535486 olfactory receptor 52E5-like LOC100521636 __SEG__ Chr9 {Sus scrofa} MLQPNNTPFHPPSFLLTGIPGLEDVHVWLGFPFLAVYLVALLGNATILVVIQTERSLHQPMFYFLAMLACTDLGLSTATIPKMLGIFWFHLREIVFGACIAQMYTIHICT
GLESVVLTAMAIDRYVAICNPLRYSLLLTNKVMAILGGVILGRTLVFVTPFIFLILRLPFCQVRIIPHTYCEHMGLAKLACANIRVNVIYGLIAFSVGYIDLSVIGFSYV
QILRAVFQLPSWEARLKALSTCGSHVCVMLAFYLPALFSFMTHRFGHNIPHSIHILLANLYVVVPPALNPVIYGVRTKQIRERVLRMLNPKSY*
825 >lcl|XP_003129523.2|Plus1complement(166213..167148) NW_003535486 olfactory receptor 52E4-like LOC100521811 __SEG__ Chr9 {Sus scrofa} MPSLNDTPFHPPFFHLLGIPGLETVHLWIAFPFCAVYLIALVGNITILSVIKAEHSLHQPMFYFLAMLSLIDLGLSTSTIPKMLGIFWFNLQEISFGGCLAQMFFIHMFT
GMETVLLVAMAYDRFVAICNPLQYTAILTNKTVSILASVVVGRNLILVTPFVFLILRLPFCGHHIIPHTYCEHMGLARLACAPIGINVIYGLMVISNIIVDVVLIASSYV
LILRAVFRLPSREARLKALNTCGSHVCVMLCFYTPAFFSFMTHRFGHHIPRYVHILLANLYVVVPPALNPVIYGVRTKHIRERVVKILVQK*
826 >lcl|XP_003129524.1|Plus1complement(182877..183839) NW_003535486 olfactory receptor 52N2-like LOC100521984 __SEG__ Chr9 {Sus scrofa} MHGANSSSLTPTHFILSGIPGLEAAHVWISLPFCFMYVIAVTGNCGLMYIISHEEALHRPMYYFLALLSLIDISGCTSFVPNTLCIFWLRLKEIDFNACLVQMFFIHMLT
GMESGVLMLMALDRYVAICYPLRYATILTNTTIARAGLATFTRSVLLMMPFTFLIKRLPYCRGNLVQHTYCDHMSLAKLSCGNIKINAVYGLIAALLIGGFDMFCISLSY
TMIVRAVINLASADARHKAFSTCTSHISAIVITYVPAFFNFFTHRFGGRSIPHHVHILIANLYLLLPPTLNPIVYGVKTKQIREGVIKLFTREKDAFRVR*
827 >lcl|XP_003129526.1|Plus1229492..230433 NW_003535486 olfactory receptor 52N5-like LOC100522337 __SEG__ Chr9 {Sus scrofa} MLVSNNSYVPPQFFILNGIPGLERVHVWLSLPFCTMYIISLVGNLGLVYLIHHEESLHRPMYLFLAMLSLIDLLTCTTTLPNALCIFWFRLKEIDFNACLVQMFFVHGFT
GVESGVLMLMALDRYVAICYPLRYATILTNPVIAKAGLATFLRGVLLMIPFPFLVKRLPFCQSNVISHTYCDHMSVVKLSCASIKINVIYGLLVALLIGVFDIFCISVSY
TMILRAVVSLSSTDARQKAFGTCTAHISAIIITYVPAFFTFFTHRFGEHTIPPSLHIIVANLYLLLPPTLNPIVYGVKTKQIRDNVIKLLRGE*
828 >lcl|XP_003129531.1|Plus1complement(278133..279104) NW_003535486 olfactory receptor 52N4-like LOC100523266 __SEG__ Chr9 {Sus scrofa} MIMKMLNKTDLTPASFLLTGIPGLEDLHLWISFPFCSMYVVAVVGNCGLLYLICCEDSLHRPMYYFLAMLSLTDLVMCSSTIPKALSIFWFHLKEISFEECLVQMFFIYT
FTGMESGVLMLMALDRYVAICYPLRYATILTNPVIAKAGLATFLRGVLLVIPLIFFTKRLPYCRGNIIHHTYCDQLSVAKLSCGNIKANVVYGLMVALLIGGFDILCITV
SYTMILRAVVSLSSAEARQKAFSTCTAHICAIVFSYSPAFFCFFFNRFGSHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDCVIRILSGSKDTKSYST*
829 >lcl|XP_003129532.1|Plus1complement(284416..285387) NW_003535486 olfactory receptor 52N4-like LOC100523456 __SEG__ Chr9 {Sus scrofa} MIMKMLNKTDLTPASFLLTGIPGLEDLHLWISFPFCSMYVVAVVGNCGLLYLICCEDSLHRPMYYFLAMLSLTDLVMCSSTIPKALSIFWFHLKEISFEECLVQMFFIYT
FTGMESGVLMLMALDRYVAICHPLRYATILTNPVIAKAGLATFLRGVLLVIPLIFFTKRLPYCRGNIIHHTYCDQLSVAKLSCGNIKANVVYGLMVALLIGGFDILCITV
SYTMILRAVVSLSSAEARQKAFSTCTAHICAIVFSYSPAFFCFFFNRFGSHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDCVIRILSGSKDTKSYST*
830 >lcl|XP_003129534.2|Plus1complement(317044..318009) NW_003535486 olfactory receptor 52N4-like LOC100523809 __SEG__ Chr9 {Sus scrofa} MLVLNQTDMNPRSFLLTGIPGLEDLHLWISFPFCSMYVVAVVGNCGLLYLICCEDSLHRPMYYFLAMLSLTDLVMCSSTIPKALSIFWFHLKEISFEECLVQMVLVHTFT
GMESGVLMLMALDRYVAICYPLRYATILTNPVIAKAGLSTFLRGVFLIIPFTLLVKRLPFCRGNVIPHTYCDHMSVAKLSCGNIKANVVYGLMAALLIGGFDILCITVSY
TMILRAVVSLSSAEARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPTMNPVVYGVKTKQIQDCVIRILSGSKNTKSHDL*
831 >lcl|XP_003129536.1|Plus1complement(333583..334572) NW_003535486 putative olfactory receptor 52P1-like LOC100524159 __SEG__ Chr9 {Sus scrofa} MSHWQVSKLSLTTSNSFYDALFNRSSFTTFTLMGIPGLESQHLWLSFPFSFMFLATLIGNGAILFLVTTEPTLHTPMHLLLALLMAADLTSTLALVPKLLFLFWFNDRDI
AANACFTQMFFIHGASVVRSALLVAMAFDRFVAVCEPLRYNSVMSHFLVGRLGLVALAKGVILILPMPLLLQRLTFCRMAIPHTYCDHMAVVKLACDDTRPNRIYGLFVL
LLVVGLDLLLIGFSYGLILQAVIRLNSRDATCKALNTCSAHLFVILVTYGPALFSSLTHRIGHNIPPHAHILLANLYLLLPSVFNPIIYGIKMKEIQTKVAKCLCRGPP*
832 >lcl|XP_003129541.1|Plus1405091..406038 NW_003535486 olfactory receptor 52H1-like LOC100525239 __SEG__ Chr9 {Sus scrofa} MLTLNFTIFNPDAFVLVGIPGLEKLHIWIGIPFFSIYLVALAGNGILLYLIAVDHSLHEPMFFFLAMLASTDLVLSTTCVPSTLGILWLKSQEITFPGCLTQLFFLHFSS
FLESAILVGMAFDRYVAICSPLRYTSVLTPRAVVKILVGIVGRSFAVIFPVVFLVKRLPFCRTRTIPHTFCEHIGVARLACADISVNIWYGFAVPLMTVIADTVLIGISY
ALILHAVFHLPSRDARQRALGTCGSHVTVILLFYIPAVFSALTHRFGHNISQSFHIMFANLYVTIPPALNPIIYGVKTKQIKDKVILLFIPKGMQ*
833 >lcl|XP_003129542.1|Plus1complement(55813..56769) NW_003535487 olfactory receptor 52D1-like LOC100525938 __SEG__ Chr9 {Sus scrofa} MPASNSSEPGLPAALLLTGVPGLEWAHPWIALPFCALYLVALAGNAALVLVIVTDRTLHAPVYLFLCLLSLTDLALSSTTVPKTLAILWLQAGEISSAGCLAQMFCVHSI
YALESSVLLAMAFDRYVAVCHPLRYTTILNHAVIGRIGLLGICRSITVVSPLIFLLRRLPYCGHRVMAHTYCEHMGVARLACANITVNIVYGLTMALLAVGLDSILIAVS
YGFILHAVFCLPSRDAQHKALSTCGSHLGVIVAFYMPAFFSFLTHRFGQHRVPRHVHIFLANLYVLVPPVLNPIIYGARTTEIRSRLLRLPRLWKISA*
834 >lcl|XP_003129543.1|Plus166326..67270 NW_003535487 olfactory receptor 51I2-like LOC100526123 __SEG__ Chr9 {Sus scrofa} MGGNPHNSSEWPTFILTGLLGLETSQDWLFLLLGTLYAVSIVGNALILFIIKEEQSLHQPMYYFLSLLSVNDLGVSFSTLPTVLATFCFHFREISFDACMAQMFFIHLFS
FMESGILLVMSFDRYVAICKPLRYATVLSDGRVVRMGVSAFIRSFCLVFPLPFLLKRLPFCKANVLSHAYCLHPDLIRLPCGDITINNRFGLFIVITTFGLDPALILLSY
ALIVRSVLAIASREGRLKTLHTCVSHMCAVLIFYVPMVGVSMAARYGRHAPLHLHTLLSLVYLFVPPMLNPVIYSIKTKEIRQRLCRMLVGTNF*
835 >lcl|XP_003129544.2|Plus173626..74570 NW_003535487 olfactory receptor 51I2-like LOC100510920 __SEG__ Chr9 {Sus scrofa} MGSFGTNITGMTSFTLTGFPEMEGLEHWVAALLLLLYAVSILGNVLILFIVKEEQSLHQPMYYFLSVLSVNDLGVSLSTLPTVLATLCFRAPEAALDACLTQMFFIHFFS
WTESGVLLAMSFDRYVAICNPLHYSTVLTDTRVAHMGISITLRSFCMVFPLPFLLKRLPFCKDTVLTHSYCLHPDLIRLPCGDTTINSMYGLFIVISAFGVDAVLILLSY
ALILRSVLAIASQEERLKTFHTCVSHVCAVLIFYVPMVSVSMVHRFGKHAPEYIHKFMSLVYLFVPPVLNPIIYSVKTKEIRKRLHKMLLGPKH*
836 >lcl|XP_003129545.1|Plus1complement(80201..81139) NW_003535487 olfactory receptor 51I2-like LOC100511094 __SEG__ Chr9 {Sus scrofa} MGLFNVTHPAFFLLTGIPGLESSQIWLAGPLCVMYAVALGGNAVILQAVRVEPSLHEPMYVFLSMLSGSDVAMALATLPTVLRTFCLNARTIDFDACLIQMFLIHSFSMM
ESGILLAMSFDRYVAICDPLRYAAVLTSEVIAGMGLAVTARSFIILFPLPFLFKRLPICRSNVLSHSYCLHPDMMKLACADITINSIYGFFVLVSTFGMDLLCIVLSYVL
ILRSVMAIASREERLRALNTCVSHILAVLAFYVPMIGVSVVHRFGKHAPRYVHILLSNIYLFVPPVLNPLIYSAKTKEIRRAIARMSHRITV*
837 >lcl|XP_003129546.1|Plus1complement(89145..90083) NW_003535487 olfactory receptor 51I2-like LOC100511274 __SEG__ Chr9 {Sus scrofa} MGLFNVTHPAFFLLTGIPGLESSQIWLAGPLCVMYAVALGGNAVILQAVRVEPSLHEPMYVFLSMLSGSDVAMALATLPTVLRTFCLNARTIDFDACLIQMFLIHSFSMM
ESGILLAMSFDRYVAICDPLRYAAVLTSEVIAGLGLAVTARSFITLVPLPFLFKRLPICRSNVLSHSYCLHPDMMKLACADIAINSIYGLFVLVSTFGMDLLCIVLSYVL
ILRSVMAIASREERLRALNTCVSHILAVLAFYVPMIGVSVVHRFGKHAPRYVHILLSNVYLFVPPVLNPLIYSAKTKEIRRAIARMSHRITM*
838 >lcl|XP_003129547.1|Plus1complement(115843..116817) NW_003535487 olfactory receptor 51Q1-like LOC100511465 __SEG__ Chr9 {Sus scrofa} MKLRSSASSEGTNSTQEPFSFLLTGIPGFESAHVWISIPFCCLYAISMVGNASILVVIRTEPALRQPMYLFLSMLALTDLGLTLTTLPTVMPLLWFNAQEIGFEACFAQV
FFIHTFSFMESSVLLAMSFDRYVAICRPLHYATILTSQVIGGIGSAILCRSVLAVLPSLLLLKRLPFCRSHLLSHSYCLHQDMIRLVCADIRVNSWYGFAVALLIIVMDP
LLIVLSYTLILRSILGTASWTERLRALNNCLSHVLAVLVLYVPMVGVSVTHRFAKHASPLVHVIMANVYLLAPPVMNPIIYSVKTKQIRQGIMHLFSQRNMLLR*
839 >lcl|XP_003129550.2|Plus186093..87052 NW_003535488 olfactory receptor 51G2-like LOC100512549 __SEG__ Chr9 {Sus scrofa} MAAANCSRTLSWTFYLSGIPGHEDFHPWISLPFCLLYLAGVVGNCTILHVVWTDPRLHEPMCYFLAMLSLTDMGMSLPTMPSLFRVLWSRSREIQFSSCVVQMFLIHTFS
FTESSVLLAMALDRYVAICHPLRYATLLTPALIAKVGIAALLRSAVAMIPLLARLAFFPFCGSHVLSHSYCLHQDMIRLACADTRFNVIYGLVLITALWGLDSLGIFVSY
VFILRSVLGISSPEGRWKALNTCVSHICAVLILYVPMIGLSVVHRFATQSPPLVHILMAHIYLLVPPVLNPIIYSVKTKQIRQGVLRLLFPPKIGSAVM*
840 >lcl|XP_003129555.1|Plus1complement(74132..75085) NW_003535489 olfactory receptor 51I2-like LOC100514244 __SEG__ Chr9 {Sus scrofa} MKNANSSLAFLPTAFILVGIPGLETEHTWTPILFCLMYFIIFLGNGTILHVIRTDTALHQPMYFFLAMLALAEVGVSASTLPTVLGVFLLGATEIGFDACLLQMFSIHSF
SITESAVLLAMSVDRFVAICNPLRYTAILTAPRICGTGAIIGLRSIILMAPLPMLLRRLPFCGHNTLSHSYCLHPNLIHLPCGDISINNIYGLFIVSSTFGLDSLLIVVS
YGLILHTVLSITTGMGRRKALSTCGSHVCAVLAYYVPMIGLSMVHRFGHHAPPWVPTTMASAYLFFPSIVNPIVYSIKTKDICRGIARMLSEKRARV*
841 >lcl|XP_003129556.1|Plus1complement(13439..14395) NW_003535489 olfactory receptor 51L1-like LOC100514417 __SEG__ Chr9 {Sus scrofa} MLAFNHSASNWPTFSLLGIPGLEAAHIWISIPFCLLYTLALAGNALLLILVRAEQNLHAPQFYFLAVLALTDLGLSLSTLPSVLAIFWFDVRRIGLDACLSQMFFIHTLS
SVESGVLVAMAFDRLVAVCAPLNYTRILTRHTVAWLSGAALIRGASLLAPLPFVLRAFPFCGATGLSHSYCYYPDVLNLACGDVSVSSAYGLAFVLCTFAVDAVFILASY
VKILGTLLKLGPPGRTWKALHTCACHLCTVCVFYLPLLSLAVLHWYTHHTSPVLYSTMSDAYLLVTPLLNPLVYSLKSQQIQAALRKRFGVQRVVAGE*
842 >lcl|XP_003129557.1|Plus1complement(61356..62315) NW_003535489 olfactory receptor 51G2-like LOC100514592 __SEG__ Chr9 {Sus scrofa} MAAANCSHTLSWTFYLSGIPGHEDFHPWISLPFCLLYLAGVVGNCTILHVVRTDPRLHEPMCYFLAMLSLTDMGMSLPTMPSLFRVLWSRSREIQFSSCVVQMFLIHTFS
FTESSVLLAMALDRYVAICHPLRYATLLTPALIAKVGIAALLRSAVAMIPLLARLAFFPFCGSHVLSHSYCLHQDMIRLACADTRFNVIYGLVLIMALWGLDSLGIFVSY
VFILRSVLGISSPEGRWKALNTCVSHICAVLILYVPMIGLSVVHRFATQSPPLVHILMAHIYLLVPPVLNPIIYSVKTKQIRQGVLRLLFPPKIGSAVM*
843 >lcl|XP_003129559.1|Plus1158655..159605 NW_003535489 olfactory receptor 52A5-like LOC100514973 __SEG__ Chr9 {Sus scrofa} MFQRNDTVFMPSVLRLTGIPGLEPVQAWIGIPFCAMYVLALFGNSLLLVAIKSERSLHEPMCLFLAMLGATDVMLSTCILPKMLGIFWFHSPEIDFDACLFQMWLIHSFQ
CIESGVLLAMALDRYVAICDPLRHAAIFTPQLVTRIGVAVTLRAALLVAPCLILIKCRLKHYRTTVVSHSYCEHMAVVKLAAEDVRINKIYGLFVAFIVLGFDIIFITLS
YIRIFVTVFSLPQREARLKAFNTCVAHICVFLEFYLLAFFSFFTHRFGFHIPPYVHILLSNLYLLVPPLLNPVVYGVKTKQIRDRVSRMLRSVGAS*
844 >lcl|XP_003129560.1|Plus113647..14588 NW_003300505 olfactory receptor 51V1-like LOC100515268 __SEG__ Chr9 {Sus scrofa} MSAASASIVNSSVFILTGLPGLEQYYLWFAVPFSCIYAVVFLGNCLVLHVIRTEPSLHQPMFYFLAMLAVTDLCMGLSTVHTVLGVLWGLGREVSLDACIAQTYFIHGLS
LTESGVLLAMAFDRFTAICNPLRYTAILPNSRVTRLMVSILMRSALSILPVIIRLRFFHYCRPHLLSHAFCLHQNLLRLACSDVRFNSVYALALVICTLLLDAVLILVSY
VLILRAVLAIASPTGRLKSLQTCVSHLCAVLVFYIPSIGLTTVHRFGQHLSPLVHVLMGNVYILFPPLMSPAVYSVKTQQIRSRMEKWFSLKR*
845 >lcl|XP_003129561.1|Plus122771..23721 NW_003300505 olfactory receptor 52A5-like LOC100515441 __SEG__ Chr9 {Sus scrofa} MFQRNDTVFMPSVLRLTGIPGLEPVQAWIGIPFCAMYVLALFGNSLLLVAIKSERSLHEPMCLFLAMLGATDVMLSTCILPKMLGIFWFHSPEIDFDACLFQMWLIHSFQ
CIESGVLLAMALDRYVAICDPLRHAAIFTPQLVTRIGVAVTLRAALLVAPCLILIKCRLKHYRTTVVSHSYCEHMAVVKLAAEDVRINKIYGLFVAFIVLGFDIIFITFS
YIRIFVTVFSLPQREARLKAFNTCVAHICVFLEFYLLAFFSFFTHRFGFHIPPYVHILLSNLYLLVPPLLNPVVYGVKTKQIRDRVSRMLHSVGAS*
846 >lcl|XP_003129562.1|Plus1complement(120092..121027) NW_003300505 olfactory receptor 52A1-like LOC100515618 __SEG__ Chr9 {Sus scrofa} MSISNVTIPTPSVLTLTGIPGLESVQSWIGIPFCAMYLTAVLGNSWLLSIIRSERSLREPMYMFLGMLAVTDIALSTSVVPKMLGIFWFHVSEIYFDACLLQMWLIHTFQ
GIESGILLAMAMDRYVAICSPLRHAAIFTQQLVTQIGVAVTLRAAILVAPCLILIKCRLHFYHTTVISHSYCEHMAIVKLAAGNIRVNKIYGLFVAFTVVGFDLTIITLS
YVQIFMAVFRLPQKEARLKAVHTCVPHICVFLQLYLLAFFSFFTHRFGGHIPPYIHILFSSIYLVVPPCLNPLVYGAKTKQIRIHVVKLFS*
847 >lcl|XP_003129564.1|Plus126956..27960 NW_003535489 olfactory receptor 51G2-like LOC100516685 __SEG__ Chr9 {Sus scrofa} MFPISSNDSVISTFLVTGTPGLEAVHTWISIPFCAMFLVTLVGNTTIMAVIWKEHPLHVPMYLLLAMLAASDLGLSLFTFPTMLGIFWLDARELPFSACFAQMFFIHTFQ
DLESGVILAMAFDRYVAISHPLRYSSILTNGVIARIGLAITARTLTVQVPLPILLRRLCFCRSNVLSHPYCLHPDIIKLSCSNTRVNSILGLCVVLSTMGLDFFLILISY
VLILKTVLSLASHGGRLKALSTCVSHLSAVTLFFTPMICLSLLHRFGPRLPWHIYVTMANVHFLIPPVMNPIVYVVKTKQIRERILKLFLKKGPGGSQVTFSMGMSTDKQ
KNAS*
848 >lcl|XP_003129565.1|Plus1complement(33921..34868) NW_003535489 olfactory receptor 51L1-like LOC100517046 __SEG__ Chr9 {Sus scrofa} MVFFNSSSYKPFLLTGFPGAEASHPLISVLFCVLYLIALTGNLTILGVIWVEESLHAPMYLFLAMLAASDLGLCAATMPTLLQLFWFNVREIDMDACLVQMFFIHVFSLT
ESGILLTMAFDRYVAISNPLRYTTLLTSSTIANIGVGLLARAVAVIFPGPFLIKRLRFCEANVLSHSYCLHPDIIKLSCSDHRISSIYGLVMILTTFGVDAALILLSYVK
ILITVLGIASREEQLKALNTCVSHVCAVLLVYVPMIGVSVIHRFGKHVPPVVHIIMGYIYLLMPPVLNPVVYCIKTQEIRTRILGNLLKLQQKGR*
849 >lcl|XP_003129566.1|Plus1complement(71376..72362) NW_003535489 olfactory receptor 51G1-like LOC100517411 __SEG__ Chr9 {Sus scrofa} MAPWASLVTAPGSNASSGPPASFYLTGIPGSENVQPFLSLPFCVLYLTGTVGNCTILHIIHTDQRLHEPMYYFLAMLALTDLGMSISTLPTVLKTFWFDAKEIEINACVA
QMYFIHTFSLMESAVLLAMALDRYVAICDPLRYCSKLTPRRIVYIGGFIVIRCSPVLPVILVRIPRLSFCHSHVLSHSFCLHQDIIRLACADISFNVLFGLFVVVFYWGV
DALGIFLSYAFIFRSVLRIASKRGKLKALNTCASHICAVLILYVPMIGLSLVHRFAKHSSPVIHVTMANVYLLVPPVLNPIIYSIKTKQIRQGFLRILFSKRVGLAPT*
850 >lcl|XP_003129567.1|Plus1136848..137804 NW_003535489 olfactory receptor 52Z1-like LOC100517595 __SEG__ Chr9 {Sus scrofa} MTASCNDTSLRDIWYSMTGIPGLEEAHTWISIPICSMYIVAVVGNALLLFLVSTERRLHEPMYLFLSMLALADVFLSTATTPKMLAIFWFQDGGISFGSCVCQMFFLHFI
FVAESAILLAMAFDRYVAICHPLRYAAILTPSVIGKVGIAIVTRSFLICFPLVFLVYRLTYCGRRVIRHSYCEHMGIARLACDSIKVNIYYGVIAALFSVCLDVVLIIIS
YALILRAVFRIPSQDARLKALSTCGSHVCVILLFYTPAFLSVLAHRFGGHSIPLHVHILLANLYVVIPPALNPIIYGAKTKQIQEKLTRVFSLTNKCC*
851 >lcl|XP_003129569.1|Plus1complement(7159..8103) NW_003300505 olfactory receptor 51V1-like LOC100518500 __SEG__ Chr9 {Sus scrofa} MPAISVFNVNSSRFILTGFPGLEGDYFWLSIPFSSIYATVFLGNCMVLHVIRTEPSLHQPMFYFLAMLAVTDLCVGLSTVHTVLGVLWGLSREVSLDACIAQSYFIHGLS
FVESSVLLAMAFDRYVAICNPLRYSSILTNDKVMKIGVAILCRSSLLIPPVIIRLKFLNYCRPHVLSHSFCLHQDLIRMACSDIRFNSVYGLALVISNLLLDAVLIILSY
LRILRAILAAASREGRSKSLQTCGSHLCAVLVFYIPVIGLTMVHRFGRHLSPVVHVLMGNVYILFPPLMNPIIYSIRTQQIRRRVQRLFSLKGM*
852 >lcl|XP_003129571.1|Plus1complement(57075..58031) NW_003300505 olfactory receptor 51V1-like LOC100518850 __SEG__ Chr9 {Sus scrofa} MPAFAACDTNASTFLLAGFPGLEQHYPWLSIPFSCIYTVVLSGNCLVLHVIRTEPSLHQPMFYFLAMLAVTDLCMGLSTVHTVLGVLWGLGREVSLDACIAQTYFIHGLS
LTESGVLLAMAFDRFTAICNPLRYASILTNARIINIGLGILVRSFMFIVAPIIRLKFFRYCRSHVLSHSFCLHQDLLRLACSDIRFNSVYALALVICTLLLDSVLILVSY
IRILHSVLAIASREERLKSLQTCVSHLCAVLVFYIPVIGLTMVHRFGRHLSPVVHVLMGNVYIIVPPLMNPIIYSVKTQQVRGRIRRWFPKTSLRPRG*
853 >lcl|XP_003129572.1|Plus163104..64060 NW_003300505 olfactory receptor 51V1-like LOC100519039 __SEG__ Chr9 {Sus scrofa} MSVGPDSKLSNSTFLLAGFPGLEQHYPWLSIPFSCIYAVVLSGNCLVLHVIRTEPSLHQPMFYFLAMLAVTDLCMGLSTVHTVLGVLWGLSREVSLDACIAQSYFIHGLS
FVESSVLLAMAFDRFTAICNPLRYASILTNARIINIGLGILVRSFMFIVAPIIRLKFFRYCRPHVLSHSFCLHQDLLRLACSDIRFNSVYALALVICTLLLDSVLILVSY
IRILHSVLAIASREERLKSLQTCVSHLCAVLVFYIPVIGLTMVHRFGRHLSPVVHVLMGNVYIIVPPLMNPIIYSVKTQQVRGRIRRWFPKTSLRPRG*
854 >lcl|XP_003129573.1|Plus1complement(72029..72994) NW_003300505 olfactory receptor 52A5-like LOC100519205 __SEG__ Chr9 {Sus scrofa} MPIANGTVLMPSVLALIGIPGLETVQRWIGIPFCAMYIIALMGNSLLLVIIQSEPRLQEPMYIFLAMLGATDIALSTSIVPKMLGIFWFHLPEIYFDACLFQMWLIHTFQ
GIESGVLLAMALDRYIAICYPLRHATIFTRQLVANIGVGVTLRPAMLVIPCLLLIKCRLKLYRTKLIAHTYCEHMALVKLATEDVFINKLYGLLGAFTVGGLDFLLITLS
YTQIFITVFRLPQKEARLKAFNTCIPHICVFFQFYLLAFFSFFTHRSGTYFPSYIHITLSNLYLLVPPFLNPFVYGVKTKHIRDKAIKMFRSREFPQWLRG*
855 >lcl|XP_003129574.1|Plus1complement(79546..80502) NW_003300505 olfactory receptor 52A5-like LOC100519378 __SEG__ Chr9 {Sus scrofa} MLTFNGSVFMPSVLTLIGIPGLESVQCCIGIPFCVMDLIALSGNSLILVIVKHESNLHRPMYIFLAMLGATDIALSTCILPKMLGIFWFHLPDISFEACLLQMGLIHSFQ
AIESGVLLAMALDRYVAICNPLRHASIFSRQLLTHMGVGVTLRAAILTAPCLVLIKCRLKHYRTTVISHSYCEHTALVKLAAEDIRIHKIIGLFVAFTILGLDIIVITVS
YISIFITIFQLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHIPPCVHILLSNLYLLVPPFLNPIVYGVKTKQIRDHVLNVFFSKRHLDH*
856 >lcl|XP_003129579.1|Plus1complement(204191..205129) NW_003300505 olfactory receptor 51B2-like LOC100520442 __SEG__ Chr9 {Sus scrofa} MWPNISAAPFVLTGFPGLEAAHPWASIPLLVAHSSVLLGNGSLLSLIRAERSLHQPMYYFLAMLAGTDLTVTLATMPTVLGVLWLNQREISHGACFLQAYCIHSLSIVES
GILLAMACDRFIAIRHPLRYAAVLTNTHVVRVGMGAFVRGFLSILPVILRLFSFPYCHSHVLAHAFCLHQEVMTLACADTTFNRLYPVVLISFTVFLDALIILFSYILIL
KAVVGLASGEERSKALNTCISHIGCVLIFYVTVIGLSFVHRFGRNVPQVVHVTMSYIYFLFPPLMNPIIYSIKTKQIQHGILRLLSKHRLGC*
857 >lcl|XP_003129605.1|Plus1complement(47093..48049) NW_003535491 putative olfactory receptor 51H1-like LOC100511338 __SEG__ Chr9 {Sus scrofa} MAGNNHSHFQHLYFVLTGIPGLEQKYYWMAFPLGATYVIALLGNAVITSTIKSELSLHIPMYYFLSMLALADMGLALCTMPSVLGIFWFNYRSIAFDACLVQMYFIHTFS
AIESGVLVAMAFDRVVAIWNPLRYGTILTSGVVCRTGAVILTRAVCVVFPVPFLIKRLPFYRSNLLSHSFCLHQDVMRLACASTRVNSLYGLVAVIFTKGCDSLSILFSY
VFILRTVMAIAAGQGRLKALNTCVSHICAVLIFYVPLIGVSVTHRFGKHLSPLTHALMANAYLLVPPVLNPIVYAVKTKEIRRKLIEMFVQTKITAGG*
858 >lcl|XP_003129606.1|Plus1complement(83993..84943) NW_003535491 olfactory receptor 51F2-like LOC100511520 __SEG__ Chr9 {Sus scrofa} MLVLNSTDTQPLTFLLTGIPGLRAAQVWASIPFCLLYAIALSGNGMILLAVLREKRLHEPMYYFLSMLSATDLSLSLCTLSTTLGVFWFEARKINLNACIAQMFFLHGFT
FMESGVLLAMAWDRFVAICDPLRYTTVLTNARIAQIGVSMLMRNVAVMLPVVLFVKRLSFCGSTVLSHSYCYHVDLIQLSCTDNRINSILGLFALFSTTGFDCPCILLSY
VLIVRSVLSITSSEGRQKTFNTCISHLSAVAIFYIPLISLSLIHRYGHSAPPFVHSIMANIFLLIPPVLNPVIYSVRTKQIQKAIAKVILQKQLQI*
859 >lcl|XP_003129607.1|Plus1130281..131240 NW_003535491 olfactory receptor 51F1-like LOC100511705 __SEG__ Chr9 {Sus scrofa} MLQIQDNREILGNSTSEAPMFLLTGIPGLESVHPWISVPFCCLYTAALSGNGMILFVVITQQSLHEPMYCFLSMLSAADLGLTVSTMSTTLGVFWFDATEISLDACILQM
FFLHGFTVAESGVLVAMAFDRCVAICDPLRYTAILTHDRIIQVGFLMTLRSAVVIVPLLLLLKPLSFCGGNVLSHSYCYHPDVIKLACSDTRANSACGLAALLLTSGVDT
PCIVLSYILILRSVLRIASPQERHKVFSTCVSHIGAVAVFYIPMISLSLGHRFGQATPKVVHSLMADVYLLLPPVLNPIIYSVKTQQIRKAVLSLLLTK*
860 >lcl|XP_003129608.2|Plus1complement(175057..176001) NW_003535491 olfactory receptor 51F2-like LOC100511888 __SEG__ Chr9 {Sus scrofa} MPSFNQSIFQPAVFFLTGIPGFETYHAWISIPFCCLYAIAISGNSMILFVIITEPSLHEPMYYFLSMLSFTDLGLCLSTLVTMVGIFWFNAREISLDACIGQMFFIHGFT
FMESSVLLAMAFDRFIAICNPLRYATILTNSRIIKAGFAILIRGTTALVPLLLLLKRLSFCRSRVLHHSYCFHPDVMKLSCTDTKINSAFGLAIVIATAALDLVLILLSY
VLIIHSVLSIASPEEREKVFGTCVSHLSAVAIFYIPMISLSLVHRFGRHAPPLAHTLIANIYLLIPPVMNPIIYSVKTKQIRKAMLRIFLPKLI*
861 >lcl|XP_003129612.2|Plus1complement(15477..16457) NW_003535491 olfactory receptor 51T1-like LOC100513166 __SEG__ Chr9 {Sus scrofa} MSFNNTTSSPSTFLLTAFPGLERAHVWISIPVCCLYIVALLGNSTILFIITAERRLHKPMYYFLSMLSAVDLCLTISTLPTVLGVLWFHAREISFNACFIQMFFVHAFSF
LESSVLAVMAFDRFMAICNPLKYAAVLKGKMIMAIGLAIFLRQILFIVPVVLFLKGVSFQGGKELSHPFCYHPDLIRYTISSPWISSFLGLFLQLYWTGTDLLFILFSYV
LIIRTILSIVAPKKQRKALNTCVCHICAVTVFYVPMISLSFTHRLLSSTPRVICSILANVYLLVPPVLNPIIYSLKTKTIRRALLQLLRSKSARGRTMRGLRGSWD*
862 >lcl|XP_003129613.1|Plus1complement(21985..22917) NW_003535491 putative olfactory receptor 51H1-like LOC100513367 __SEG__ Chr9 {Sus scrofa} MSPFNQTTGNRQTFTLTGIPGMPEKDFWLALPLCLLYSFTFLGNVTILVVIKVERSLREPMYYFLAMLAATDLSLSWSSMPTMVSVHLFNWRSVALDACITQMFFIHAFG
GVESGVLVAMAFDCFVAIRFPLHYGAITKSGAAVLLRSVGLVLPVPFLLKRLPFCHSNILSHAYCLHQDAMRLACADTSINSIYGLLAVIFAIVLDALILLVSYFLILQA
VLGIASSEERLKALNTCLSHICAVLLFYVPLIGMTLSHRFGKHLSPVVHTAMANIYLLLPPVLNPVVYSVRTKQIRQRIVLVFRRGRVGS*
863 >lcl|XP_003129614.1|Plus137015..37965 NW_003535491 putative olfactory receptor 51H1-like LOC100513557 __SEG__ Chr9 {Sus scrofa} MLNPNASHAAHHSFILTGIPGMPDKNLWMAFPLGFLYTLTLLGNGTVLAVIKADQSLHEPMYHFLSILALADVGLSMSTLPSMLSIFWFNVPEIPFDACITQMFFIHGFG
VVESGVLVSMAFDRCVAIRDPLRYASILTQGIIGKIGVAVVTRAICVVFPVPFLIKRLPFCRSNVLSHSYCLHQDAMRLACASTRINSLYGLIVVIFTLGLDALSILFSY
VLILKTVLSIASRTERLKALNTCLSHICAVLLFYVPLIGVTMIHRFGKHLSPVVHTLMANIYLLLPPVLNPIVYSVKTKQIRSRIVHVFQRTRNRV*
864 >lcl|XP_003129615.1|Plus175022..76077 NW_003535491 olfactory receptor 51S1-like LOC100513749 __SEG__ Chr9 {Sus scrofa} MSTFLTHSAPNTSTSMAPTFLLVGMPGLSAVPSWWAIPLITIYLLSALGNGAILWIIALEPTLHRPMYFFLFLLSVSDVGLATALMPTLLGLALTDAHDVSASACLLQMF
FVHVFSIMESSVLLAMAIDRALAICRPLRYPTLLTSDVVSKIGMAIAFRCLGLHLPLPFLLAHMRYCHPQVLTHSYCLHPDMARLACPGAWGAIYSLFVVLSAMGLDPLL
IFFSYGLIGRALQGLGSREDRWKAGQTCAAHLLAVLLFYVPMTLLALVDRLRVPLPQPAHTLLSYVHFLLPPLINPILYSVKMKEIRERIFKRMKPRKVGCAQRGGCASM
CGGSRLPDTKVSMTENSVHRA*
865 >lcl|XP_003129618.1|Plus1120459..121394 NW_003535491 olfactory receptor 51F1-like LOC100514307 __SEG__ Chr9 {Sus scrofa} MLSVGNSTPPSFFLTGVPGLEAFHIWLSIPFCCLCVIALLGNSTILYAVITDSSLHEPMYYFLSLLSTTDIGITASSLPTTLGVLWFNARIISLDACIVQMFFLHGFTLM
ESSVLLAMAFDCFVAICNPLRYAVILTSSRIIKAAVVIFVRMLVNLMPLLLLLKRLSFCGSNMLSHSYCYHPDVIKCSCSSIKVNSICGLVALILTSGIDIPCIFLSYVL
IIKSILSIASPEERKRAFGTCISHLGAVAIFYVPWVILALVHRFGHNAPPYVHTLMSNLHFLFPPVLNPIIYSVKTKQIRKAFRKFFPNTG*
866 >lcl|XP_003129620.2|Plus1193561..194283 NW_003535491 olfactory receptor 51F2-like LOC100514861 __SEG__ Chr9 {Sus scrofa} MSHFQNTTSSSITFLLTGVPGLEASHTWISIAFCFLYVTALSGNSLILLVIVTQSSLHAPMYYFLSMLSTTDLGLSVSTLVTTMGIFWFNAREITFNACLSQMFFIKLFT
VMESSVLLAMAFDRFVAISNPLRYATILTDSRIIQIGVAIVIRGTLTLTPMVALLTRLSFCHSLVLHHSYCFHPDVMKLSCTDTTVNNAAGLTALISTVGVDSVLIPFSY
VLIMKLLDSVERIRNRFLLH*
867 >lcl|XP_003129624.1|Plus1complement(291465..292418) NW_003535491 olfactory receptor 52M1-like LOC100516094 __SEG__ Chr9 {Sus scrofa} MLTFHNVCSEPSSFQLTGIPGLEALHIWLSIPFGSMYLVAVVGNVTILAAVRVEHGLHQPMYFFLCMLAVIDLVLSTSTMPKLLGIFWFGAGDIGLDACLAQMFLIHCFA
TVESGIFLAMAFDRYVAICDPLRHTTVLTHAVVGRLGLAALFRGVLYIGPLPLMIRLRLPLYKARVIAHSYCEHMAVVTLACGDSRVNNIYGLGIGFLVLILDSVAIAAS
YVMIGRAVMGLTTPEARLKALGTCGSHICAILIFYVPTAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRERILQILNIGTKIR*
868 >lcl|XP_003129625.1|Plus1377921..378865 NW_003535491 olfactory receptor 52K1-like LOC100516453 __SEG__ Chr9 {Sus scrofa} MSVTNSTSSHPAAFLLVGIPGLEHLHIWISIPFCFAYTLALLGNCTLLFIIQADTALHEPMYLFLAMLAAIDLVLSSTTLPKMLAIFWFRDQEINFYACLVQMFFLHSFS
IMESALLLAMAFDRYVAICRPLHYTTVLTGPLITKIGLAAVTRAVTLMTPLPFLLRRFHYCRGPVIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLTSQEARYKAFGTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMVNPIIYGVKTKQIRGHVLSLFQRKDV*
869 >lcl|XP_003129626.1|Plus1142651..143604 NW_003535492 olfactory receptor 52M1-like LOC100516631 __SEG__ Chr9 {Sus scrofa} MLTFHNVCSEPSSFQLTGIPGLESLHIWLSIPFGSMYLVAVVGNVTILAVVRVERSLHQPMYFFLCMLAVIDLVLSTSAMPKLLGIFWFGAGDIGLDACLAQMFLIHCFA
TVESGIFLAMAFDRYIAICDPLRHTTVLTHTVVGRLGLAALFRGVLYIGPLPLMIRLRLPLYKARVIAHSYCEHMAVVTLACGDSRVNSIYGLGIGFLVLILDSVAIAAS
YVMIGRAVMGLTTPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRERILQILKIGTKIR*
870 >lcl|XP_003129627.1|Plus191209..92153 NW_003535492 olfactory receptor 52K1-like LOC100516818 __SEG__ Chr9 {Sus scrofa} MSVTNSTSSHPAAFLLVGIPGLEHLHIWISIPFCFAYTLALLGNCTLLFIIRADTALHEPMYLFLAMLAAIDLVLSSTTLPKMLAIFWFRDQEINFYACLVQMFFLHSFS
IMESALLLAMAFDRYVAICRPLHYTTVLTGPLITKIGLAAVTRAVTLMTPLPFLLRRFHYCRGPVIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLTSQEARYKAFGTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMVNPIIYGVKTKQIRGHVLSLFQRKDV*
871 >lcl|XP_003129628.1|Plus173880..74824 NW_003535492 olfactory receptor 52K1-like LOC100516988 __SEG__ Chr9 {Sus scrofa} MSASNSTSSHPAAFLLVGIPGLEHLHVWISIPFCFAYTLALLGNCTLLFIILVNTALHEPMYLFLAVLAAIDLVLSSTTVPKMLAIFWFRDRAINFYTCLVQMFFLHSFS
IMESALLLAMAFDRYVAICRPLHYTTVLTGPLITKIGLAAVTRAVTLMTPLPFLLRRFHYCRGPVIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIAVLDLFFVILSY
IFILRAVLQLTSQEARYKAFGTCVSHIGAILAFYTPAVISSVMHRVARRAAPHVHILFANFYLLFPPMVNPIIYGVRTKQIREQVLGLFLRKDV*
872 >lcl|XP_003129629.1|Plus1complement(180110..181054) NW_003535492 olfactory receptor 52K1-like LOC100517176 __SEG__ Chr9 {Sus scrofa} MSASNITSTHPAVFLLMGIPGLEHLHIWISIPFCSAYTLALLGNCTLLFIIRADTALHEPMYLFLAMLAAIDLVLSSTTLPKMLAIFWFRDQEINFYACLVQMFFLHSFS
IMESALLLAMAFDRYVAICRPLHYTTVLTGPLITKIGLAAVTRAVTLMTPLPFLLRRFHYCRGPVIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILQAVLKLASQEARYKAFGTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILFANFYLLFPPMVNPIIYGVRTKQIRERVLGLFLRKDV*
873 >lcl|XP_003129630.1|Plus1complement(110518..111462) NW_003535493 olfactory receptor 52B4-like LOC100517357 __SEG__ Chr9 {Sus scrofa} MLSFNRTGVSHTVFYLLGIPGLEDQHLWISIPFFLSYVIALLGNSLLIFLILTRRSLHEPMFLFLCMLAGADLVLSTCTVPQALAIFWFHAGEISLDRCITQLFFIHSTF
ISESGILLVMAFDRYVAICYPLRYNTILTHPLIRKIGVTIVLRSYCTVFPVIFLMKRLTFCKNYILPNTACKHIVLAKISCNDIRLNIWYGFFVLMSTLVLDVVLIFVSY
VLILRAIFHMPSRDARHKALSTCGSHVCVIILFYGPGIFSVLTQRFGHHIPLHSHVLLANVYILIPPMLNPIIYGVKTKQIWDLLVHLLFPRQK*
874 >lcl|XP_003129631.1|Plus1128248..129192 NW_003535493 olfactory receptor 52B4-like LOC100517545 __SEG__ Chr9 {Sus scrofa} MLSFNHTGVSHTVFYLLGIPGLEDQHLWISIPFFLSYVIALLGNSLLIFIILTRRSLHEPMFLFLCMLAGADLVLSTCTVPQALAIFWFRAGEISLNRCISQFFITHCIF
MSESGILLVMAFDRYVAICYPLRYTTILTHTLIGKIGVTIFLRSYCTIFPIIFLLKRLTFCRNNVIPHTYCEHIGLAKYACNDIRVNIWYGLFVIVSTVVLDVLLIFVSY
MLILRAVFHMPSQDARHKALNTCGSHVSVIILFYGPGIFTTLTQRFGRHIPAHIHILLANVCVLAPPMLNPIIYGIKTKAIREQVAHLFFLKQK*
875 >lcl|XP_003129632.1|Plus1complement(30193..31137) NW_003535493 olfactory receptor 52B4-like LOC100517905 __SEG__ Chr9 {Sus scrofa} MTALNHTGVSHTVFYLLGIPGLEDQHLWISIPFFISYVTALLGNSLLIFLILTRRSLHEPMFLFLCMLAGADLVLSTCTVPQALAIFWFRAGEISLDRCITQLFFIHSIF
IFESGLLLVMAFDRYVAICYPLRYTTILTHTLIGKIGVTIVLRSYCAIFPIIFLLKRLTFCRSNVLPHTGCEHIGLAKYACNDIRVNIWYGLFVIVSTLFLDVLLIFVSY
MLILRAVFHMPSQDARHKALNTCGSHVSVIILFYGPGFFTTLTQRFGRHIPAHIHILMANVCVLVPPMLNPIIYGIKTKAIREQVTHLLFPKQK*
876 >lcl|XP_003129633.2|Plus151710..52663 NW_003535492 olfactory receptor 52M1-like LOC100518266 __SEG__ Chr9 {Sus scrofa} MFMSNNACLAPTSFRLTGIPGLESLHLWLSIPFSSMYLLAVVGNVAILAVVKVERSLHQPMYFFLCMLAVSDLVLSTSTMPKLLAIFWFGARRIDLEACLAQMFFIHCFA
TVASGIFLAMAFDRYVAICEPLHHASVLTRAMVGRLGLAALLRGVLYIGPLPLMIRLRLPLYRAQIIAHSYCEHMAVVTLACGDTTINNLYGMGIGFLVLILDSLAISAS
YVMIFRAVMRLSTPEARLKTLGTCSSHICAILVFYIPIAVSSLAHRFGRHVPPHVHILLANFYLLIPPILNPVVYAVRTRQIRERLLHILKAGSQPK*
877 >lcl|XP_003129634.1|Plus1complement(157897..158844) NW_003535493 putative olfactory receptor 52P1-like LOC100518442 __SEG__ Chr9 {Sus scrofa} MHFTNHSHQNPTSFLLMGIPGLEASHFWIAFPFCSMYALAVLGNMAVLLVVRSEPALHQPMYLFLCMLSLIDLVLCTSTVPKLLALFWANAAEIAFGACAAQMFFIHGFS
AVESGILLAMAFDRYLAICRPLHYGSLLPPEAVGKLGAAAVFRGLGLMTPLTCLLARLSYCSRVVAHSYCEHMAVVKLACGGTQPNNIYGITAATLVVGTDSICIAVSYA
LILRAVLGLSSKEARAKTFGTCGSHLGVILLFYTPGLFSFYTQRFGHHVPRHIHILLADLYLVMPPMLNPIIYGMKTKQIRDGALRLLKRGFVHS*
878 >lcl|XP_003129635.1|Plus1complement(73373..74323) NW_003535493 olfactory receptor 52B4-like LOC100518798 __SEG__ Chr9 {Sus scrofa} MATPNHTGTSHSLFILLGIPGLEDQHSWISLPFFISYLVAVLGNCLLVFLIITERSLHEPMYFFLCMLALADLILSTTTVPKALAIFWFHAGEISLDGCVTQIFFIHATF
IAESGILLAMAFDRYVAIRDPLRYTTVLSHAVIIRIGLAVVLRSFSVILPDVFLVKRLPFCRSNVLPHVYCEHMAVAKFACADIRVNVWYGLCVLLSTVVTDVLLILVSY
MCILSAVFRLPSQGARQKALGTCGSHLGVISMFYLPGIFTIITQRFGHHVPLHTHILLANVCMLAPPMLNPIIYGIKTRQIRECVVSTLSSQGKHC*
879 >lcl|XP_003129636.1|Plus1complement(7548..8492) NW_003535493 olfactory receptor 52B4-like LOC100518981 __SEG__ Chr9 {Sus scrofa} MLSFNRTGVSHTVFYLLGIPGLEDQHLWISIPFFISYVTALLGNSLLIFLILTRRSLHEPMFLFLCMLAGADIVLSTCTVPQALAIFWFRAGEISLDRCISQFFIIHCIF
ISESGLLLVMAFDRYVAICYPLRYTTILTHPLIGKIGVTIFLRSYCTIFPIIFLLKRLTFCRNNVLPHTYCEHIGLAKYACNDIRVNIWYGLFVIVSTVVLDVLLIFVSY
MLILRAVFHMPSQDARHKALNTCGSHVCIIILFYGPAIFTTLTQRFGRHIPAHIHILLANVCVLVPPMLNPVIYGIKTKAIREQVAHLFFPKQK*
880 >lcl|XP_003129646.1|Plus192848..93792 NW_003300509 olfactory receptor 52B4-like LOC100521672 __SEG__ Chr9 {Sus scrofa} MLSFNRTGVSHTVFYLLGIPGLEDQHLWISIPFFISYVIALLGNSLLIFLILTRRSLHEPMFLFLCMLAGADVVLSTCTVPQALAIFWFRAGEISLDRCISQFFIIHCIF
ISESGLLLVMAFDRYIAICYPLRYTTILTHTLIGKIGVTIFLRSYCTIFPIVFLLKRLTFCRNNVLPHTYCEHIGLAKYACNDIRVNIWYGLFVLMATLVLDILLIFVSY
MLILHAVFHMPSQDARHKALNTCGSHVCIIILFYGPAIFTTLTQRFGRHIPLHIHILLANVCMLAPPMLNPIIYGIKTKAIREQVAHLFFPKQK*
881 >lcl|XP_003129659.1|Plus1complement(35318..36262) NW_003300509 olfactory receptor 52B4-like LOC100524754 __SEG__ Chr9 {Sus scrofa} MLSFNRTGVSHTVFYLLGIPGLEDQHLWISIPFFISYVIALLGNSLLIFLILTRRSLHEPMFLFLCMLAGADLVLSTCTVPQALAIFWFRAGEISLDRCITQLFFIHSTF
ISESGILLVMAFDRYVAICYPLRYTTILTHTLIGKIGVTIVLRSYCAIFPIVFLLKRLTFCRSNVLPHTCCEHIGLAKYACNDIRVNIWYGFFVIVSTLVLDVLLIFVSY
MLILRAVFHMPSQDARHKALNTCGSHVSVIILFYGPGFFTTLTQRFGRHIPAHIHILLANVCVLAPPMLNPIIYGIKTKAIREQVAHLLFPKQK*
882 >lcl|XP_003129674.1|Plus1complement(25403..26395) NW_003535496 p2Y purinoceptor 6-like LOC100512849 __SEG__ Chr9 {Sus scrofa} MAMAWDNGTGRALSFPPTTCVYQENFKRLLLPPVYSVVLAAGLPLNACVIAQICTSRRALTRTAVYTLNLALADLLYTCSLPLLIYNYARGDYWPFGDLACRLVRFLFYA
NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCGAVWLAVTTQCLPTAHFAATGIQRNRTVCYDLSPPSLATHYMPYGMALTVIGFLLPFGALLACYCRLARR
LCRRDGPAGPVAQERRDKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCPVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPQELLQKLTAKWQRQGR
*
883 >lcl|XP_003129720.1|Plus164423..65496 NW_003535502 tsukushin-like isoform 1 LOC100522628 __SEG__ Chr9 {Sus scrofa} MPWPLLPPLLLLLAASRAQATRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIVPVPIPLDTAHLDLSSNRLETVNESVLAGPGYTTLAGLDLSHNLLTSLSPTAFSR
LRYLESLDLSHNGLAALPAQSFTSSPLSDVNLSHNRLRELSVSAFATHSQGRALHVDLSHNLLQRLAPHPARASLPAPTIQSLNLAWNRLRAVPDLRDLPLRYLSLDGNP
LAAIGPGAFAGLAGLTHLSLGGLQGLPQLAPHGFRELRGLQVLDLSGNPKLTWAGAEVFSGLDSLQELDLSGTALVPLPEKLLLHLPALQSVSVGQGVWCRRLVREGTYP
RQPGSTPKVALHCIDTGEPAPGGPDIL*
884 >lcl|XP_003129771.1|Plus1complement(2003401..2004516) NW_003535512 coiled-coil domain-containing protein 89-like LOC100519041 __SEG__ Chr9 {Sus scrofa} MPQEETALGMDAPSAEKLLEKQNKKLENQEEEGLEFKELDGLREALANLRGLSEEEKGEKAMLCSRIQEQSQLICILKRRSDEALERCQVLELLNAELEEKRMLEAEKLK
AKSEHAEKLEERFMTLAANHELMIRFKDEHKNQNIKLREENEKLRLENDHLFSQALKDQEVKVAQLTAQSEALAKELETLKQRSAQDACQAQAREKELLKLQSQQACAHA
RETEQLRSQLQSLKQQHQQATEQMAKAEQAHSLLNQELQARLQTVSREKEELLQLSMERGKVLQNKQAEIRQLEDKLETADVARRHAVERFEQEAVAVDSNLRVRELQRR
VDGIQKAYDELRLQSEAFKRHSLDLLSKERELNAKLRHLFP*
885 >lcl|XP_003129786.1|Plus1448702..449223 NW_003535513 protein tyrosine phosphatase type IVA 1-like LOC100521853 __SEG__ Chr9 {Sus scrofa} MAPLNRPAPVEVTYRNMRFLITHNPTSATLNRFIEDLKKYGVTTIVRVCEATYDTALVEKEGIQVLDWPFDDGSSPSNQIVDDWLSLVNVKFREEPGCCIAVHCVAGLGR
TPVLVALALIEGGMKNEEAVQFIRQKRRGAFNSKQLLYLEKYRSKMRLRFKDSSGHRNSCCIQ*
886 >lcl|XP_003130010.1|Plus1complement(1928241..1929188) NW_003535553 olfactory receptor 6M1-like LOC100524388 __SEG__ Chr9 {Sus scrofa} MEVQNQTTVTEFILTAFPALHKLQVFLFAVLLVTYMLTLTGNGVIISLIWADNRLQTPMYFFLSNLSFLDILYTTSVTPKLLACLLEDRKTISLAGCITQTYFFFFLGTV
EFILLVVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVLCPVILLSRLPFCSEEINHFFCDIAPLLQAACINTHFLEMISFLLSSLVLLTSLVLTTVSYTYI
ISTILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQNHSLEFDKVTAVLTIMGTPLLNPFIYSLRNETVKEVLRDAGNKIMSLWHQKP*
887 >lcl|XP_003130011.1|Plus1complement(1941324..1942271) NW_003535553 olfactory receptor 6M1-like LOC100524576 __SEG__ Chr9 {Sus scrofa} MEVQNQTTVTEFILTAFPALHKLQVFLFAVLLVTYMLTLTGNGVIISLIWADNRLQIPMYFFLSNLSFLDILYTTSVTPKLLACLLEDRKSISFAGCITQTYFFFFLGTV
EFILLAVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVLCPTIVVSRLPFCSKEISHFFCDIAPLLQVACIDTHFIEMINFLLSSLVLLTSLVLTTVSYTYI
ISTILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLEFDKVTAVLTTMGTPLLNPFIYSLRNEKVKEVLRDAVNQIMSPWHRKP*
888 >lcl|XP_003130012.1|Plus1complement(1974749..1975687) NW_003535553 olfactory receptor 8D4-like LOC100524947 __SEG__ Chr9 {Sus scrofa} MDIRNQSEVTNFLLSGLTDQPGLQLPLFCLFLGIYMVTVVGNLGMISIIALSSQLHTPMYYFLSSLSFLDFCYSSVITPKMLAGFLARDRTISYSGCMTQLFFFCIFVIS
ECYMLAAMAYDRYVAICIPLLYNVIMSPRVCSLLVAAVFSVGITDALIHGGCILRLTFCGSNIIAHYFCDIIPLIKLSCSSTYIDELLVFAIGGFNMVATSLTIIISYAF
ILSSILCIHSKAGRSKAFSTCSSHLTAVLIFYGSLMSMYLKPASSSSLTQEKVSSVFYTNVIPMLNPLIYSLRNKEVKNALMKLLRRKISSK*
889 >lcl|XP_003130013.1|Plus12019982..2020926 NW_003535553 olfactory receptor 4D5-like LOC100525119 __SEG__ Chr9 {Sus scrofa} MNPTNHSQVTGFVLLGLSQVWELRFFFFIVFSVVYLMTVTGNLLIVAIVTSDPRLHTTMYFLLGNLSFLDFCYSSITAPRMLVDLLLGNPIISFGGCLTQLFFFHFIGGI
KIFLLTVMAYDRYVAISQPLRYTLIMNRTVCGLLMAASWVGGFIHSIVQVGLTMKLPFCGPDKLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLLCFLVLLGSYTA
LLVMLQSHSREGRSKALSTCASHIAVVTLIFVPCVYIYARPFRTFPMDKVVSVLYTMVTPMLNPAIYTLRNKEVIMAMKKLWRRQKDPLGSFEH*
890 >lcl|XP_003130014.1|Plus1complement(2027459..2028421) NW_003535553 olfactory receptor 6T1-like LOC100525298 __SEG__ Chr9 {Sus scrofa} MSPENWTQVTGFVLLGFPSSHTLKFLLFLGLLGIYVVTATGNLLIIGLSWMDRRLHTQMYFFLRNLSFLELLLVSVVVPKMLVIILTGDHSISYASCMIQSYLYFLLGTT
DFFLLAVMSMDRFLAICRPLHYETLMSGHVCSQLVLASWLAGFLCILCPTILMASLPFCGPNDIDHFFCDSWPLLRLSCGDTRLLELVAFVLSTSVLLGSLALISVSYAC
ILATVLRAPTASERKKALSTCASHLTVVVIVYGSSSFLYIRMSEAQSMQFNKGASVLSCIITPLLNPFIFSLRNEKVKQALRDALSGLRPMDVGDDEGHK*
891 >lcl|XP_003130015.1|Plus12060051..2060986 NW_003535553 olfactory receptor 8B3-like LOC100525476 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLAMYMVTVLGNFGLITVIGLNSHLHTPMYFFLLNLSFIDLCYSSVFTPEMLTHFLSEKKIISYLGCMTQLFFFGFLILS
ECYVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCDANTINHYFCDILPLLQLSCTSTYINEIVLFIASCINIIVPSLTIFVSYGL
ILSNILRISSMESRSKAFSTCSSHIIAISLFFASGEIMYLQPSSSGSMDKGKISSVFYTNVVPMMNPLIYSLRNKDVKFALRKTLRRRFWF*
892 >lcl|XP_003130017.1|Plus1complement(2145219..2146151) NW_003535553 olfactory receptor 8B3-like LOC100526004 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTYHPALQLPLFLLFLVMYMVTVLGNFGLITVIGLNSHLHTPMYFFLFNLSFIDLCYSSVFTPEMLTHFLSEKNIISYLGCMTQLCFFCFFGIS
ECYVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCAADTINHYFCDILPLFQLSCTSTYVNEMVIFIVGGINIIVPSLTIFVSYGL
ILSNILRISSTEGRSKAFNTCSSHVIAVCLLFGSGVFMYLQPSSSGSMDKGKISSVFYTNVVPMLNPLVYSLRNKDVKVALRNTLRRRRY*
893 >lcl|XP_003130019.1|Plus1complement(2139168..2140103) NW_003535553 olfactory receptor 8B3-like LOC100510973 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLVMYMVTVLGNFGLITVIGLNSHLHTPMYLFLFNLSFIDLCYSSVFTPKMLTHFLSENKLISYLGCMAQLFFFCFFGIS
EACVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCDANTINHYLCDILPLLQLSCTSTYINEMIVFIVGGINIIVSSLTIFVSYGL
ILSNILHVSSLESRSKAFTTCSSHIIAISLFFGSGAIMYLQPSSSGSMDKGKLSSVFYTNVVPMMNPLIYSLRNKDVKFALRKTLRRRFQF*
894 >lcl|XP_003130021.1|Plus12043550..2044479 NW_003535553 olfactory receptor 8B3-like LOC100511340 __SEG__ Chr9 {Sus scrofa} MAPGNVSSVTEFILLGLTQQPELQLPLFFIFLGTYVVTMVGNVGLVILIGLNPHLHTPMYYFLFNLSFVDLCYSSVITPKMLMTFVNRNIISYAECMAQLYFFSFFVIDE
CYILTSMAYDRYVAICKPLLYKVSMSHQVCLMLTVGAYVMGLVGAVAHTGCMLRLSFCDGNIINHYMCDIPPLLQLSCTSTYITELVVFIVVGINVIVPSLTISISYTLI
LSSVLRIRSTEGRSKAFSTCSSHITVVSLFFGSSAFMYLKPFPAGSLDEEKVSTVFYTIVGPMMNSFIYSLRNKDIQIALSKTLKKRMF*
895 >lcl|XP_003130022.1|Plus12068408..2069343 NW_003535553 olfactory receptor 147-like LOC100511524 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLAMYTVTVLGNFGLITVIGLNSHLHTPMYFFLLNLSFIDLCYSSVFTPEMLTHFLSEKKIISYLGCMTQLFFFCFLILS
ECYVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMAFSVSMAHTGCMLRLTFCDANTINHYFCDILPLLQLSCTSTYINEIVLFIASCINIIVPSLTIFVSYGL
ILSNILRISSMESRSKAFSTCSSHIIAISLFFGSGTIMYLQPSSSGSMDKGKISSVFYTNVVPMMNPLIYSLRNKDVKFALQKTLRRRFRF*
896 >lcl|XP_003130023.1|Plus12078603..2079538 NW_003535553 olfactory receptor 8B3-like LOC100511708 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLAMYTVTVLGNFGLITVIGLNSHLHTPMYFFLLNLSFIDLCYSSVFTPEMLTHFLSEKKIISYLGCMTQLFFFCFFAIS
ECGVLTLMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCDANTINHYFCDILPLLQLSCTSTYINEMVVFIMASINISVPSLTIFVSYGL
ILSNILRISSMESRSKAFSTCSSHIIAISLFFGSGAIMYLRPSSSGSMDKGKISSVFYTNVVPMMNPLIYSLRNKDVKFALQKTLRRRFRF*
897 >lcl|XP_003130025.1|Plus12096699..2097631 NW_003535553 olfactory receptor 8B3-like LOC100512064 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLAMYMVTVLGSFGLITVIGLNSHLHTPMYFFLLNLSFIDLCYSSVFTPEMLTHFLSEKKIISYLWCMTQLCFFCFFGIS
EAYVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCGANTIHHYFCDILPLLQLPCTSTYVNEMVIFILGGINIIVPSLTIFVAYGL
ILSNILRISSTEGRSKAFNTCSSHVIAICLLFGSGVFMYLQPSSSGSMDKGKISSVFYTNVVPMLNPFVYSLRNKDVKVALRNTLRRRRY*
898 >lcl|XP_003130026.1|Plus1complement(2112225..2113220) NW_003535553 olfactory receptor 10S1-like LOC100512247 __SEG__ Chr9 {Sus scrofa} MSVSSLGKKMLMEKEDPNQTVVDSFFLEGLMYTAEHPSLFFLLFLLIYGITITGNLLILITVGSDPHLCSPMYHFLGHLSFLDAWLSTVTVPKVMDGLLTLDGKVISFEG
CALQLYGFHFLASTECFLYTVMAYDRYLAICRPLYYPAAMNRRMCAGLAGITWSLGAVHSAIHTSLTFRLPYCEPRHIAYFFCDIPPVLKLACADTTINELVMLANIGIV
AAGCLILIVVSYSFIVTAVVRIHTAEGRQRAFSTCTSHLTVVLLYYMPPVSIYLQPRSGAAGAGASAVFYTIVTPVLNPFIYTLRNREVKRALRRFLGQGSPESPAGNPP
P*
899 >lcl|XP_003130029.1|Plus1complement(1874650..1875588) NW_003535553 olfactory receptor 6X1-like LOC100513168 __SEG__ Chr9 {Sus scrofa} MRNGTAITEFILLGFPGIQGLQAPLFIVIFFIYILTLAGNGLIIAIVWAEPRLRIPMYFFLCNLSFLEIWYTTTVLPKLLETLLVARTAICTPCCLLQAFFHFFLGTTEF
FILTIMSFDRYLAICKPLHYPTIMSSKLCLQLALSSWVVGFTIVFCQMVLLIQLPFCGNNVINHFYCDVGPILKAACTDTSILELLGLLATILVIPGSLLFTIVSYIYIL
STILRIPSATGRQKAFSTCASHLTVVSLLYGAVLFMYLRPTAHSSFKMNKVVSVLNTILTPLLNPFIYTIRNKEVKGALRKAMVCPKTHHPV*
900 >lcl|XP_003130031.1|Plus1complement(1913615..1914562) NW_003535553 olfactory receptor 6M1-like LOC100513559 __SEG__ Chr9 {Sus scrofa} MEGQNQNPGTEFILNAFPALHKLQVFLFAGLLGTYMLNLKGNGVIISLIWAENRLQTPMDFFPRNLSFLDILFTSSVTPKLLACLLEDRKTISLAGCITQTYFFFFLGTV
EFILLVVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVLCPVILLSRLPFCSEEINHFFCDIAPLLQAACINTHFLEMISFLLSSLVLLTSLVLTTVSYTYI
ISTILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLEFDKVTAVLTIMGTPLLNPFIYSLRNEKVKEVLRDAVNKIMSLWHQKP*
901 >lcl|XP_003130032.1|Plus1complement(260965..261897) NW_003300551 putative olfactory receptor 10D4-like LOC100513751 __SEG__ Chr9 {Sus scrofa} MRNHTMVTEFILLGIPETEGLEIVLFSLFSSLYLCTLLGNVLILTAIISSSLLHTPMYFFLGNLSMFDLGFSSTTGPKMLSYLSGQSQGISFQGCAAQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYMVIMNHRVCSFLATGTWMGGCIHAFILTSLTFQLSYCGSNKVGYYFCDIPAILPLACGDTSLAQRVGFTNVGLLSLICFSLILVSYTRIG
IAISKIHSAEGRKRAFSTCSAHIAAILCAYGPVIIIYLQPDSSALVGAIIQILNNLVTPMLNPLIYSLRNKDVKSALRNIFPKRGLHSGE*
902 >lcl|XP_003130033.1|Plus1complement(269859..270794) NW_003300551 olfactory receptor 148-like LOC100513942 __SEG__ Chr9 {Sus scrofa} MRNDTEELKEFLLLGIPQTEGLEPVLFVIFSAIYLFTLLGNLLIIVAITSSSTLRTPMYFFLGLLSILDILFPSVTCPKMLFYLSGRSRAISYEGCAAQLFFYHFLGSTE
GCLYSVMAYDRFVAICHPLRYMLIMRPGVCVGLVMAALLVDCLHATILMSLTFQLPYCGPNQVAYFFCDIPAVLPLACADSSLAQRVGSTNVGFLVLLFWFSVCASYTRI
GIAILRIRSAEGKQKAFSTCSAHLTAILCAYGPVIIIYLQPTPNALVGAMVQILNNIVSPMLNSLIYSLRNKEVKSSLKRVFHKVVFTALE*
903 >lcl|XP_003130034.1|Plus161439..62374 NW_003300551 olfactory receptor 8B3-like LOC100514122 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLVMYMVTVLGNFGLITVIGLNSHLHTPMYLFLFNLSFIDLCYSSVFTPKMLTHFLSENKLISYLGCMAQLFFFCFFGIS
EACVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCDANTINHYLCDILPLLQLSCTSTYINEMIVFIVGGINIIVSSLTIFVSYGL
ILSNILHVSSLESRSKAFTTCSSHIIAISLFFGSGAIMYLQPSSSGSMDKGKLSSVFYTNVVPMMNPLIYSLRNKDVKFALRKTLRRRFQF*
904 >lcl|XP_003130035.1|Plus1326778..327725 NW_003300551 olfactory receptor 149-like LOC100514309 __SEG__ Chr9 {Sus scrofa} MRNASVVTMFILLGIPHTEDLETMLFVLFLSFYIFTLIGNLLILLAIVSSTRLHTPMYFFLCELSTCDIFFPSVSSPKMLFYLSGNSRAISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYTIIMSHRACALLAIGTSFFGCIQAIFLTALTFQLPYCGPNEVDYYFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSRIA
YSILQIRSAEGQQRAFSTCSAHLTAILLFYMPVVLIYLRPTPSPWMDATVQILNNLVTPMLNPLIYSLRNKEVKSSLRKALRQLGFHPEQLQRDE*
905 >lcl|XP_003130037.1|Plus1602909..603850 NW_003300551 olfactory receptor 8A1-like LOC100514671 __SEG__ Chr9 {Sus scrofa} METRNHSLVTEFILEGLTDQAGLQLPLFFLFLMIYMVSMVGNVGLVFLIRISSQLHTPMYYFLSNLSFIDLCYSSVIIPKMLVNFISRRNFTSFSECMVQLFFFCFFGID
DSYMLTAMAYDRYAAICHPLLYNVTMSHRVCLLLVTSVYIVGAAGALVHTSYVSSRSFCGTNVIHHYFCDILPLLNISCSRDYIMELSVMILVGFNVFACALAIFISYAF
ILSSILCIRSAEGRSKAFSTCSSHLAAVGVFYGSIIFMYFKPSTSDTTQEKVASVFYTTVIPMLNPIIYSLRNKDVKESLKKLLSGEILSRSV*
906 >lcl|XP_003130039.1|Plus16785..7720 NW_003300551 olfactory receptor 8B3-like LOC100515226 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLAMYTVTVLGNFGLITVIGLNSHLHTPMYFFLLNLSFIDLCYSSVFTPEMLTHFLSEKKIISYLGCMTQLFFFCFFAIS
ECGVLTLMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCDANTINHYFCDILPLLQLSCTSTYINEMVVFIMASINISVPSLTIFVSYGL
ILSNILRISSMESRSKAFSTCSSHIIAISLFFGSGAIMYLRPSSSGSMDKGKISSVFYTNVVPMMNPLIYSLRNKDVKFALQKTLRRRFRF*
907 >lcl|XP_003130041.1|Plus1103370..104347 NW_003300551 olfactory receptor 10S1-like LOC100515565 __SEG__ Chr9 {Sus scrofa} MSVSSLGKKMLMEKEDPNQTVVDSFFLEGLMYTAEHPSLFFLLFLLIYGITITGNLLILITVGSDPHLCSTMYHFLDAWLSTVTVPKVMDGLLTLDGKVISFEGCALQLY
GFHFLASTECFLYTVMAYDRYLAICRPLYYPAAMNRRMCAGLAGITWSLGAVHSAIHTSLTFHLPYCGPRHIAYFFCDIPPVLKLACADTTINELVMLANIGIVAAGCLI
LIVVSYSFIVTAVVRIHTAEGRQRAFSTCTSHLTVVLLYYMPPVSIYLQPRSGAARAGASAVFYTIVTPVLNPFIYTLRNREVKRALRRFLGQGSPESPAGNPPP*
908 >lcl|XP_003130042.1|Plus1complement(127264..128259) NW_003300551 olfactory receptor 10S1-like LOC100515746 __SEG__ Chr9 {Sus scrofa} MSVSSLGKKMLMEKEDPNQTVVDSFFLEGLMYTAEHPSLFFLLFLLIYGITITGNLLILITVGSDPHLCSPMYHFLGHLSFLDAWLSTVTVPKVMDGLLTLDGKVISFEG
YALQLYGFHFLASTECFLYTVMAYDRYLAICRPLYYPAAMNRRMCAGLAGITWSLGAVHSAIHTSLTFHLPYCGPRHIAYFFCDIPPVLKLACADTTINELVMLANIGIV
AAGYLILIVVSYSFIVTAVVRIRTAEGRQRAFSTCTSHLTVVLLYYMPPVSIYLQPRSGAAGAGASAVFYTIVTPVLNPFIYTLRNREVKRALRRFLGQGSPESPAGNPP
P*
909 >lcl|XP_003130045.1|Plus1complement(538684..539613) NW_003300551 olfactory receptor 8B3-like LOC100516283 __SEG__ Chr9 {Sus scrofa} MAPGNGSFMTQFILVGLTDQPDLQLPLFFLFLIMYIITMMGNLGMMTLIGLNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINIISKKNIISYMGCMTQLYFFSFFGIS
ECYVLTSMAYDRYVAICNPLLYNIAVSPKVCSSLVLGSYLMAFFDATTLIGCMLRLTFCDANTVNHYLCDIHPLLQLSCTSTYLIEMEVFIVGGLNIIIPSLTIFISYGL
ILTTILRISTMEGRSKAFSTCSSHVIAVSLFFGSSAFMYLRPSSVSMDEGKISSVFYTNVVPMMNPLIYSLRNKDVKLALRKTLRRGEF*
910 >lcl|XP_003130046.1|Plus1complement(492031..492966) NW_003300551 olfactory receptor 145-like LOC100516454 __SEG__ Chr9 {Sus scrofa} MDIGNSSLVTEFILVGLSKYSEIQLPLFFLFMGIYIVTVAGNLGLVTLIRLNSHLHTPMYYFLFNLSFIDLCYSSTITPKLLVNFVSEMNTISYAGCMTQLFFYCFFVSA
ECYVLTVMAYDRYVAICKPLLYNVTMSPKVCHLLVVIVYVGAFIGAWAHTGCMLRLTFCDANTINHYMCDILPLLELSCTSTHINELVVLIVVGFDIGVPSLTIIISYAF
ILSSIFRIHSAEGRSKAFSTCSSHVIVVFVFFGSGAFMYLHPSSVLSMDQGKVSTVFYTIVVPMLNPLIYSFRNKEVKVALKKSLSRKIFS*
911 >lcl|XP_003130047.1|Plus1complement(473412..474338) NW_003300551 olfactory receptor 8D2-like LOC100516632 __SEG__ Chr9 {Sus scrofa} MATLNLSSVTEFILEGLTKCPELQLPLFLLFLGIYVVTVVGNLGMILLIAISSQLHTPMYYFLSHLSFIDLCYSSVITPKMLLNFLSEKNIISFLECMAQLYFFLIFVIA
EGYILTIMAYDRYVAICSPLLYNIIMSHRVCSIMMAVVYSLGLFGATVHTARMSTLSFCGSHTISHYFCDILPLLSLSCSSTHINEILLFIIGGVNTLAPTLAMLISYAF
ILSSILRIRSSDGRSKAFGTCSSHLMAVGIFFGSITFMYFKPPSSNTMEQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKALRKVVGGR*
912 >lcl|XP_003130048.1|Plus1<556585..557544 NW_003300551 olfactory receptor 8G5-like LOC100516990 __SEG__ Chr9 {Sus scrofa} PSGTTQREMAVGNHSSVIEFILAGLTEQPELQLPLFFLFLGIYVVTVVGNLGMILLIGVSSHLHTPMYYFLSSLSFIDLCHSTVITPKMLLNFVTDKNIISYAACMTQLC
FFLLFAISECYMLAAMAYDRYVAICSPLLYHVIMSHQTCFSLIVGVYTVGLVCAFSHTGCIFRVHFCKCDVINHYFCDLLSLLKLSCSSTYVNELLILIFSAINILAPSL
TILSSYIFIIASILHIRSTEGRSKAFGTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQGKVSSVFYTIAVPMLNPLIYSLRNKDVTVALKKMLERRIFL*
913 >lcl|XP_003130052.1|Plus171094..72029 NW_003300551 olfactory receptor 8B3-like LOC100518086 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTDHPALQLPLFLLFLVMYMVTVLGNFGLITVIGLNSHLHTPMYLFLFNLSFIDLCYSSVFTPKMLTHFLSENKLISYLGCMTQLYFFCFFGIS
EAYVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCDANTINHYLCDILPLLQLSWTSTYINEMVDFITVGINIIVPSLTIFVSYGL
ILSNILRISSMESRSKAFSTCSSHIIAVSLFFGSGAIMYLRPSSSGSMDKGKISSVFYTNVVPMMNPLIYSLRNKDVKFALRKTLRRRFRF*
914 >lcl|XP_003130053.1|Plus1168881..169816 NW_003300551 olfactory receptor 10G9-like LOC100518267 __SEG__ Chr9 {Sus scrofa} MTNKSLVTTFILAGLPHPPQLDTLLFATFLLIYVLSVLGNLLILLVITVDPHLHTPMYFFLTNLSFIDMWFSTVTVPKVLMSLVSPAGGALSFHSCVAQLYSFHFLGSTE
CFLYTVMSYDRYLAISHPLRYSGLMRGRTCALLATTTWLSGALHSAVQTTLTFRLPYCGPSRIQHYFCDAPPILKLACADTSAVEMVIFINIGVVASGCFLLIVLSYVSI
VCSILKIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSKAAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKVAYSQDK*
915 >lcl|XP_003130054.1|Plus185690..86622 NW_003300551 olfactory receptor 8B3-like LOC100518443 __SEG__ Chr9 {Sus scrofa} MAPGNGSFVTDFILVGLTYHPALQLPLFLLFLVMYMVTVLGNFGLITVIGLNSHLHTPMYFFLFNLSFIDLCYSSVFTPEMLTHFLSEKNIISYLGCMTQLCFFCFFGIS
ECYVLTAMAYDRYVAICNPLLYNIAMSPKVCSSLMLACYLMALSGAMAHTGCMLRLTFCAADTINHYFCDILPLFQLSCTSTYVNEMVIFIVGGINIIVPSLTIFVSYGL
ILSNILRISSTEGRSKAFNTCSSHVIAVCLLFGSGVFMYLQPSSSGSMDKGKISSVFYTNVVPMLNPLVYSLRNKDVKVALRNTLRRRRY*
916 >lcl|XP_003130055.1|Plus1178409..179344 NW_003300551 olfactory receptor 10G9-like LOC100518623 __SEG__ Chr9 {Sus scrofa} MTNKSLVTTFILAGLPHPPQLDTLLFATFLLIYVLSVLGNLLILLVITVDPHLHTPMYFFLTNLSFIDMWFSTVTVPKVLMSLVSPAGGALSFHSCVAQLYSFHFLGSTE
CFLYTVMSYDRYLAISHPLRYSGLMRGRTCALLATTTWLSGALHSAVQTTLTFRLPYCGPSRIQHYFCDAPPILKLACADTSAVEMVIFINIGVVASGCFLLIVLSYVSI
VCSILKIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSKAAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKVAYSRDK*
917 >lcl|XP_003130056.1|Plus1complement(191870..192805) NW_003300551 olfactory receptor 10G7-like LOC100518799 __SEG__ Chr9 {Sus scrofa} MTNKSLVTTFILAGLPHPPQLDTLLFATFLLIYVLSVLGNLLILLVITVDPHLHTPMYFFLTNLSFIDMWFSTVTVPKVLMSLVSPAGGALSFHSCVAQLYSFHFLGSTE
CFLYTVMSYDRYLAISHPLRYSGLMRGRTCALLATTTWLSGALHSAVQTTLTFRLPYCGPSRIQHYFCDAPPILKLACADTSAVEMVIFVNIGVVALGCLLLIVLSYVSI
VCSILKIRTSEGRHRAFQTCASHCIVVLCFFGPGVFIYLRPGSKAAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLNSQSVSTQSK*
918 >lcl|XP_003130057.1|Plus1215498..216433 NW_003300551 olfactory receptor 148-like LOC100518982 __SEG__ Chr9 {Sus scrofa} MRNDTEELKEFLLLGIPQTEGLEPVLSVIFSAIYLFTLLGNLLILVAITSSSTLRTPMYFFLGLLSILDMLFPSVTCPKMLFYLSGRSRAISYEGCAAQLFFYHFLGSTE
GCLYSVMAYDRFVAICHPLRYMLIMRPGVCVGLVMAAWLVGCLQATILMSLTFQLPYCGPNQVAYFFCDIPAVLPLACADSSLAQRVGSTNIGFLVLLFWFSVCASYTRI
GIAILRIRSAEGKQKAFSTCSAHLTAILCAYGPVIIIYLQPTPNALVGAMVQILNNNVSPMLNSLIYSLRNKDVKSSLKRVFRNVVFMALE*
919 >lcl|XP_003130058.1|Plus1243980..244912 NW_003300551 olfactory receptor 958-like LOC100519326 __SEG__ Chr9 {Sus scrofa} MRNHTPVTEFLLMGLPHTNGLENVLFVVFLAFYLLTLLGNLLILLAILTSSSLHTPMYFFLGNLSVFDIFFPSVSSPKMMLSLVGSSQTISYQGCASQLFFYHFLGCIEC
FLFTVMGYDRFAAICHPLRYTVIMNRRACAVMTLGTWLGSCVHASVLTFLIFKLPYCGPNEVDSFFCDIPVVLPLACADTSLAQLVSFTSVGIVALMCFLLILASYTRIV
ISVLKISSSEGRRRAFSTCSAHLTSILLCYGPVILIYLRPASSPWLDSVVPVFNNIVTPSLNPLIYTLRNKDVKLALRKALIQGLQTCKG*
920 >lcl|XP_003130059.1|Plus1complement(33783..34709) NW_003300553 olfactory receptor 8B3-like LOC100519506 __SEG__ Chr9 {Sus scrofa} MASGNGSFVTEFILLGLTDQPDLQLPLFFLFLVMYMVTVMGNLGLIILVVLNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINFISKNNIISLMGCMTQLYFFCFFAIS
ECYVLTSMACDRYVAICNPLLYNIAMSPKVCSSLMLASYLMAFSGATAHTGCMLRLTFCDANTINHYFCDIPPLLQLSCTSTYVNELEVFIVVGINIIVPSLTISVSYGL
ILSSILHISSRKGRFKAFSTCSSHIIAVSLFFGSVAFMYLRPSSAQSVDEGKISSVFYTNIVPLLNPLIYSLRNKDVKRALRKTLGRI*
921 >lcl|XP_003130060.1|Plus1complement(115768..116709) NW_003300553 olfactory receptor 8B3-like LOC100519677 __SEG__ Chr9 {Sus scrofa} MLARNDSLVTEFILAGLTERRELQQPLFYLFLMIYIVTMVGNLSLIILIGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMSFVSRGNIISYVGCMTQLFFFLFFVIS
ECYMLTSMAYDRYVAICNPLLYKVTMSHQVCSVLALAAYVMGLAGASAHTGCMLRLTFCSVNVINHYLCDILPLLQLSCTSTYVNEVVVLIVVGVNITVPSFTILISYIF
IITSIFHIKSAQGRSKAFSTCSSHIIALSLFFGSGAFMYLKYSSPGSMEQGKVSSVFFTNVVPMLNPLIYSLRNKDVKVALRKSLFEIQRRKM*
922 >lcl|XP_003130061.1|Plus1complement(87832..88776) NW_003300553 olfactory receptor 8B3-like LOC100519859 __SEG__ Chr9 {Sus scrofa} MLARNDSLVTEFILAGLTERRELQQPLFYLFLMIYIVTMVGNLSLIILIGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMSFVSRGNIISYVGCMTQLFFFLFFVIS
ECYMLTSMAYDRYVAICNPLLYKVTMSHQVCSVLALAAYVMGLAGASAHTGCMLRLTFCSVNVINHYLCDILPLLQLSCTSTYVNEVVVLIVVGVNITVPSFTILISYIF
IITSIFHIKSAQGRSKAFSTCSSHIIALSLFFGSGAFMYLKYSSPGSMEQGKVSSVFFTNVVPMLNPLIYSLRNKDVKVTLKNFLFKIRWRTMF*
923 >lcl|XP_003130062.1|Plus1complement(78718..79650) NW_003300553 olfactory receptor 143-like LOC100520042 __SEG__ Chr9 {Sus scrofa} MTMGNDSSVTEFILVGLTDQPELQLPLFFLFLVNYVVTVMGSLCLMNLICLNSHLHTPMYFFLFNLSFIDLCYSSVFTPRMLLSFILERNIISFTGCMTQLFFFCFFVSS
ECYVLTAMAYDRYVAICKPLLYPIAMSPQVCSLLMSGSYVLGLAGAVVHTGCMMGLMFCGSNIINHYMCDIFPLLQLSCSSTYVNELVVSVIVGTVIIVSSLIIFISYAL
ILFNILHIQSAQGWSKAFSTCSSHIITVGLFYGFGLLAYVKPSSAGSVGKGKFFSVFYTNVVPMLNPLIYSLRNKDVRIALQKTLKRITT*
924 >lcl|XP_003130063.1|Plus1complement(69713..70645) NW_003300553 olfactory receptor 8B3-like LOC100520211 __SEG__ Chr9 {Sus scrofa} MSPGNGSFVTEFILLSLTDQPDLQLPLFFLFLVMYIVTVLGNLGLIILIVLNSHLHTPMYFFLFNFSFVDFCSSSVFTPKMLVDFLSKNNIILYMECMTQLYFFCFFAIS
ECYVLTSMAYDRYVAICNPLLYNIAMSPKVCSSLILGSYLMAFSGAMAHTGCMLRLTFCDANIINHYFCDILPLLQLSCTSTYVNKMVVFIVSGISVVVPSLTISVTYGF
ILSNILRISSTGGRSKAFSTCSSHIIAVSMFFGSGAFMYLNPSSSGSMDQGKISSVFYTNVVPMMNPFIYSLRNKDVKLALRKILRRRKF*
925 >lcl|XP_003130064.2|Plus1complement(59043..59948) NW_003300553 olfactory receptor 8B3-like LOC100520398 __SEG__ Chr9 {Sus scrofa} MTQFILVGLTDQPDLQLPLFFLFLIMYIITMMGNLGMITLIGLNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINIISKKNIISYMGCMTQLYFLSFFGISECYVLTSM
AYDRYVAICNPLLYNNAVSSKVCSSLVLGSYLMAFFDATTLIGCMLRLTFCDANTVNHYLCDIHPLLQLSCTSTYLIEMEVFIVGGLNIIIPSLTIFISYGLILTTILRI
STMEGRSKAFSTCSSHVIAVSLFFGSSAFMYLRPSSVSMDEGKISSVFYTNVVPMMNPLIYSLRNKDVRLALRKTLRRGEF*
926 >lcl|XP_003130066.2|Plus1complement(173654..174592) NW_003300553 olfactory receptor 145-like LOC100520926 __SEG__ Chr9 {Sus scrofa} MRMVAENSSVAEFILAGLTNQLELQVPLFFLFLGFYVVTVVGNLGLIMLIGLNSHLHTPMYFFLYNLSFIDFCYSTVITPKMLMSFVSKKNIISYAGCMTQLFFFLFFVV
SESFILSAMAYDRYVAICKPLVYMAIMSPQVCLLLLLGVYGMGFAGAMAHTACMVRLTFCDNNMIDHYMCDILPLLKRSCTSTYVNEMVVFLVVGIDIGVPTVTIFISYA
LILSSILCIRSTEGRFKAFSTCTSHIIAVSLFFGSGAFVYLKPSSLLPMNQGKISSLFYTTVVPMLNPLIYSLRNKDVKIALKKTVSKKSFS*
927 >lcl|XP_003130080.2|Plus1complement(155021..155968) NW_003300553 olfactory receptor 8B4-like LOC100523744 __SEG__ Chr9 {Sus scrofa} MPLRNSSLVTKFILVGLSQQKELQLPLFLLFLGIYVLTVVGNLGLITLIGLNTSLHTPMYFFLFNLSFIDLCYSCVFTPKMLNDFVSENIISYVGCMTQLFFFCFFVNSE
CYVLVSMAYDRYVAICNPLLYMVTMSPQICSLLMVGSYVIGFAGAMAHAGGMLRLTFCDSNIIDHYLCEVLPLLQLSCTSTHVNELVFFIAVGVVITLSSISIFISYTLI
LSNIFRIPSAEGRSKAFGTCGSHIVAVVLFFGSGAFTYLTNSFSGSMDQGKFASVFYTNVIPMLNPLIYSLRNKDVKLAEESALLMILFVSIIYW*
928 >lcl|XP_003130081.2|Plus1complement(211270..212205) NW_003300553 olfactory receptor 8B12-like LOC100523913 __SEG__ Chr9 {Sus scrofa} MAADNTSSVTEFVLAGLTDQPELQVPLFFLFLSFYVVTVVGNLGLITLIGLNSHLHIPMYFFLFNLSFIDFSYSTTLTPKMLMGFVSKKNIISYAGCMTQFFFFCFFVFS
ESYILTAMAYDRYVAICKPLVYTVTMSPQVCLLLLLGVYGMGVFGAVAHMGNVMFMTFCANNLVNHFMCDIIPLLELSCNSSYVNLLVVFIVVATGIGVSIVTILISYGF
ILSSILCISSAEGRSKAFSTCSSHIILVSLFFGSGAFMYLKPPSILPLDQGKVSSVFYTIVVPMFNPLIYSLRNKDVKVALKKTLSRKIFS*
929 >lcl|XP_003130149.2|Plus1321317..323455 NW_003535568 leucine-rich repeat neuronal protein 2 LRRN2 __SEG__ Chr9 {Sus scrofa} MRLLVAPLLLAWVAGATAAVPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFLTAVPPALPAGTQTLLLQSNSIVRVDQGELGYLANLTELDLSQNSFSDTRD
CDFRALPQLLSLHLEENQLTRLEDHSFAGLASLQELYLNHNQLYRIAPRAFAGLSNLLRLHLNSNLLRAVDSRWFEMLPNLEILMIGGNRVDAILDMNFRPLANLRSLVL
AGMNLREISDYALEGLQSLESLSFYDNRLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFIHPRA
FHHLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRRPVREVPFREMTDHCLPLISPRSFPSSLQVASGES
LVLHCRALAEPEPEIYWVTPAGVRLTAARAGRKYRVYPEGTLELRRVTVEEAGLYTCVAQNLVGADTKTVSVVVGRAPLQPGRDKGWGLELRVQETHPYHILLSWVSPPN
TVSTNLTWSSASALRGHGATALARLPRGTHSYNITRLLQATEYWACLQVAFADAHTQLACVWARTKEATPCHRALGDRPGLIAVLALAILLLAAGLAAHLGTGQPRQGVS
GRPLLPVWAFWGWSASSVRVVSAPLVLHWNPGRKPPRSSEEETLSPPLSQNS*
930 >lcl|XP_003130188.1|Plus1complement(13521..14180) NW_003535575 hypothetical protein LOC100518567 LOC100518567 __SEG__ Chr9 {Sus scrofa} MAKQRLTVTSWAEGKGRVDPAALPPAWRPSFSRRAGDLRYSLRPTHLGGRPFLGGPGSPTRQRQLGPWVRTGGPRGRQRELEVPAAGLTLGRRPHPSLAAAPPHSGEGKR
GRWLLPPPRGQVRLMLQPCARAARTALFPSPPLAQPQARPLPPPPPPQSPIRRPPAPDSLQPKREAAAQPPGRRPGSSSAAKREAARGGCEPGSDFLAPVAAEWKAKGL*
931 >lcl|XP_003130191.1|Plus1complement(866291..871042) NW_003535575 sterile alpha motif domain-containing protein 9 SAMD9 __SEG__ Chr9 {Sus scrofa} MAAQLNLPKNTDDWTKEDVNRWLESHKIDQKHRDILTAQDVNGANLKYLTKEHLIDIGITFGPAIQIEHLFKELMETSTEDPSQICKREKGSKDVPKKQEKNRETSKQKQ
KDKETSDRVTDSTISTVTEGSMSLNNEFMEDEINDTQKKQSSVELMCVPYPFDEFSDPYRYKLNFSLQPETGPLNLIDPIHEFKAFTNTETATKEDVKMKFSNEVFRFAS
ACMNSRTNGTIHFGVKDKPHGKIVGVEVTTVTKEAFIDHFNMMIHQYFEDHQVQKAKNCIREPRFVEVLLPNSIPSDRFVIEVDVVPKYSECEQEYFQIKMQNYSNKTWK
QSPKFSVFMRDGASSKDVMKNNVEFKTFKLDLKKLAEARKEAEEKCRLKTNKKESEGPKLVKLLTGNKDLLDNSYYDWYILVINKCHPTQIKHLDFLKEIKWFAVLEFDP
ESVSEGVVKAYKESRVVNLHFPSLYVEGKTTNEKIISLNLYQQLSWIFCNGRLDLDSEKYKPLDPSSWQREKASEVRKLISFITHEDIMPRGKFLVVFLLLSSVDDPRDP
LIETFCAFYQDLKGMENIMCICAHSRICQGWKDLLEARLAKQEDELSSQCISALSLEEINGTILKLKSVTQSSKRFLPSVGSSTVLLKREEDIMTALEILCENECEGTLL
EKDEKKFLEFKALKEEDFYRGGKVSWWNFYFSSENYSSPFVKRERYEKLETMIQECAASSKPTCVKIIHLYHHPGCGGTTLAMHVLWELRKKFRCAVLKNKMVDFCEIGE
QVTNLITYGTASSQEYLPVLLLVDDFEEQDNVYFLQASIQTTIANKYIRYEKPLVIILNCRRSQNPEKSAKNPNSIALIQNLSSKEQRAFELKLKKIEEQHKNFKDFYSF
MIMKTNFDKKYIENVVRNILKGQNICTKEAKLFSFLALLNSYVPDTTISLSQCEKFLGITNKKAFWGTEKLEDKMGTYSTILIKTEVIECGNYCGVRIIHPLIATRSLEE
LKISYNLDKSQIILDMLTENLFYDTGIGKDKFLEDMQTLLLTRQRNDHEGETGTWFSPFIEALHRDEGNVAVKNVLLEGIRQFNSNAFICQALSRHFYIKERDFNSALHW
ANEAKKIEPDNSYISDTLGQVYKSKIRWWIEDGRNWNISADDLADLLDLAVHASNAFKESQRQSEDREYEVKERFYQKSKRRYDTYNIAGYQGEIEVGLYTIQILQLIPF
FDNKNELSKRDMINFISGTTDIPGDPNNEFKLVLNNFIPYLTKLKFSLKKSFDFFDDYFVLLKPRNNIKQNEEAKTRKKVAVYFKKYADIFGPSEDSQSKYLGSKLSLPL
QVEQCRRSLEVLKADKFSGLLEYLIKNQKDAASTMEDIMNKYSFLFEQCTVRMLSKEKQNFILANIILYCIKPTSKIVMPIKKLKEQLREVLQQAETICRQSEPYFLASL
LFWPENQQLDQDSKQMEKYARSLENSFRGQYKHMCRTKQPIAYFFLGKGNNMNRLIHRGKIDQCCKKTAADIKSFWQSGDVWKEKEVQKLLFRLKGRAENNCLYIEYGIN
EKITIPITPAFLGQLRSGRSIDKVSFYLGFSTGGPLAYDIEVI*
932 >lcl|XP_003130336.1|Plus1163868..164800 NW_003300625 olfactory receptor 2A2-like LOC100525065 __SEG__ Chr9 {Sus scrofa} MEGNKSWIAEFILVGFQLTEEMELLLFGIFSLLYIFNLLANGIILGLICLDPRLHSPMYYFLSHLAIIDMSYASSNLPNLLANLLNHKKTISFILCTLQMIFNLSFASIE
CLILVVMSYDRYVAICHPLQYTVIMNWRLCTVLAITSWACGFSLALVQVILLLRLSFCGPQQVNHFFCEIRSVLKLACGNTWINEIFLFADGVFILVGPLSLMLVSYVHI
LWAILKIQSKEGRKKAFSTCSSHLCVVGFYFGIAMMVYLVPDNNQREEQQKILFLFYTLFNPLLNPLVYSLRNAQVKSAFHRVLQKKRTR*
933 >lcl|XP_003130337.1|Plus1complement(15274..16206) NW_003300625 olfactory receptor 2A2-like LOC100525242 __SEG__ Chr9 {Sus scrofa} MEGNQSWITEFILVGFQLREEMELLLFVIFFLLYIFNLLANGMILGLICLDLKLHSPMYYFLSHLAVIDMSYPSSSLPNMLENLVKHKKTISFDSCTMQMVFSLAFGSVE
CLILVVMSYDRYVAICHPLRYTVIMNWKLCIVLAITSWACGFSLALVQVFLLLRLSFCGPQKINHFFCEFRSVLKVACGDTWISEISLFADGVFILVTPISLVLVSYVRI
LWSVLKIQSKEGRKKAFSTCSSHLCVVGFYFGLAMIVYMVPDNSKQEEQLKILFLFYTLFNPLLNPLVYSLRNAQVKAAFYRVLQINTTV*
934 >lcl|XP_003130338.1|Plus1complement(32933..33874) NW_003300625 olfactory receptor 2A1/2A42-like LOC100525417 __SEG__ Chr9 {Sus scrofa} MGENQTMVTEFILLGFPLNPRIQLFLFGLFFLCYAFTLLGNGVILGLISLDSRLHTPMYFFLSHLAIVDVAYACNTVPQMLINLLSPTKPISFTGCMTQTFLFLSFAHTE
CLLLVVMSYDRYVAICHPLRYSAIMSWRLCFILVVTSWACGSLLALVHVVLILRLPFCGPREINHFFCEILAVLKLACADTWLNQVVIFAACMFILVGPLCLVLVSYTHI
LFAILGIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYIAPNSHHPQEQQKVLFLFYSLFNPMLNPLIYSLRNAEVKGALRRAVFKERHFQLE*
935 >lcl|XP_003130339.2|Plus1138794..139489 NW_003300625 olfactory receptor 2A2-like LOC100525768 __SEG__ Chr9 {Sus scrofa} MLENLVKHKKTIPFVSCTLQMLFYLAFGSVECLILVVMSYDRYMAICHPLQYTVIMNWRVCTVLAIASWACGFFLALVQVSLFLRLPFCGPQKVNHFFCEIQSVLKVTCG
ETWINEIFLFADSVFILVGPLSLVLVSYVRILWSVLKIQSKEGRKKAFSTCSSHLCVVGFYFGIVMMVYLVPDNSQQEEQQKILFLFYTFFNPLLNPLVYSLRNAQVKSA
FHRMLQKNWTL*
936 >lcl|XP_003130340.1|Plus1complement(193157..194089) NW_003300625 olfactory receptor 13-like LOC100511466 __SEG__ Chr9 {Sus scrofa} MGDNMTSVTEFILLGFSLDPRIQLFLFGLFFLCYAFTLLGNGVILGLISLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLINLLSPTKPISFTGCMTQTFLFLSFAHIE
CLLLVVMSYDRYVAICHPLRYSAIVSWRVCITLVVIPWAIGVLLSLIHLVLLLPLPFCISQKINHFFCEIMALLKLACADTHINETVVLAGAISVLLGPFSLIVISYMCI
FCSILRIQSGGGQKKAFSTCSSHLCVVGLFYGTAIITYVGPRYGNPKEPKKYLLLFHSLFNPMLNPLIYTLRNLEVKGALKRVLGIKRAL*
937 >lcl|XP_003130341.1|Plus1complement(224116..225048) NW_003300625 olfactory receptor 2A2-like LOC100511653 __SEG__ Chr9 {Sus scrofa} MEGNKSWIAEFILVGFQLTEEMELLLFGIFSLLYIFNLLANGIILGLICLDPRLHSPMYYFLSHLAIIDMSYASSNLPNLLANLLNHKKTISFILCTLQMIFNLSFASIE
CLILVVMSYDRYVAICHPLQYTVIMNWRLCTVLAITSWACGFSLALVQVILLLRLSFCGPQQVNHFFCEIRSVLKLACGNTWINEIFLFADGVFILVGPLSLMLVSYVHI
LWAILKIQSKEGRKKAFSTCSSHLCVVGFYFGIAMMVYLVPDNNQREEQQKILFLFYTLFNPLLNPLVYSLRNAQVKSAFHRVLQKKRTR*
938 >lcl|XP_003130349.1|Plus1complement(281046..281978) NW_003300625 olfactory receptor 2A2-like LOC100513612 __SEG__ Chr9 {Sus scrofa} MEGNQSWITEFILVGFQLREEMELLLFVIFFLLYIFNLLANGMILGLICLDLKLHSPMYYFLSHLAVIDMSYPSSSLPNMLENLVKHKKTISFDSCTMQMVFSLAFGSVE
CLILVVMSYDRYVAICHPLRYTVIMNWKLCIVLAITSWACGFSLALVQVFLLLRLSFCGPQKINHFFCEFRSVLKVACGDTWISEISLFADGVFILVTPISLVLVSYVRI
LWSVLKIQSKEGRKKAFSTCSSHLCVVGFYFGLAMIVYMVPDNSKQEEQLKILFLFYTLFNPLLNPLVYSLRNAQVKAAFYRVLQINTTV*
939 >lcl|XP_003130367.1|Plus1470516..471601 NW_003535614 probable G-protein coupled receptor 52-like LOC100518923 __SEG__ Chr9 {Sus scrofa} MNESRGIEWRILNMSSGTLNVSERHSCPLGFGHYSAVDVCIFETVVIVLLTFLIIAGNLTVIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGIHE
SLTCQVFGYIISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCASSWLTSAYFTGFIVCLLYAPAAFVVC
FTYFHIFKICRQHTKEINDRRARFPSHEVTASGETGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRR
LSETMCTSCMCVKDQEARDPKPRKRANSCSI*
940 >lcl|XP_003130605.1|Plus1complement(316621..317922) NW_003300694 beclin-1-like protein 1-like LOC100512673 __SEG__ Chr10 {Sus scrofa} MSSFRFICQRCSQPLKLTESTETSQERAASLLHSARGEPGEPQGASSGEGASVINLQDGASCLPFPGGGMFWASSEFTLLGRLGSLRSLNSIQKAIRDIFGILSGETVVD
HPLCQHCTDCLLEQLDAQLTTTDSEVQNYRRCLETRGWGSEAERETLRKQLKGLELEELRLVQELEQVQKNRERTTADLEAAQAETEMLDQKEWQYQKDYSKLKWQQLEL
HDELDSVARRLEHAQTRWDQLEKTNVFRATFEIRHAGPIAIINNFRLGSLPTVPVGWNEINAAWGQTALLLHALSNAIGLEFQRYRLVPCGNYSYLKSLTGDHVELPLFA
NGQQSVFLNNKFDQAMVAFLDCMQQFKEAAEKSEPPLFWPYKIDVKKGLMEDPGSHGGFCPIRTHLNTEEEWTRALKLMLINFKSSLLWVSLRYRQKRLSFSP*
941 >lcl|XP_003130622.1|Plus1211551..213395 NW_003300702 uncharacterized protein C1orf65-like LOC100517728 __SEG__ Chr10 {Sus scrofa} MEGLGHFSPRPYPDLWEPPPPREDRASSARLGGLGPQTEPDLCSWAMTPGEGSEAAAPWLYPPCSPTPSRCRYPDSPRESCSLTDVARRPPDRAKKHRPRSRLLEDAWGE
ARTKLQAQGGSPHNPAWQQQPSCQHCPPARGDSPPPYPHGAYTPPRGTSRVEEVPSGDQWAARVCRGLGRWSLSSVHTEKSSVASRELGTQSACAYIQKRHSNETVASLA
SQYSLSSKGVQSQHTQILQNKLEEAVMSSRDQKIIALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVQLTLERERQLLLQQSQEQWQQEKEQRVRRRDRQAKITTQQE
SGWKGQLEDSENRRQETLERAPSETEMEHGKQCEVQRLQEQERMLHDLREQNSRLQLQKRPVQAFQKKHTHTTEGQKKVQETNLSSLVNYQARKVLMDCQAKAEELLRKL
SLEQSFQWSQEIPQGVIKAHHREPKEKVQKEDAQFQQVKWRPGESEEQRKEHKRLLVELAKQKILQTRSKVHKNISDKAQHPRELSILRENTHHILKLKAEKEEKSHVDG
IKEAMRKKERRIEQISREKDAPSEGFQKISRAAGTDNARAPASSCFDRAARGAQERAGQQRGGY*
942 >lcl|XP_003130633.1|Plus1272336..273484 NW_003535665 zinc finger and BTB domain-containing protein 41 ZBTB41 __SEG__ Chr10 {Sus scrofa} MKKRRKVTSHLEKIHLGYHKDSSDGNVAAECEQITCTHSTERPAPDTLRCYQELPPSPDQRTLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGS
SYFHACLSKNPSADVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVATFQSELTEKSSPEETLSELTGRLSNNHQCKFCSRHFCYKK
SLENHLAKTHRSLLLGKKHGLKMLERGFSARRPKRNRKCPVKFDDTSDDEQESGDGSDNLNQDHFDKEKSDRNDSEDPGSEYNAEEDELEEEMSDEYSDIEEQSEKDQND
AEEEPEAGDSVGSIHEGLTPVVIQNSNKKILQCPKCDKTFDRIGKKKLVSSL*
943 >lcl|XP_003130742.1|Plus11013734..1015554 NW_003535691 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2-like LOC100515620 __SEG__ Chr10 {Sus scrofa} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECNADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGIYVCIASNAAGNDTFTASLTVKGFTSDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVAEGEVAGPRRFNMKMI*
944 >lcl|XP_003130780.1|Plus1580409..580558 NW_003300736 ras suppressor protein 1-like LOC100524578 __SEG__ Chr10 {Sus scrofa} MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLCKSPEDFRLGGKV*
945 >lcl|XP_003130872.1|Plus1complement(685284..685733) NW_003535732 calmodulin-like LOC100516639 __SEG__ Chr10 {Sus scrofa} MAEQLSKEQVAKFKEAFDRIDKNKDGTINVQELGAVMRSLGHNPSEAELKELIARVDKDGDGSISFEEFLAAMVTVMQAHGSQGGLRETFRAFDLDGDGHISVDELRQTM
AKLGETLSPEELDMMIREADVDQDGRVNYEEFLRVLAQK*
946 >lcl|XP_003131043.1|Plus1105185..107227 NW_003535777 kelch repeat and BTB domain-containing protein 7-like LOC100511833 __SEG__ Chr11 {Sus scrofa} MQSREEASRSRRLASPRGGRRPKRISKPSVSAFFTGSEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLA
QLLAVLRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDKDREYLEGLLTKPIVKKYCLDLMEGVLQMRYGDMLYKSLVPKPESSSGNSVVSIAENP
PQRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRD
PVTGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDS
ETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFTD
DEVWVQVAPQRNAQDQQGSL*
947 >lcl|XP_003131064.2|Plus1complement(817918..821016) NW_003535797 protocadherin-9-like LOC100520265 __SEG__ Chr11 {Sus scrofa} MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECF
FELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVM
KIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTV
LASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIV
ASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTP
PLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAK
VTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLV
FLYVNDTAGNASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIVAGAMVVIVVIFVTVLVRCRHASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSS
LLNFVTIEESKPDDAVHEPINGTISLPAELEEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTLSKRSSTSSDH
FSASECSSQGGFKTKGPLHTRQVNEHFYWSISTAYKCPVNQY*
948 >lcl|XP_003131107.1|Plus1complement(1623942..1624937) NW_003535832 n-arachidonyl glycine receptor-like isoform 1 LOC100153378 __SEG__ Chr11 {Sus scrofa} MTTPHNQTHPGPSDNSHPDEYKIAALVFYSCIFIIGLFVNVTALWVFSCTTKKRTTVTIYMMNVALLDLIFILTLPFRMFYYAKGEWPFGANFCQILAALTVFYPSIALW
LLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYDDPDRASTPATCLKISDIIHLKAINVLNFTRLIFFFLIPLFIMIGCYLVIIHSLLHGKTS
KLKPKVKEKSIRIIITLMVQVLVCFMPFHVCFAFLMLGGDENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSVRRKSFRSGSLRSLSNINSEM
L*
949 >lcl|XP_003131483.1|Plus1207505..207861 NW_003300911 hypothetical protein LOC100514981 LOC100514981 __SEG__ Chr12 {Sus scrofa} MGCCPGDCVTCCPQEQDCCEVCCCQPACCGCCDCCASCCGSCCGCGGCGGCGGCGDCGGCGGCGGGCCGSSCCGSGCGGCGGCGGCGGCGGCCGSGCCGPSGCCGPVCCQ
PTPVCDTK*
950 >lcl|XP_003131501.1|Plus1173225..173578 NW_003300912 keratin-associated protein 2-3-like LOC100518750 __SEG__ Chr12 {Sus scrofa} MTGSCCAQPCCQRDPCCCRPVSCQTTVCRPVTCAPRYTRSICEPCRRPVCCDPCSLQEGCCRPITCCPSSCQAVVCRPCCWAIPCCRPVSVQSPCCRPPCCQPAPCRTVC
RTFPSCC*
951 >lcl|XP_003131502.1|Plus1121267..121620 NW_003300912 keratin-associated protein 2-3-like LOC100518930 __SEG__ Chr12 {Sus scrofa} MTGSCCAQPCCQRDPCCCRPVSCQTTVCRPVTCAPRYTRSICEPCRRPVCCDPCSLQEGCCRPITCCPSSCQAVVCRPCCWATPCCRPVSVQSPCCRPPCCQPAPCRTVC
RTFPSCC*
952 >lcl|XP_003131503.1|Plus162968..63321 NW_003300912 keratin-associated protein 2-3-like LOC100519107 __SEG__ Chr12 {Sus scrofa} MTGSCCAQSCCQRDPCCCRPVSCQTTVCRPVTCAPRYTRSICEPCRRPVCCDPCSLQEGCCRPITCCPSSCQAVVCRPCCWATPCCRPVSVQSPCCRPPCCQPAPCRTVC
RTFPSCC*
953 >lcl|XP_003131511.1|Plus1complement(357469..357648) NW_003300912 hypothetical protein LOC100520514 LOC100520514 __SEG__ Chr12 {Sus scrofa} MVTFSFPLRRPPSPNPPKPPPPKPPPPPKLPPPKPPPPKPPPPPKLPPPKPPPPKLLPP*
954 >lcl|XP_003131692.1|Plus1688870..689805 NW_003535885 olfactory receptor 4D2-like LOC100514728 __SEG__ Chr12 {Sus scrofa} MESGNLTWVSEFVFLGLSQTRELQLLLFLVVLFVYTTTVLGNLLIMVSVTSDSRLHTPMYFLLRNLALLDLSVSSVISPKMLVDLLSEKKTISYQGCMAQIFFFHFVGGG
IVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVASWVGGFIHSISQMALMLPLPFCGPNVLDNFYCDIPQVLRLACTDTSLLEFLIICNSGVLVLIWFLLLLISYSV
ILVMLRSHSGQARRKAASTCTTHIIVVSMGFIPSIYLYARPFTSFPMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAMKRLVKHLVIGSRE*
955 >lcl|XP_003131700.1|Plus1complement(561493..562428) NW_003535885 olfactory receptor 4D2-like LOC100516038 __SEG__ Chr12 {Sus scrofa} MEPGNLTWVSEFVFLGLSPSQEFQFFLFPVFLFVYTTTVMGNLLIMVTITSDARLHTAMYFLLRNLALIELCFSSVIAPKMLVDLLSEKKTISYEGCLAQIFFFHFLGGA
TIFFLSVMAYDRLVAISRPLHYVIIMNTQLCVGLVVASWVGGFVHSISQLALMLPLPFCGPNVLDNFYCDIPQVLRLACTDTSLLEFLIICNSGVLVLIWFLLLLVSYSI
ILVMLGAHSGQARRKAASTCTTHIVVVSMVFIPSIYLYARPFTSFPMDKAVSISQTVMTPMLNPLIYTLRNQEMQAAVKRRARRWVLWKRE*
956 >lcl|XP_003131702.1|Plus1704050..704985 NW_003535885 olfactory receptor 4D2-like LOC100516933 __SEG__ Chr12 {Sus scrofa} MEPGNLTWVSEFVFLGLSPSQEFQFFLFPVFLFVYTTTVMGNLLIMVTITSDARLHTAMYFLLRNLALIELCFSSVIAPKMLVDLLSEKKTISYQGCLAQIFFFHFLGGA
TIFFLSVMAYDRLVAISRPLHYVIIMNTQLCVGLVVASWVGGFVHSISQLALMLPLPFCGPNVLDNFYCDIPQVLRLACTDTSLLEFLIICNSGMLVLIWFLLLLISYSA
ILVMLRAHSGQARRKAASTCTTHIVVVSMVFIPSIYLYARPFTSFPMDKAVSISQTVMTPMFNPLIYTLRNQEMQAAVKRRARRWVLWKRE*
957 >lcl|XP_003131728.2|Plus1complement(229092..230030) NW_003535167 olfactory receptor 14J1-like LOC100522462 __SEG__ Chr7 {Sus scrofa} MANFTAVSGFLLMGFSAKPELEALWASLFLVLYLVALTGNTLIIAATSMDDSLYSPMYFFLKHLSFLDICYISVTVPRSICNSFRHTSSISLWECILQCLAFILCGSAEL
AMLTVMSYDRYVAICLPLRYEIIMNVNTCIHGILAVWISGVVSGVMHTSATFSIHFCGANVIHQFFCEVPQLLKLACSDEYVSELGVTGFVSLVAFLCFLSIGFSYTRIF
STVLRIPSAEGRAKAFATCLPHLAVVTLFLSTGAFEFLKPHSDSPTALDFLLTLFYTVLPPTLNPMIYSLRNKAMKAALQKFVKKRKAYLFC*
958 >lcl|XP_003131731.1|Plus1complement(210036..210962) NW_003535167 olfactory receptor 12D2-like LOC100523396 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAVYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKMLGNFLSSHKAISFWGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLRYTLIMNPWVCTQMAATVWIIGFFHALMHSIMTSRLHFCGSNHIHHFFCDIKPLLKLACGNTELNQWLLNTVTGTIAMGPFFLTLLSYFYII
IHLFFKTHSCSMLHKALSTCASHFMVVVLLYAPVIFTYIRPASSSSMDQDWIIAIMYSVVTPVLNPLIYTLRNKEVKGALKRVFRNGL*
959 >lcl|XP_003131888.2|Plus1complement(32821..33750) NW_003535909 olfactory receptor 1A1-like LOC100513947 __SEG__ Chr12 {Sus scrofa} MGEGNQSSNLDFILLGVSGQKEQENLFFTLLLFIYPITLMGNLLIILAIHCDVRLHNPMYFLLVSLSFVDIFFSSVTIPKALANHLLGTKAISFGGCLTQMYFMLALVNT
DSYILAAMAYDRAVAITRPLHYTTVMSPRACVLLVVGSWVMGNANAVPHTLLTARLSFCANKEVANFYCDLASLLKLSCSDIHFNVKMMYVGVGVFSVPLLCIVISYVQV
FSTVLRVPSTKGVRKAFSTCGSHLTVVSLYYGTVMGMYYRPLTSHSLKDAMITVMYTAVTPMVNPFIYSLRNQDMKAALGKLFSKRISS*
960 >lcl|XP_003131890.1|Plus1complement(253688..254635) NW_003535909 olfactory receptor 3A1-like LOC100514318 __SEG__ Chr12 {Sus scrofa} MEPESGANGTVVTEFILLGLVEAPGLRPAVFVLFFFAYLLTVGGNLSILAAILVEPRLHTPMYFFLGNLSVLDIGCITVTVPSMLSRLLSHKHTVPYAACLTQLFFFHQL
AGVDCFLLTAMAYDRFLAICRPLTYSSRMSQMVQRILVAVSWGCAFTNALTHTVAISTLNFCGPSVINHFYCDLPQLFQLSCSSTQLNELLLFGLGILMAGAPVILIVTS
YIHVAAAVLRIRSAEGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVEASDKDKGIGILNTVISPMLNPLIYSLRNPDVQGALWRVLTGKRVLA*
961 >lcl|XP_003131891.1|Plus1complement(228544..229491) NW_003535909 olfactory receptor 3A2-like LOC100514488 __SEG__ Chr12 {Sus scrofa} MEPEAGNNRTAVTELILLGLVDTEKLQPVVFVLFLFAYLLTVGGNLSILAAILVEPTLHTPMYFFLGNLSALDIGCITVTVPAMLGRLLSHKRTISYEACLSQLFFFHLL
AGMDCFLLTAMAYDRFLAICRPLTYSSRMSQMVQRMLVAVSWACAFTNALTHTVAISTLNFCGPSEVNHFYCDLPQLFQLSCSSTQLNELLLFGVGFIMAGAPLVLIITS
YIHVAAAVLQIRSAEGRKKAFSTCGSHLTVVCLFYGTGIFSYMRLGSEEASDKDKGVGVFNTVINPLLNPLIYSLRNPDVQRALWRVLVGRRSLA*
962 >lcl|XP_003131892.1|Plus1215880..216830 NW_003535909 olfactory receptor 1P1-like LOC100514870 __SEG__ Chr12 {Sus scrofa} MAGGNQSSVFEFLLWGLSEQPAQQHMLFLLFLWMYVVTVAGNLLIILAIVTHTHLHTPMYFFLASLSWADILFTSTTVPKALVNIQTQSRSISYAGCLVQLYFFLTFGDM
DIFLLAAMAYDRHVAICHPLHYTMVMSRQRCIVLVTACWTLTSLVAMTHTFLIFRLSFCSKKIIPDFFCDLGPLMKLSCSDTRVNELVLLFLGGAVILIPFMLILASYIH
IVSAIFRVPSAQGRYKAFSTCGSHLAVVALFFGTVIRAYLCPSSSSSNAVEEDTAAAVMYSVVAPLLNPFIYSLRNKDMQGALGRLLRGKVSSWGQ*
963 >lcl|XP_003131899.1|Plus1complement(94379..95320) NW_003535908 olfactory receptor 1D2-like LOC100516152 __SEG__ Chr12 {Sus scrofa} MDGGNQTRASDFLLLGISESPGQQRVLFWMFLSMYLVTVVGNMLIILAIGSDSRLHTPMYFFLANLSSTDLFFVTNTIPKMLVNLQSQNKAISYAGCLTQLYFLVSLVTL
DNLILATMAYDRYVAICQPLHYVTVMSPGLCASLLALCWALSALYGLTLTLLMTRVTFCGSRKIHYIFCEMYVLLRLACSNTEIIHTSLITTGIFIFLTPCGFMITSYVR
IVRAILRIPSASGKYKAFSTCASHLAVVSLFYGTLCMVYLQPLHTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLPEKGFHLWT*
964 >lcl|XP_003131900.1|Plus1complement(120101..121036) NW_003535908 olfactory receptor 1A1-like LOC100516511 __SEG__ Chr12 {Sus scrofa} MREENQSSALDFILLGISGQQKQEDFFFFLFLFIYPITLIGNLLIILAIHCDVRLHNPMYFLLANLSFVDIFFSSVTIPKMLANHLLGTKAISFGGCLTQMYFMIALGNT
DSYILAAMAYDRAMAITRPLHYTTIMSPRACVLLVVGSWVVGNANAVPHTLLTARLSFCANKEVANFYCDIAPLLKLSCSDIHFNVKMMYVGVGVFSVPLLCIIISYVQV
FSTVLRVPSTKGVRKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVITVMYMAVTPMLNPFIYSLRNRDMKAALGKLFSKSTSQPV*
965 >lcl|XP_003131901.1|Plus1complement(127417..128355) NW_003535908 olfactory receptor 1A1-like LOC100516694 __SEG__ Chr12 {Sus scrofa} MTEENQSSALDFILLGVSGHQEQETLFLILFLFMYPITVTGNLLIILAICCNSRLHNPMYLLLANLSFVDIFLSSVTIPKTLVNYLLHSKAISFGGCLTQMYFMIALANT
DSYILAAMAYDRAMAITRPLHYTTIMSPRACVLLVVGSWVVGNANAVPHTLLTARLSFCANKEVANFYCDAVPLVKLSCSDTHFNVKMMYVGVGVFSVPLLCIIISYVRV
FSTVLRVPSTKGVRKAFSTCGSHLTVVSLYYGTVMGMYLRPLTSYSLKDAVITVMYMAVTPMLNPFIYTLRNGDMKAALGKLCSKRISLKPT*
966 >lcl|XP_003131902.2|Plus1complement(19942..20880) NW_003535909 olfactory receptor 1A1-like LOC100517054 __SEG__ Chr12 {Sus scrofa} MTEENQSSALDFILLGVSGHQEQETLFLILFLFMYPITVTGNLLIILAICCNSRLHNPMYLLLANLSFVDIFLSSVTIPKTLVNYLLHSKAISFGGCLTQMYFMIALANT
DSYILAAMAYDRAMAITRPLHYTTIMSPRACVLLVVGSWVVGNANALLHTLLTARLSFCRNQKIANFYCDIVPLLKLSCSDIHFNVKMMYVGVGVFSVPLLCIIISYVRV
FSAVLRVPSTKGVSKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVMTVMYMAVTPMLNPFIYTLRNGDMKAALGKLCSKRISLKPT*
967 >lcl|XP_003131903.1|Plus1278178..279125 NW_003535909 olfactory receptor 139-like LOC100517239 __SEG__ Chr12 {Sus scrofa} MELGARGNRTAVTEFILLGLTENIRLQAILFTVFLFAYVITVGGNFSILAAIFVEPKLHTPMYYFLGNLSLLDIGCITVTVPPMLACLLTHQCRVPYAACISQLFFFHLL
AGVDCHLLTAMAYDRYLAICQPLTYSTRMSREVQAALVGICCTISLINALTHTVAVSVLDFCGPNVVNHFYCDLPPLFQLSCSSIHLNGQLLFAGATFMGVVPMILISVS
YTHVAAAVLRIRSAEGRKKAFSTCGSHLTVVCIFYGTGFFSYMRLGSVSASDKDKGIGILNTILSPMLNPVIYSLRNPDVQGALKRVLTGKRPPE*
968 >lcl|XP_003131904.1|Plus1266723..267670 NW_003535909 olfactory receptor 3A4-like LOC100517422 __SEG__ Chr12 {Sus scrofa} MDLGASENDSVVTEFVLLGLTDTPSLHPILFVIFLLAYVATVAGNFSILAAIFAEPKLHTPMYFFLGNLSLLDVGCISVTVPAMLRHFMSNNRSIPYTSCLSQLFFFHLL
AGVDCFLLTVMAYDRYLAICQPLTYSTRMSWGIQQALAGMSCVFSFTNALTQTVALSTLNFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMGVAPLVLITVS
YGHVAAAVLRIRSAEGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVEASDKDKGIGILNTVISPMLNPLIYSLRNPDVQGALRRVLMGREPPK*
969 >lcl|XP_003131905.1|Plus1complement(239049..>240035) NW_003535909 olfactory receptor 3A1-like LOC100517605 __SEG__ Chr12 {Sus scrofa} FLISLDISLQELRQPKSGASGTVVTEFILLGLVETPGLRPAVFVLFFFAYLLTVGGNLSILAAILVEPKLHTPMYFFLGNLSVLDIGCITVTVPSMLSRLLSHKHTVPYA
ACLTQLFFFHLLVGVDCFLLTAMAYDRFLAICRPLTYSSRMSQMVQRMLVAVSWACAFTNALTHTVAISTLNFCGPSVINHFYCDLPQLFQLSCSSTQLNELLLFGVGFI
MAGTPMALIVTSYIHVAAAVLRIRSAEGRKKAFSTCGSHLTVVAIFYGTGIFNYMRLGSAKLSDKDKAVGIFNTVLNPMLNPIIYSLRNPDVQGALWRVLRGRRSVAG*
970 >lcl|XP_003131906.1|Plus1293596..294567 NW_003535909 olfactory receptor-like protein DTMT-like LOC100517779 __SEG__ Chr12 {Sus scrofa} MTGRNQTVVSEFLLLGLPIEAEHRSLFCALFLAVYLSTVLGNLLIMVLICLDAHLHTPMYFFLSNLSFSDLCFSSVTMPKLLQNMQSQDPSIPYAGCLTQMYFFFFFGDL
ESFLLVAMAYDRYVAICFPLRYTTIMSPKLCLSLVVLCWLLTTLHAMLHTLLTARLCFCGDNVIPHFFCDLSALLKLSCSDTGVNVLVIFIIGGLIVVVPFLLILVSYAL
IFSSILKAPSAKGFCKAFSTCGSHLSVVSLFYGTVIALYLCPSAKNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKGALGRFCLSLLVNLGFGHNFVKHTH*
971 >lcl|XP_003131907.1|Plus1complement(322986..323930) NW_003535909 olfactory receptor 1L6-like LOC100518149 __SEG__ Chr12 {Sus scrofa} MALANLTSTPEFLLLGLMDGTDIHPLLFLLFLGVYLVNALGNLSMVVVVRSDGALRSPMYYFLGHLSLVDVCFTTVTVPRLLAGLLHPGQAVSFQGCFAQMYFFVALGIT
ESYLLAAMSYDRAVAVCRPLHYGSVMTPWRCTALVGASWAVAHLHSLLHTVLISKLSYPRSAPVRHFFCDMTVMLSLATSDTSAAETAIFSEGLAVVLTPLLLVSLSYAR
ILVTVLGVRSAGGRRRTFSTCGAHLVVVSLFFGSILSVYFRPSSAYSARYDRLASVVYAVVTPTLNPFIYSLRNKEVKGSLKRGLRWRAALQEV*
972 >lcl|XP_003131908.1|Plus1386097..387047 NW_003535909 olfactory receptor 1E5-like LOC100518333 __SEG__ Chr12 {Sus scrofa} MMGRNKTVISEFLLLGLPIAPEHQNLFYALFLAMYLTTVLGNLLITFLIQLDSYLHTPMYFFLSNLSFSDLCFSSVTIPKLLQTMQSQDPSIPYAGCLTQMYFFLFFADL
ESFLLVAMAYDRYVAICFPLRYTTIMSPKLCLSLVVLSWLLTTLHAMLHTLLMARLCFCGDNVIPHFFCDMSALLKLSCSDTGINELVIFIMGGLILVIPFLLIVMSYAR
IVSSILRVPSTRGIRKAFSTCGSHLSVVSLFYGTVIALYLCPSAKNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKGALGRVFWKKETPFSLCC*
973 >lcl|XP_003131967.1|Plus1complement(152741..154624) NW_003535912 platelet glycoprotein Ib alpha chain LOC100515052 __SEG__ Chr12 {Sus scrofa} MPLLLLLLLLPGPSHPHSICEVTKVASQVEMNCENKTLKAPPPDLEAETTNLHLGENPLGTFSTSSLVYLPRLTQLHLGKCQLTRLQVDGKLPRLETLRLAHNKLKSLPS
LGQALPALVTLDVSFNELASLSPGVLDGLSHLQELYLRGNRLKTLPPGLLAPTPKLKKLNLAENQLKELPPGLLDGLEEPDTLYLQGNWLRTIPEGFFGSHLLPFAFLHD
NPWLCDCAILYFTRWLQTNNVYEWKEGVDVKVMTPNVRSVRCSNSDPAEFVYTYKGEGCPTLSPEDSLDYDVYDDEVPAAKAAPASTSSRHTWAPTTSWGLLYSAPTTPL
HNHTPYSPSTEEEATAPRAAGTTMSFATLELSPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTPEPLTTTP
EPTTPTALEPRTTLKAPEPTIFLTSTGLPSALEFTVTTSSEYVNLSKSFGLAPENLDSSRNDPFLNLDSCCLSLVFYVLGLLWLLFSSLILILLLIWVRQVKPQALATAT
HTTHLELQRERQVTVPRAWLLSLQGSLPTFRSSLFLWVRPNGRVGPLLRGRRPSALSQARGQDLLGTVGFRYSGHSL*
974 >lcl|XP_003132087.1|Plus1120958..121083 NW_003300981 GRB2-related adapter protein-like LOC100511409 __SEG__ Chr12 {Sus scrofa} MESVALYSFQATESDELAFNKGDTLKVGRPELSGPRTGQGA*
975 >lcl|XP_003132124.1|Plus1369399..370178 NW_003535939 leucine-rich repeat-containing protein 3B-like LOC100523139 __SEG__ Chr13 {Sus scrofa} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
976 >lcl|XP_003132414.1|Plus1262760..264217 NW_003535996 histamine H1 receptor-like LOC100523996 __SEG__ Chr13 {Sus scrofa} MTFPNSSFTLEDNMCEANKTTMANPKLMPLVVVLSAVSLVTVGLNLLVLCAVRSERKLHTVGNLYIVSLSVADLIVGAIVMPMNILYLLMSRWSLGRPLCLFWLSMDYVA
STASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILVAWLFSFLWVIPILGWHRFVSRTSRRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRRH
CQHRELINGSLPSFSEIKLKPENPKVGAKKAGKESPWEVLKRKPKDAGGGPVLKPSSQDSVEMKSPGVSSQEDGELDKFHCFTLNIVQTQMEAEGSSKGYVAVIHSQSQL
EMDEQGLNMRGANEISEDQTLGDSQSSRTDSDTPTEPVPGKSKPRSGSSTGLDYIKLTWKRLRSHSRQYVSGLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCK
SCCNEHVHMFTIWLGYINSTLNPLIYPLCNENFKKTFKKILHIRS*
977 >lcl|XP_003132509.1|Plus1387802..388935 NW_003536013 progestin and adipoQ receptor family member 9-like LOC100516760 __SEG__ Chr13 {Sus scrofa} MPRRLQPRSAGTKGPPGMTAAASEAASRSHPSASGDPAASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGR
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTGLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCSYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLKAPPDAPTFCGTVGYMLLLVICLGLVIKKFLNNSEFCSKK*
978 >lcl|XP_003132517.1|Plus151042..52121 NW_003301109 type-1 angiotensin II receptor LOC100519976 __SEG__ Chr13 {Sus scrofa} MILNSSTEDSIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSF
NLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVCAFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWK
ALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICLAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSL
STKMSTLSYRPSENGSSSTKKSAPCTEVE*
979 >lcl|XP_003132536.1|Plus1560962..561978 NW_003536020 p2Y purinoceptor 14-like LOC100524220 __SEG__ Chr13 {Sus scrofa} MMNATTTQAPEESCPQNTLITQKIIPALYFVVFVAGILLNGVSGWIFFYVPSSKSFIVYLKNIVVADFLMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYINMYVSIV
FFGFIGFDRYYKIVKPLLTSFVQSVTSSKLLSVLVWSLTLLLAVPNMILTNQSVREGTRIKCVELKNELGRNWHKASNYIFVGIFWIVFLSLIIFYTAITRKIFKSHLKA
RKNSSSVKKKSSRNIFSIMFVFFVCFVPYHIARIPYTRSQTEAHYSCQSKEILLYVKEFALLLSAANVCLDPIIYFFLCQPFREILCKKLHIPVKAWHDLETSKTKRGNI
MQESTDTL*
980 >lcl|XP_003132649.1|Plus1complement(613888..615597) NW_001885223 platelet glycoprotein V-like LOC100523640 __SEG__ Chr13 {Sus scrofa} MLRSVLLGAALGLLRAQRFPCPPSCVCMFRDAAQCSGSSVARIAALSLPTNLTHLLLFRMGRGALQNHSFSGMTVLQRLMLSDSHVTAIAPGTLNDLIKLKTLRLSRNKI
THLPGALLDKLVLLEQLFLDGNELKSLDQNMFQKLVSLQELFLNQNQFAFLPASLFAHLENLKLLDLSGNNLTHLPKGLFGAQVKLEKLLLHSNQLVSLDSGLLDSLRAL
KELQLDSNHIRSVAPGAFDRLRSLSSLTLARNRLEGLPSALFLHSRSLTFLTLFENPLEELPEVLFGEMGGLQELWLNGTQLLTLPAAVFRNLSGLWVLRVTLSPRLSAL
PEDAFRGLGELRVLALSSNGLASLPAGLLRGLGRLRHVSLRRNRLRTLPRALFHNLSSLAEVQLDHNQLETLPGDMFEGLPQLAEVLLGHNPWRCDCGLRPFLAWLRQHA
ALVGRAEPPLCHGPRPHAGLPLWALPAGDPGCPRLGSPPPRSPALGSSEGPRRPALPAAPPGAAGGLNRSEPWAWHPQGAEGQSPNHSRFWGLYFLLLAVQALITGIIVF
AMIKLCRLFRKLIRECALV*
981 >lcl|XP_003132768.1|Plus1complement(261442..262368) NW_003301181 olfactory receptor 5K1-like LOC100513311 __SEG__ Chr13 {Sus scrofa} MTGNNQSLTTEFTLTGFTDHPDLRTILFLVFLTIYLITMVGNLGLVALIFIERRLHTPMYIFLGNLALMDSCCSSSITPKMLQNFFSKDSIISLYECMAQFYFLCLAESA
DCFLLAAMAYDRYVAICNPLQYHTRMSKKLCIQMTTGAYLAGNLHSVIHVGLLFRLTFCGSHQINHFFCDVLPLYRLSCVDPYINELMILILAGFIQIFTITTVIISYLF
ILFIIFTMKSNKGRRKALSTCASHFLSVSIFYGSLIFMYVRPNSVKEEEKEKPVAVFYTIVIPLLNPFIYSLRNKEVMTVMKKMMKIS*
982 >lcl|XP_003132770.2|Plus1complement(308579..>309526) NW_003301181 olfactory receptor 5H2-like LOC100514072 __SEG__ Chr13 {Sus scrofa} GPFSNNMDIKNATSLTKFVLIGLIYQPEWHIHLFLMFLMLYLITTMGNLGLIYLICNDPQLHIPMYFFLGSLAFVDACISTTVTPKMLVSFLTESKMISLSECMTQLFSF
AFSATTECFLLATMAYDRYVAICKPLLYPVIMTNRLCFQLLGLSFVSGFIHSTIHIGFLFRLTFCKSNRIHHFYCDIMPLFKISCTDPSVNVLMVFIFSGSIQVFTILIV
LVSYTFVLFTILKMRSIQGIRKAFSTCGAHLLSVSLYYGPLLFRYVHPGSEKADDQDMMDSLFYTVIIPFLNPIIYSLRNKKVIDSLTKMLKRNV*
983 >lcl|XP_003132771.1|Plus1complement(113548..114471) NW_003301182 olfactory receptor 5AC1-like LOC100514252 __SEG__ Chr13 {Sus scrofa} MEEENKTLVTEFVLIGLTDLLGWQIPLFLVFLVIYLTTMVGNLGLIFLIWKDPHLHTPMYLFLGSLAFADACSSSSVTPKMLINFLSNSHLIPLSDCMAQFYFFGFSATT
ECFLLVVMAYDRYVAICNPLLYPVVISTRLCIQFIGVSYFTGFLHSAIHIGFLFRLSFCRSNIIHHFYCEILQVFKISCTDPTVNILLVFIFSAFIQVFTFIAIIVSYTG
VLFAILKNKSEKGRSKTFNTCSAHLLSVSLFYGTLFFMYVRPASGPSEGHGKIYSLFYTIIIPLLNPFIYSLRNKEVIGALRRKLKK*
984 >lcl|XP_003132774.1|Plus1complement(158131..>159084) NW_003301182 olfactory receptor 5H1-like LOC100514797 __SEG__ Chr13 {Sus scrofa} FQRSFIKHMETKNATELTEFVLTGLKYQSEWQIPLFLLFLIIYLITLIGNLGLIALICNDPHLHSPMYLFLGNLAFVDTWLSSTVTPNMLVNFFSKSKMISLSECKIQFF
SFAICATTECFLLATMAYDRYVAICKPLLYPVIMTNRLCIRLLILSFLGGLSHAIIHNVFLLRLTFCNSIIIHHFYCDIIPLFKISCTDPSINYMMVLIFAGIIQIFTIS
VVLASYTLVLFTILKKKSMQGIRKTFSTCGAHLLSVSLYYGPLLFMYVLPGSAEENDQDMMDSLFYAVIIPFLNPIIYSLRNKKVIDSVTKMLKRNV*
985 >lcl|XP_003132775.1|Plus1complement(7979..8977) NW_003301182 olfactory receptor 5H1-like LOC100514986 __SEG__ Chr13 {Sus scrofa} MVDDCPFYTCYILFQRTSFKNMETKNATELTEFVLTGLTYQQECKIPLFLLFLVIYIITIMGNLGLIALICNDLQLHIPMYLFLGNLAFVDTWLSSTVTPRMLVNILTKS
KMISLSECMTQCFSFVVSATTECFLLATMAYDRCVAICNPLLYPMIMTNRLCMRMLISSFVGGLLHALIHTGFLFRLTFCNSNVIHHFYCDIMPLFKISCTDPSINALMI
FVFSGSIQVFTILTVLVSYTQVLFTILKKKSLQGIRKAFSTCGAHLLSVSLYYGPLLFMYVRPGSEQAGEQDMIDSLFYTVIIPFINPIIYSLRNKSVIDSLRKTLKRNT
CI*
986 >lcl|XP_003132905.1|Plus1complement(466798..468543) NW_003536200 frizzled-10-like LOC100511782 __SEG__ Chr14 {Sus scrofa} MQRPSPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMC
EQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMFPPLFRPQRPHSAQEHQLKDGGPGRAGCDNPGKFHHVEKSASCAPLCTPGVDVYWS
RDDKHFAVVWLAVWSVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDIGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVIL
TLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDTNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL
MVRIGVFSVLYTVPATCVIACYFYERLNVEYWKILARQHKCQMNNQTKNLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRFKKKSRRKPASV
ITSSGIYKKAQHPQKTHLGKYEIPTQPPTCV*
987 >lcl|XP_003133241.1|Plus1complement(4630766..4631878) NW_003536311 prolactin-releasing peptide receptor-like LOC100523144 __SEG__ Chr14 {Sus scrofa} MASLPTQDPGGPDLFSGLPPAASTLANHSAEALVGNDSAAGPGAQAITPFQSLQLVHQLKGLIVLLYSIVVIVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMC
AACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAALHTYHVELKPHRVRLCEEFWGSQER
QRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVFNLLRDLDPRAIDPYAFGLVQLLCHWLAMSSVCY
NPFIYAWLHDSFREELRKLLLTWPRKVAPHGQSMTVSVVI*
988 >lcl|XP_003133291.2|Plus1complement(123302..124318) NW_003536326 olfactory receptor 13A1-like LOC100514734 __SEG__ Chr14 {Sus scrofa} MPPWAGLAVSQRLQGLNPQMTANNSTAVEEFVLQSFSEEPGPRILFLAVFLLLYLGALAGNALIVTAISLHPGLHTPMYFFLTNLAILDIVCTSTVVPKLLENLALKGGT
ITYQGCMTQLFFLTWCLGAELLLLTVMAYDRYVAICRPLHYSRLMGRPVCALLAGSVWAITVLNTSVHTGLMTRLMFCGHNQIQHFLCEIPTLLLLSCSPTTLNNVMMVL
ADVYFGVVNFLLTLASYAYIIASIVRMRSATGRQRAFSTCSSHLLVVTLYYSTVIYTYILPGSGSSLENGKVVAVLYTAVSPTLNPLIYSLRNKDVKVALGKVFSCIRGR
HGPCRLTG*
989 >lcl|XP_003133294.2|Plus1complement(434..1414) NW_001885567 olfactory receptor 13A1-like LOC100516159 __SEG__ Chr14 {Sus scrofa} MPPWAGLAVSQRLQGLTPQMTANNGTAVEEFVLQSFSEEPGPRILFLAVFLLLYLGALAGNALIVTAISLHPGLHTPMYFFLTNLAILDIVCTSTVVPKLLENLALKGGT
ITYQGCMTQLFFLTWCLAAELLLLTVMAYDRYVAICRPLHYSRLMGRPVCALLAGSVWAITVLNTSVHTGLMTRLMFCGHNQIQHFLCEIPTLLLLSCSPTTLNNVMMVL
ADVYFGVVNFLLTLASYAYIIASIVRMRSATGRQRAFSTCSSHLLVVTLYYSTVIYTYILPGSGSSLENGKVVAVLYTAVSPTLNPLIYSLRNKDVKVALGEVFSCI
990 >lcl|XP_003133445.1|Plus1complement(143868..144722) NW_003536414 protein phosphatase 1 regulatory subunit 3B-like LOC100515931 __SEG__ Chr15 {Sus scrofa} MAVDIECRYSCMAPSLRRERFTFQISPKPSKPLRPCIQLSSKNEASGTVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPLNITELLDNIVSLTTAESESFV
LDFAQPSADYLDFRNRLQTDHVCLENCVLKDRAIEGTVKVQNLAFEKMVKVRMTFDTWKSFTDFPCWYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQTY
WDSNKGKNYRIIRAELKSTQGTAQPQNGPDFGIALDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
991 >lcl|XP_003133643.2|Plus1complement(181976..183700) NW_003301421 frizzled-7-like LOC100513691 __SEG__ Chr15 {Sus scrofa} MRGPRTAASPSPLGLCTMVLAVLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC
TVLDKAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYMPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYL
GYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYVVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSEDGYRTVAQG
TKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFL
LAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWS
GKTLQSWRRFYHRLSHSSKGETAV*
992 >lcl|XP_003133662.1|Plus1complement(62623..64383) NW_001885667 frizzled-5-like LOC100519058 __SEG__ Chr15 {Sus scrofa} MARPDPSAPPSLLLLLLAQLAGRATAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCE
RAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLSGPPGAPASGSDCVAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAV
PCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASS
IWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKT
DKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGA
TATGDYAEASAALTGRTGPPGPAAATYHKQVSLSHV*
993 >lcl|XP_003133759.1|Plus1complement(681409..682371) NW_003536499 G-protein coupled receptor 55-like LOC100517685 __SEG__ Chr15 {Sus scrofa} MNQLNQSKDCNFNDVDKLMKTVQMTVNIPTFLLGLLLNLLAIRGFSSFLKKRWPYYAATSIYMINLAVFDLLLVLSLPFKMALSHVKAPFLPFCTLVECLYFISMYGSIF
TICFISLDRFLAIRYPLLVSHLRSPRKVLGICCIIWVLLWVGSTPVYSFHQKEENYTCFHNLSDGTWSVKVLLPLEVFGFLLPMSIMGFCSSRSICILVRRRNHTQDWVQ
QKTCIWTIAANLVVFVVSFLPVHLSFFLQFLVRNGFIMECRTRQNISLFVQLSMCFSNFNCCLDVFCYYFVIKEFRMDIMTHHRPSRVQVVRQDTMTTRG*
994 >lcl|XP_003133807.1|Plus1148719..149807 NW_003536507 c-X-C chemokine receptor type 7-like LOC100515346 __SEG__ Chr15 {Sus scrofa} MDLHVFDYSEPGNFSDISWPCNSSDCIVVDTLQCSGLPNKSVLLYTLAFVYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVVTIPVWVVSLVQHNQW
PMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSVAYFAHTSSRKKQAVRRAVCVLVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSVKEWLISMELVSVVLG
FAIPFSVIAVFYCLLARAVSSSSDPEKHSSRKIIFSYVVVFLVCWLPYHVVVLLDIFSILHYLPFSCQLENFLFTALHVTQCLSLVHCCVNPVLYSFIHRSYRYELMKAF
IFKYSAKTGLTKLIDASRASETEYSALEQTTK*
995 >lcl|XP_003133834.1|Plus1complement(130509..131456) NW_003301475 olfactory receptor 6B2-like LOC100521825 __SEG__ Chr15 {Sus scrofa} MRGENGTQVGAFVLLGFPTAPGLQRLLFLLFLLIYLLVLLENLAIILTVWRSLSLHRPMYCFLGCMSALELWYVSDIIPKMLGGFLLQRWRISFAGCMTQLYFFSALVCT
ECVLLASMAYDRYVAICHPLRYPAIMTAGLCARLVAFSFASGFSISVIKVYFISSATFCGSNVLNHFFCDISPILRLACTDFSTAELVDFVLAFVILVFPLAATALSYAH
IVLAVLRTPSATGRRRAFSTCASHLTVVVIFYVAMIFMYVRPQAIDSRSSNKLISAVYTVLTPIVNPLIYCLRNKEFKDALRKALGLGQSSLQHN*
996 >lcl|XP_003133835.1|Plus1complement(139209..140147) NW_003301475 olfactory receptor 6B3-like LOC100521996 __SEG__ Chr15 {Sus scrofa} MRGENGTQVGAFVLLGFPTAPGLQRLLFLLFLLIYLLVLLENLAIILTVWRSLSLHRPMYCFLGCMSALELWYVSDIIPKMLGGFLLQRWRISFAGCMTQLYFFSALMCT
ECVLLASMAYDRYVAICHPLRYPAIMTAGLCARLVAFSFASGFSVSVIKVYFISSATFCGSNVLNHFFCDISPILRLACTDFSTAELVDFVLAFVILVFPLSATALSYAH
IVLAVLRTPSATGRRRAFSTCASHLTVVVIFYVALIFMYVRPQAIDSRSSNKLISVFYTVLTPILNPLIYCLRNKEFKDAVRKALGFGQAPP*
997 >lcl|XP_003133836.1|Plus1complement(194130..195080) NW_003301475 olfactory receptor 12-like LOC100522169 __SEG__ Chr15 {Sus scrofa} MTPHANGTLSGKPLQEFVLEGFQGGLQTQALLFALFLALYLAAVLGNLTMIVVITLDARLHSPMYFFLKNLSFMDLCYSSVIYPKALANVLSSAKVISFGGCASQFFFFS
MRGTTEAFLLAVMAYDRFLAICSPLHYPITMCPSACARLVLGCYGGGCLNAILQTSFTFSLPFCSSNHIDHFFCDVPPLLLLACADTAISELVLFGICGLFIVGTTLGVL
ISYAYITVTILRMRSGAGRHKLFSTCGSHMTAVSLFYGTVFVMYAQPGAVESMEQGKVVSVFYTLVIPVLNPLIYSLRNKEVKEALRRLGQKSITS*
998 >lcl|XP_003133837.1|Plus1214048..214998 NW_003301475 olfactory receptor 12-like LOC100522524 __SEG__ Chr15 {Sus scrofa} MPPHGNGNLSGKPLQEFVLEGFQGGLQTQALLFALFLALYLAAVLGNLTMIVVITLDARLHSPMYFFLKNLSFLDLCYSSVIYPKALANVLSSAKVISFGGCASQFFLIS
LMITTEGFLLAVMAYDRFLAICSPLHYPITMCPMACARFMLGCYGGGCLNAILQTSFTFSLPFCSSNHIDHFFCDVPPLLLLACADTAINELVMFGICGLIIVGTTLGVL
ISYAYITVTILRMRSGAGRHKLFSTCGSHMTAVSLFYGTVFVMYAQPGAVESMEQGKVVSVFYTLVIPVLNPLIYSLQNKEVKEALWRLGHKLTAK*
999 >lcl|XP_003133839.1|Plus1292621..293571 NW_003301475 olfactory receptor 12-like LOC100523098 __SEG__ Chr15 {Sus scrofa} MSPHGSGNLSGMPLEEFVLEGFQGGLQTQALLFALFLALYLAAVLGNLTMIVVITLDARLHSPMYFFLKKLSFLDLCYSSVIYPKALGNFLSSAKVISFGGCATQFFFFS
MMGTTEAFLLAVMAYDRFLAICSPLHYPITMQPSVCACLVLGSYCGGCLNAILQTSFTFSLPFCSSNHIDHFFCDVVPLLKLTCANTAINELVMFSICGLIIVGTTLGVL
ISYAYITVTILRMRSGAGRHKLFSTCGSHMTAVSLFYGTVFVMYAQPGAVESLQQGKVVSVFYTLVIPVLNPLIYSLRNKEVKEALWRLGHKHTAP*
1000 >lcl|XP_003133843.2|Plus1446896..447846 NW_003301475 olfactory receptor 12-like LOC100524176 __SEG__ Chr15 {Sus scrofa} MTPHANGTLSGKPLQEFVLEGFQGGLQTQALLFALFLALYLAAVLGNLTMIVVITLDARLHSPMYFFLKNLSFLDLCYSSVIYPKALGNFLSSAKVISFGGCASQFFFFS
MMGTTEDFLLAVMAYDRFLAICSPLHYPITMCPSACAHLLLGCYGGGCLNAILQTSFTFSLPFCSSNHIDHFFSDVVPLLLLTCTDTAVNKLVLFGICGLFIVGTTLGVL
ISYAYITVTILRMRSGAGRHKLFSTCGSHMTAVSLFYGTVFVMYAQPGAVESMEQGKVVSVFYTLVIPVLNPLIYSLQNKEVKEALWRLGHKHTAK*
1001 >lcl|XP_003133945.1|Plus1complement(54736..55215) NW_003536542 glial cell line-derived neurotrophic factor GDNF __SEG__ Chr16 {Sus scrofa} MPEEYPDQFDDVMDFIQATIRRLKRSPDKQMALLPRRERHRQAAAASPESSRGKARRGQRGRNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETMYDKILKN
LSKNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI*
1002 >lcl|XP_003134043.1|Plus1complement(26292..28160) NW_003536558 leucine-rich repeat-containing protein 70-like LOC100525544 __SEG__ Chr16 {Sus scrofa} MCGVRFSLLCLRLFLLVACYLVLLFHKEILGCSSVCQLCTGRQINCRNLGLSSIPKKFPESTVFLYLTGNNISHINENELTGLHSLIALYLDNSSIVYVYPKAFVHLRHL
YFLYLNNNFIKRLDPGIFEGLSNLRNLYLQSNQISFVPRGVFHDLVSVQYLNLQRNRLTILGSGTFVGMVALRILDLSNNKILRISDSGFQHLENLNCLYLEGNNLTKVP
SNAFEILKSLKRLSLSHNHIEAIQPFAFKGLVNLEYLLLKNSGIKNVTRNGFNGINNLRYLILSHNDLENLNSDTFSLLKNLIYLKLDRNRIISIDNDTFENMGASLKIL
NLSFNNLTDLHPRVLKPLSSLTHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQSPPSMRGRALHYIKWTDFTNCVTSSTNASRAWAIKSLHIHHKTTALMMAWHRIT
TDGKHLENNESVTFWERIRTSPASRFFQENAFGNPLETTAVLPVQIQLTSPVNLNLEKNSALPVDAASVSGKTSLICTQEVEKLNEAFDILLAFFILACVLIVFLIYKVV
QFKQKLKAPENSGDNRLEYYSFYQSARYNVTASFCSTSPNSLEGPGLEQIRLHKQIVPESEAQVILFEHSAL*
1003 >lcl|XP_003134046.1|Plus1complement(1134763..1136031) NW_003536559 5-hydroxytryptamine receptor 1A-like LOC100526081 __SEG__ Chr16 {Sus scrofa} MDVLSPDQGNNTTSSQGPFGARGNATGSSDVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCD
LFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR
AARFRIRKTVKKVEKKRGNNPLGASPAPQPPKSVNGEPGIRDWKQGMENKAAAAPCANGAVRQGEEGAALEVIEVHRVGNSKEHLPLPNEASAVSCVPTSFKKKNERNAE
AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCRR*
1004 >lcl|XP_003134149.2|Plus1complement(1265298..1266299) NW_003536579 alpha-1B adrenergic receptor ADRA1B __SEG__ Chr16 {Sus scrofa} MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSAALEVLGY
WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVIL
VMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGKLEPWRKGIGHFQ
ILG*
1005 >lcl|XP_003134554.1|Plus1complement(5417255..5418154) NW_003536672 protein phosphatase 1 regulatory subunit 3D-like LOC100521997 __SEG__ Chr17 {Sus scrofa} MSGDPGSAVPPAAPAFRKPAPRSLSCLSDLYGGAAPEPRPCRPPGSPGRAPPPPTPPSGCDPRLRPIILRRARSLPSSPERRQKGAGAPGAACRPGCSRQHRVRFADALG
LELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFPPPVEAPDFGERLGRQLVCLERVTCSDLGISGTVRVRNVAFEKQVAVRYTFSDWQSAHEAG
ARWRGPAGAEGAEDVFAFGFPVPPFLLALGSRVHFALRYRVAGAEYWDNNDGRDYSLTCRNHALHMPRGECEESWIHFI*
1006 >lcl|XP_003134612.1|Plus1complement(94903..95856) NW_003536687 olfactory receptor-like protein OLF3-like LOC100519633 __SEG__ Chr18 {Sus scrofa} MGRNNQTWVREFILLGLSSDWDTQLSLFVLFLVMYLVTVLGNLLIVLLIRLDSRLHTPMYFFLTNLSLVDVSYATNIVPQMLVHLLAKHKRIPFVSCAAQLFFSLGLGGT
EFVLLAVMAYDRYVAVCNPLRYPVIMHGGFCTRLAVTSWLSGSGNSLMQTAITFQLPMCTNKYIDHISCEILAVIRLACVDTSSNEVAITVSSIVLLMTPFCLVLMSYIQ
IVSTILQVRSAEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSILQEKLISVFYAILMPVLNPMIYSLRNKDVKGAWQKLLGQLSGLTSKLAT*
1007 >lcl|XP_003134635.1|Plus1complement(19514..20470) NW_003536687 olfactory receptor-like protein OLF3-like LOC100523829 __SEG__ Chr18 {Sus scrofa} MGTENQTWEKEFILLGLSSDWDTQVSLFVLFLVMYLVTVLGNLLIVLLIRLDSRLHTPMYFFLTNLSLVDVSYATNIVPQMLVHLLAKHKRIPFVSCAAQLFFSLGLGGT
EFVLLAVMAYDRYVAVCNPLRYPVIMHGGFCTRLAVTSWLSGSGNSLMQTAITFQVPTCTNKCIDHISCELLAVVRLACVDTSSNKVAITVSSIVLLMTPFCLVLVSYIQ
IVSTILQVRSAEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQEKLISVFYAILMPVLNPMIYSLRNKDVKGAWQKLLGQLSGLTSKLATR*
1008 >lcl|XP_003134818.1|Plus1complement(3168639..3170765) NW_003301717 leucine-rich repeat neuronal protein 3-like LOC100520161 __SEG__ Chr18 {Sus scrofa} MKDLPLQIHVLLGLAITTLVQAVDKKADCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGLLNFPARLPADTQILLLQTNNIAKIESSIDFPVNLTGLDLSQNNLSSVTNI
NIKKMPQLLSVYLEENKLTELPEKCLSGLSNLQELYINHNLLSTISPGAFIGLDNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIA
GINLTEIPDNALVGLENLESISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLAVDNLPDLRKIEATNNPRLSYIHPNAF
FRLPKLESLMLNSNALSALYHGTVESLPNLKEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFREMMEICLPLIAPESFPSNLDLEAGSYV
SLHCRATAEPQPEIYWVTPSGKKLLPNTLTDKFYVHSEGTLDITGITPTEGGLYTCIATNLVGADLKSIMIKVDGSFPRDNNGSLNIKIKDVQAHSVLVSWKASSKILKS
SVKWTAFVKTENARAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQKSRKQCVNVTTKSLDPDQKGYEKSNTTTFMACLGGFLGIIGVICLFSCLSQEMNCDGGHS
YVRNYLQKPTFAFGELYPPLINLWETGKEKGTGLEVKATVIGVPTHMS*
1009 >lcl|XP_003134827.1|Plus1complement(106293..107204) NW_003536714 probable G-protein coupled receptor 141-like LOC100521938 __SEG__ Chr18 {Sus scrofa} MAGHNTSSCDDAILTPHLTRLYFVVLIGGLMGIISILFLLVKMNTRSVTTTAVINLVVVHSVFLLTVPFRLTYLIKHTWIFGLPFCKFVSAMLHIHMYLTFLFYVVILVI
RYLIFFKHKDKVEFYRKLHAVAASTALWILVITIVVPLVASQYGIREGYDKHDCFKFHKELAHVYAQVINYIIVIIVIVIAVVLLVFQSIIIVSMVRKLRHSLLSHQEFW
AQLKNLFFIVVILICFLPYQFFRIYYLYTVAHSSHCNNNVAFYNEILLSVTAISCFDLLLFVLGGSRWFKQKITDLWNRLLCR*
1010 >lcl|XP_003134869.2|Plus193163..95592 NW_003536722 TLR4 interactor with leucine rich repeats-like LOC100515456 __SEG__ Chr18 {Sus scrofa} MEAARAVRFLLVVCGCLALPPRAQTVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQDVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRFLHPKTFEKLSRLE
ELYLGNNLLQTLAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLSNLLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLR
HAATFAPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALRELRLEGNRLSQLPVALLEPLHSLEALDLSGNELSALHPTVFGHLGRLREL
SLRDNALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCADPSPSVPPTADGKQLPLPTAQEEEV
APPPGALAQEPPQPQPQQRGRFLPGVAWDGAARELLGNRSALRLSRRGPGLQQPGFNAAAAAGPAPHPQDLLEKPERGRPTASDPAHAEPTQTAAAGSAPAGDPWQRAAK
QRLAAPQLETAAQSDGGVGLPPLVSDPCDFNKFILCNLTVEAVGADSASVRWAVREHRSPRPLGGARFRLLFDRFGQQPKFHRFVYLPERSDSATLRELRGDTPYLVCVE
GVLGGRVCPVAPRDHCAGLVTLPESGSRSSVDYQLLTLALLAVNALLVLLALAAWASRWLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTTVC
ALSEADLIEFPCDRFMDSGGGGAGGSLRREDHLLQRFAD*
1011 >lcl|XP_003135078.2|Plus1815249..816394 NW_003301784 LOW QUALITY PROTEIN: probable G-protein coupled receptor 34-like LOC100516349 __SEG__ ChrX {Sus scrofa} MRSHTVTMTTASVSSWPCSSQGVHLLTNHSVQSPHNFSGAPNFTACSMDETLLSSVLTTFYSVIFIMGLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFR
IMYHINQNKWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCAVWIIALAGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFN
FILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTVCFVPYHAFRFVYISAQLNVSSCYWKEIVHKTNEIMLVFSSFNSCLDPVMYFLM
SSNIRKIMCQLLSKRFQGEASRSESTSEFKPGYSLHDTSAAAKIQPTS*ST*
1012 >lcl|XP_003135079.1|Plus1835141..836151 NW_003301784 probable G-protein coupled receptor 82-like LOC100158124 __SEG__ ChrX {Sus scrofa} MSNNSTCIQPSMISSMALPITYIFLCIIGLFGNSLSQWIFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYQSAQCRVVNFLGTLSMHVSMFVSLLIL
SWIAISRYATLMKKDSTQETTSCYEKIFYGHLLKKFRQPNFARKLCVYIWVVVLGIIIPVILYYSVVEATEGEEKVCYNRQMELGAMLSQIAGLIGTTFIGFSFLVVLTS
YYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQILLVVCFLPYSIFKPIFFVLHQGKDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKIVYNLFTKPDSP
HIQTSG*
1013 >lcl|XP_003135081.1|Plus1complement(160194..160802) NW_003536774 protein phosphatase inhibitor 2-like LOC100517069 __SEG__ ChrX {Sus scrofa} MAAPTASHGPIKGILKNKGSTASSVAASVQQAGGAVAEVQRKKSQKWDEKNILATYRPEYRDYDFMKTNEPSTPQLGLLEDPEDAACDSATKETLTLDNLAKKLAATDTS
ELSYHLGEPEREGAHTSKIFLDKQEKHRQFEMKRKLHYNEGLNIKLARQLISRDLEREEEEDENKESRHVTSQDKTTLGELEEGPASDELQT*
1014 >lcl|XP_003135147.1|Plus11895916..1896410 NW_003536783 diphosphoinositol polyphosphate phosphohydrolase 3-beta-like LOC100515984 __SEG__ ChrX {Sus scrofa} MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDS
VSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSSTNGNSVAPSLPESAP*
1015 >lcl|XP_003135202.2|Plus1complement(900092..901189) NW_003536796 p2Y purinoceptor 4 P2RY4 __SEG__ ChrX {Sus scrofa} MTSTESSLFTTLGPHSDPEDSEVEPDCRFNEEFKFILLPVSYAVVFVLGLGLNGPTIWLFLFRLRPWDATAIYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGLCKF
IRFLFYWNLYCSVLFLTCISVHRYLGICHPLRALRWGRPRIASLLCLAVWLVVAGCLVPNLFFVTTSTKGDTILCHDTTRPEEFDHYVHFSSAVMGLLFGVPCVVTLVCY
GLMARRLYQPLPGAAQSSTRVRSLRTIAVVLTVFAICFVPFHITRTVYYLARLLEADCWVLNIVNVVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGRGGPRPPT
AASSLALVSLPEDSSCRWTAASQDGRCPTPRADRL*
1016 >lcl|XP_003135205.2|Plus1708271..709140 NW_003536796 OTU domain-containing protein 6A-like LOC100517870 __SEG__ ChrX {Sus scrofa} MEDSQSEHQRMIRRHNREKKELQARIQSMKNSVPRSDKKRRKQMLLDVARLEAEMEQKHQQELEKFQESFPGNLDSVTEDLAKMDLENQPPRPSRAQRRRERRAALARER
QERIAEAEMEHLASFRKDEEEKLRAILGAKNLEMKDIPADGHCMYRAIQDQLVFSVTVESLRRRTAEYMQKHVDDFLPFFSDPETGDSYSRDDFLSYCDDIVRSASWGGQ
LELRALSHILQTPIEVIQANSPAVVIGEEYTKRPLILVYMRYACSLGEHYNSVKPLEAGAVGGAPPRLF*
1017 >lcl|XP_003135257.1|Plus1305882..306883 NW_003536804 probable G-protein coupled receptor 174-like LOC100154876 __SEG__ ChrX {Sus scrofa} MSANDTCPGTDGANTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGSGLCMFCFYLKYVNMYASIYFLV
CISVRRFWFLLYPFRFHDCKQKYDLYISIVGWLIICLACLLFPLLRSSDDTPGNKTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPVAQ
DLGEKKKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVIIIFHSVALCLASLNSCLDPVIYYFTTNEFRRRLSRQDLHDNIKLHAKSFVSNHITSTLRN
EVC*
1018 >lcl|XP_003135299.1|Plus150594..51733 NW_003536829 armadillo repeat-containing X-linked protein 3 isoform 1 ARMCX3 __SEG__ ChrX {Sus scrofa} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDVGDCPGARYNDWSDDDDDNSENKGIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTITSRLNSSV
QLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKFQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENIIDNFKWEEDEPTQNQFSE
GSLFFFLKEFQVCADKILGIESHQDFLVKVKVGKFMAKLAEHMFPKSQE*
1019 >lcl|XP_003135373.1|Plus1complement(123915..125003) NW_001886674 type-2 angiotensin II receptor AGTR2 __SEG__ ChrX {Sus scrofa} MKDNFTLVTISKNITSSLHVGLVNISGNESTFNCSHKPSDKHLDAIPILYYIIFVVGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWL
FGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFI
IPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLNMAAAVVLAFIICWLPFHVLTFLDALAWMGIINSCEVIAVIDLALPFAILLGFTNSCINPFLYCFVGNRFQQKLRR
VFRVPITWLQGKRESVSCRKSSSLREMETFVS*
1020 >lcl|XP_003135382.2|Plus1complement(1684988..1687006) NW_003536841 transcriptional regulator Kaiso isoform 1 ZBTB33 __SEG__ ChrX {Sus scrofa} MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTPQDGNAETLPPGSSDKNLEIQKSKDEAQDNGATIMPIITESFSLSAEDYETKKIIVTDSDDDDDDVIFCSEILPAKETLPSNNAVAQAQPN
PGSVAISDVAPCASSSSPPLTSITPPQKLPTSVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLTNPPNVSSSLPNHMSPSINLLVPNQQPPNNAVLTGNKANEEE
EEEIIDDDDDTISSSPDSAVSNTSLVPQAEIPQNTTFDGSLIQKMQVPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLTEGQKIITLDTATEIEGLSTGCKVYANIGED
TYDIVIPVKDDPDEGEARLENEIPKTSSSETANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSGTMPVMKDDGIGYKVDAGKEPPVGTTSAPQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY*
1021 >lcl|XP_003135421.1|Plus1complement(924079..925086) NW_003536848 glucose-dependent insulinotropic receptor-like LOC100524541 __SEG__ ChrX {Sus scrofa} MESSSLFGVILAVLASLIIAANALVAMAVLSLIHKNDGIGLCFTLNLAVADTFLGLAISGLVSDQLSSPARPTEKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQP
LRYFQMMNGLVAGACIAGLWLVSYLIGFLPLGIHVFQQTTYKGPCSFFAVFHPRFVLTVSCVGFFPALLLFVFFYCDMLKIASTHNQQIRKTEHTGATAGAHRPPRTPSD
FKAVRTVAILIGSFTLSWTPFFITSIVQVVCQECNLYLVLERYLWLLGVGNSLLNPLIYAYRQKEVRQQFSQMALGMKKGLAAFLLLLSARNGGPERPRESSCHITTISQ
SELDG*
1022 >lcl|XP_003135430.2|Plus1complement(439109..440011) NW_003536850 olfactory receptor 10A5-like LOC100511236 __SEG__ ChrX {Sus scrofa} MTQISEFILLGFGDLHGLQYLLFGIFLTTYVVTLMGNIIILTVVLADHSLHTPMYFFLGHFSFLEIGYTTTIEPMMLRTLLSAHVPISFPDCANQFYFFAALVATECFLL
AVMSYDRFIAICNPLYYSRIMDHWRCFQLAGACWVAGFLAPILLMVLIFQLTFCAANEIDHFFCDLKPIMKLACTDTQVAEMTSFICTSLFALGPFLLTLASYTHIISTI
LKIPSIKGKQRAFSTCSSHLTVVGLYYGTLGIVYGFPSGHQSEYLLKLLSLLYTVLTPALNPIIYTLRNRDVKVALRKLV*
1023 >lcl|XP_003135432.1|Plus1312026..312949 NW_003536850 olfactory receptor 11A1-like LOC100511798 __SEG__ ChrX {Sus scrofa} MPGNTTLTVTEFIMLGFGDLKELSPLLFLVFGIVYLATISANLLLVVLVSTQRGIQTPMYFFLANLSCLEICYTSNIMPRLLVDLLRENRVISMAGCIVQLYFFGALGST
ECYLLAVMSYDRYLAVCQPLRYPTLMHGTICLGLAIGSWVSGFTVAASFQAAMVSSLTFCGSNEIDHFFCDLNPLQKLSCSDPQLVNLVCMSLTALVTLPPFGLTLASYG
KIISTVLYIPSVTGRQKAFSTCSSHLVVVTLFYGTLILVYALPLAGQLPLLNKTFSLLYTVVTPMCNPLIYSLKNKDVKEALRKLRV*
1024 >lcl|XP_003135439.2|Plus1complement(522433..523404) NW_003536850 olfactory receptor 5B21-like LOC100513516 __SEG__ ChrX {Sus scrofa} MSKELLTTKNNTQLVFMENSSIVTNFLLLGMTANPQLGVLLFGVFFLVYIMTLWGNLGLVVLIRASPCLHTPMYFFLSNLSFLDVCFSSITIPKTLANLLYKVQAVSFLG
CMTQMGLFIIFASAECNLLASMAYDRYMAICHPLLYHTTMARVRCLLLVTGSYLGGLVNMVSVTSSITQLSFCQPYVLPHFFCDIPPLLALACSDPWVTQIVVVSCGGFT
LIISIMVILVSYLSVLMTILRIPSVSGKQKAFSTCASHLTAVGLYYGTTMYTYLQPSQRGSQAGNQVVSVFYTMVIPLLNPLIYSLRNQEVKVALWKILKQSL*
1025 >lcl|XP_003135442.1|Plus1612206..613144 NW_003536850 olfactory receptor 13H1-like LOC100514087 __SEG__ ChrX {Sus scrofa} MDIPVIDNASEVTEFVLVGLSNHPKAQAAFYCTMVAVYLVTLVGNGLIIVMVRVEKQLHTPMYFFLSNLSFLDICYSSNSVPFLLFNGLKDYPTISYTGCYAQMTIALSL
GMTECLLLAVMAYDRFIAISNPLRYSIIMNHQVCVQLAVVTWASAFLLAIIPIIAIPARFCGHNIINHFTCEVQALLKLICSDTPVRLILGLVISIFTLPLPFTFILISY
FCIVVAVLRIRSAEARLKAFSTCGSHLTVVTIFYGTAIYMYLKPQSREYQDQGKVVSAFYGVVTPMLNPVIYTLRNKDVKEALRKRIRKKKS*
1026 >lcl|XP_003135443.1|Plus1657901..658842 NW_003536850 olfactory receptor 13H1-like LOC100514444 __SEG__ ChrX {Sus scrofa} MGSHKQDNASEVTEFILVGFSQQPQIQTAFFMGLLFFYLVTMFGNSLIVVVVRWDSRLHTPMYFFLSNLSFLDICYSTSWEPYVLAQCFKDFPTISYSSCYAQMTTSLFL
GMTECLLLAIMAYDRFVAISNPLRYTIIMNNRVCIQLALGTWASAFLVAVTPIIAIPAHYCGHNIINHFTCEIQALLKLVCSDTPISLILGLVISVFTLPLPFTFILISY
FCIVVTVLKIRSVEARLKAFSTCGSHLTVVTIFYGTAIYMYLKPQSKEYQEEDKVMSIFYGAVTPMLNPLIYTLRNKDVKGALRKLAKGNEKS*
1027 >lcl|XP_003135482.1|Plus1complement(1626237..1628753) NW_003536860 SLIT and NTRK-like protein 4-like LOC100525800 __SEG__ ChrX {Sus scrofa} MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENSYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKGLSTRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPFNAKKLHVNGNSIKDVDISDFAEFEGLDLLHLGSNQIAAIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELRCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPIPAVTFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLANPE
CGSMQLQLRKHEHKSNKKDGLATEAFIPQTIEQMSKSHTCGLKESETGFMFADPPGQKVMMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI*
1028 >lcl|XP_003135487.1|Plus168008..70557 NW_003536862 SLIT and NTRK-like protein 2 SLITRK2 __SEG__ ChrX {Sus scrofa} MLSGVWFLSVFTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSSSGSGGDSGQRGSHADTHVQRQSPTLNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGP
IMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLE
VLYPAMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEH
ANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTILSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRS
ANNLDVSSFQLQYGSYNTETQDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYSNLEEKKEEPATLAYTISATELLEKQATPREPELLYQNIAERVKEL
PSAGLVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
1029 >lcl|XP_003135547.2|Plus1complement(119257..120192) NW_003301854 olfactory receptor 6C2-like LOC100511490 __SEG__ ChrX {Sus scrofa} MRNHTITTFILLGLTDDPRIKVLIFIFLFFTYMLSAAGNLTIISLTFIDCRLRTAMYFFLQNFSFLEISFTTACIPRFLYNIATGDKIITYAACAAQIFFTYLFGITEFF
LLATMSFDRYVAICKPLHYVTIMNNRVCNRLIISCWMAGLCIIIPPLSLGLNLEFCDSNVIDHFFCDATPLLKISCSDTQFIERMILVCAVLTFIMTLVCVVLSYIYIIM
TILRFSSSQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKKEVALNKGVSLLISSISPTLNPFIYTLRNEQVKKALNDLIKRITFFFKK*
1030 >lcl|XP_003135548.2|Plus1complement(126570..127508) NW_003301854 olfactory receptor 6C2-like LOC100511675 __SEG__ ChrX {Sus scrofa} MRNHTRLMTFILLGLTDDPQLQALIFIFLLVTYMLSATGNLTIISLTLVNSQLKSAMYFFLQNFSFLETSFTTVCIPRFLYSMSTGDKTITYNACASQLFFVIFFGSTEF
FLLAVMSYDRYVAICKPLHYVTIMNSRVCRRFVLSCWAGGLFIIIPPLSLGLNLEFCDSNIIDHFLCDASPTLKISCSDTWFIDQMVIACAVMTFIMTLVCVVLSYVYII
KTILKFPSAQQREKAFSTCSSHMLVVSITYGSCIFIYIKPSAKEKVDINKGVSVLTTSVAPMLNPFIYTLRNKQVKQAFSYSIKRMAFFSKK*
1031 >lcl|XP_003135549.2|Plus1complement(3329..4267) NW_003301854 olfactory receptor 6C2-like LOC100512033 __SEG__ ChrX {Sus scrofa} MRNHTVITTFILLGLTEDPKLQVLLCAFLLLTYMLSVAGNLIIITLTLSDPHLKTPMYFFLRNFSFLEVSFTTVCIPRFLYTMTTGDNTVSYNACATQLFFVVLFGATEF
FLLAAMSYDRYVAICKPLHYTTIMNNRVCTTLVLCCWFAGLLIILPPLGVGLQLEFCDSNEIDHFGCDTSPVLQITCSDTVLIERIVLSFAVLTLLITLVCVVLSYTCII
KTILRFPAAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEGVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKDAFKGTVKRMVFLTKK*
1032 >lcl|XP_003135550.1|Plus121288..22226 NW_003301854 olfactory receptor 6C2-like LOC100512207 __SEG__ ChrX {Sus scrofa} MRNHTSLTRFILLGLTDDPHMQILIFLFLLLTYMLSLTGNLIILLLILVDSHLKTAMYFFLQNFSFLEISFTSACIPRFLYSISTGDRAITYNACACQLFFTYMFAVTEF
FLLAAMSFDRYVAICKPLHYVTIMNHRVCRRIVFCCWMATLLIISPPFSFGLALEFCDSNVIDHFVCDVNPLLKIACSETRFIEQMTLAGSVLIFILTLVCVVLSYVYII
RTILGFPSAQQRTKAFSTCSSHIIVVSITYGSCIFVYIKPSAKDEMTINKGVTILTTSISPMLNPFIYTLRNKQVKQAFNDLVQRIISLSKN*
1033 >lcl|XP_003135551.1|Plus1complement(59365..60300) NW_003301854 olfactory receptor 6C2-like LOC100512580 __SEG__ ChrX {Sus scrofa} MRNHTVTTFILLGLTDEPQLKTLVFIFLFLTYMLSVTGNLTIISLTSTDSHLKTAMYFFLQNFSFLEIAFTSACIPKYLYNISTGDKTITYNSCATQLFFTDLFAVTEFF
LLAAMSYDRYVAICKPLHYVTIVNHTVCRRLIFGSWLAGLLIIIPPLSLGLKLEFCDSNVIDHFVCDAAPLLKISCSETWLIEQMVIVCAVLTFIMTLVCVVLSYVHILK
TILQFPSAQQRKKAFSTCSSHMIVVSISYGSCIFIYVKPSAKKSLAVNKGVTILTTSIAPMLNPFIYTLRNKQVKQAFNDAIKRIALFSKN*
1034 >lcl|XP_003135552.2|Plus1complement(101361..102296) NW_003301854 olfactory receptor 6C2-like LOC100512943 __SEG__ ChrX {Sus scrofa} MRNHTVTTFILLGLTDEPQLKTLVFIFLFLTYMLSVTGNLTIISLTSTDSHLKTAMYFFLQNFSFLEIAFTSACIPKYLYNISTGDKTITYNSCATQLFFTDLFAVTEFF
LLAAMSYDRYVAICKPLHYVTIVNHTVCRRLIIGSWLAGLLIIIPPFSLGLKLEFCDSNVIDYFFCDLAPLLKISCSETWLIEETVTVCAVLAFIMTLVCVVLSYVYILK
TILQFSSAQQRKKAFSTCSSHMIVVSISYGSCIFIYVKPSPKDSLAVNKGVTLLTTSIAPMLSPFIYTLRNKQVKQAFNDAIKRTALFKKD*
1035 >lcl|XP_003135558.1|Plus1complement(15887..16753) NW_003301855 protein sprouty homolog 3-like LOC100515521 __SEG__ ChrX {Sus scrofa} MDAAVADDCQQILPIEQLRSTHASNDYVDRPPVPCKQALSSPSLIVHTHKSDWSLATMPTALPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQ
SIIRTQPGTGAHPKADGALKGEAEPSAEHPSEHLFICEECGRCKCVLCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPGSCFV
RWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV*
1036 >lcl|XP_003353229.1|Plus1complement(39822..40112) NW_003533901 a-kinase anchor protein 12-like LOC100623325 __SEG__ Chr1 {Sus scrofa} MGAGSSTEQRSPEQPEAGSATPAEPEPSGSGSAAEAAPGTPGDPGIAAADPATKVGRAGPPAPGEAGARGVSRSPPVRTSSPMQPICKLGSRNASF*
1037 >lcl|XP_003353305.1|Plus11000733..1001830 NW_003533942 5-hydroxytryptamine receptor 1E-like LOC100518812 __SEG__ Chr1 {Sus scrofa} MNITNCTTEASVAVRPKTITEKMLISMALVIITTLTMLLNLAVIMAICTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWRLGYFICEVWLSVDMTCCTCSI
LHLCVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQCAIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSR
HLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKIHTSIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLT
WLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHI*
1038 >lcl|XP_003353313.1|Plus1complement(223632..224891) NW_003533944 probable G-protein coupled receptor 63 GPR63 __SEG__ Chr1 {Sus scrofa} MVFSAVLTASHSGASNTTFVVYENTYMNITVPPPFQHPGIGPLLRYSFETMAPTGMSSLTVNSTAVPPTPAVFKSLNLPLQIILSALMIFILFVSFLGNLVVCLMVYQKA
AMRSAINILLASLAFADMLLAVLNMPFALVTILTTRWIFGRFFCRVSAMFFWMFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKVLIAVSWVFSFCVAFPLAVGNPDL
QIPSRAPQCVFGYTTDPGYQAYVILISLISFFLPFLVILYSFMGILNTLRHNALRIHSYPEGICLSQASKLGLMSLQRPFQMSIDMGFKTRAFTTILILFAVFIVCWAPF
TTYSLVATFSKHFYYQHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKFLPRLPGHTRRRIRPSAVYVCGEHRTVV*
1039 >lcl|XP_003353508.1|Plus11551871..1552740 NW_003534056 mothers against decapentaplegic homolog 6-like LOC100622927 __SEG__ Chr1 {Sus scrofa} MFRSKRSGLVRRLWRSRVVPDREEGGGSGGGGDEDGSKGSRSDPAPRPREGGGCSRPEVRPVALRRPRDAVGQRGPQGAGRRRRAGGPPRPMSEPGAGAGGSPLDVSEPG
GRGWLPESDCETVTCCLFTERDAAGAPRDAGDPLAGAALEAAGSGRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAP
PQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPGERAAPGRPSGFPSRPLP*
1040 >lcl|XP_003353537.1|Plus11513269..1514153 NW_003534075 prostaglandin E2 receptor EP2 subtype isoform 2 LOC100127164 __SEG__ Chr1 {Sus scrofa} MGNTSSESRRRESCDTREWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDLGRGAGHGNSISLFHVLVTELVFTDLLGTCFISPVVLASYARNQTLVALAPQRRVC
TYFAFSMTFFSLATMLMLFAMALERYLAIGHPYFYQRWITHRGGLAVLPAIYTVSLLFCSLPLLDHQDYVQYCPGTWCFIGHEQSTYLRLYATLLLLLIIAVLACNFSVI
LNLIRMHRRGRNSRCGPSLGSSRAGPGSRRRGERVSVAEEMDHLILLAIMTITFAVCSLPFTVSHSLHFHSSPL*
1041 >lcl|XP_003353600.1|Plus1complement(67698..68033) NW_003534127 hypothetical protein LOC100623673 LOC100623673 __SEG__ Chr1 {Sus scrofa} MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGEYCLGWPPRALPPGLCAPCPPPSGPRDRGPRPRAPAARSGPPRARPRTLPALARARTRPRARAE
G*
1042 >lcl|XP_003353622.1|Plus1complement(626835..627773) NW_003534138 olfactory receptor 13J1-like LOC100622359 __SEG__ Chr1 {Sus scrofa} MELANWTKVSAFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNAAIVAVSVLDAHLHTPMYFFLGNLSILDICFTSSFVPLMLVHLLSVQKTISFIGCAIQMCLSLSTGST
ECVLLAVMAYDRYLAICQPLRYPVLMSHRLCLLLAGAAWVLCLLKSVAETVIAMRLPFCGHHVVSHFSCEILAVLKLACSDTSVNEGFLLVGAILLLPLPLAFICLSYTL
ILATVLRVPSAAGRRKAFSTCSAHLAVVLLFYGTVIFIYMKPKSKEARVSDEVFTVLYAVVTPMLNPIIYSLRNKEVKEAARKVWGRTWTSW*
1043 >lcl|XP_003353624.1|Plus1complement(847313..848269) NW_003534138 putative olfactory receptor ENSP00000348552-like LOC100622874 __SEG__ Chr1 {Sus scrofa} MQVVNQSIVTGFVLLGLSDQPKLEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFLDICYTTSSVPLILDGFLTPRKTISFSGCAIQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPMVMSKATYVPMAASSWLAGGANSLVQISLAVQLPFCGDNVINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIF
ILTTILKIPSAEGRKKAFSTCSAHLTVVILFYGTILFMYAKPKSKDPLGADKQDVSDKLISLLYGVLTPMLNPLIYSLRNKDVKVAVKNLKSQKCYPH*
1044 >lcl|XP_003353688.1|Plus128162..29103 NW_003534165 olfactory receptor 1J4-like LOC100621863 __SEG__ Chr1 {Sus scrofa} MRRENQSSMSEFLLLGLPTQPEKQGILFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALSDISFSSVTIPKMLKNMQTQDQSIPYAGCITQTYFFMFFGCI
DNLLLAVMAYDRYVAICHPLHYAIIMREELCLCLLAGSWLFSCAAALTHTLLLAQLSFCADNIIPHFFCDLAALVKLSCSDTSLNELLIFTLGPAVVIFPLSGILVSYGH
IGLSILKVPSMKGICKALSTCGSHLSVVSLFYGTMMAVYFSSSSGQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGLVFRKSNILAK*
1045 >lcl|XP_003353689.1|Plus1252758..253699 NW_001886053 olfactory receptor 1J4-like LOC100623988 __SEG__ Chr1 {Sus scrofa} MRRENQSHVSELLLLGLPIQPEQQGVFFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTIPKMLKNMQTKKLSISYPGCISQVYFYILFGCV
DNLLLAVMAYDRYVAICHPLHYTSIMREGLCALLVTGCWIISCSSGLLHTLLLAQRSFCADNIIPHFFCSLPNLLKLSCSDTSLNELVIYTVGAAVVIFPLSGILISYGR
IGVSILRVPSTKGICKALSTCGSHLSVVSLFYGTVMAVYFSSSSDQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGLLFRNSNILAK*
1046 >lcl|XP_003353690.1|Plus1271707..272645 NW_001886053 olfactory receptor 1J4-like LOC100624074 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPVPPEQKHVFFALFLGMYLTTMLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDQSIPYAGCVTQTYFFLIFTGL
DDFLLTSMAYDRYVAICHPLRYTSIMRGGLCTILVTVSWILSCANALCHTLLLAQLSFCSENTIPNFFCDLGALLKLSCSDTSLNDLVIFIAGVATIMLPLLCILVSYGH
IGATILKVPSTKGICKALSTCGSHLSVVLLYYGTIIGLYLVPSSSTSSNKDIVASVMYTVVTPLLNPFIYSLRNRDMKGALEKLFHKAPVLS*
1047 >lcl|XP_003353691.1|Plus1complement(375858..376799) NW_001886053 olfactory receptor 1J4-like LOC100625677 __SEG__ Chr1 {Sus scrofa} MKRENQSSMSNFQLLGLPIVPEQQGLYFALFLGMYLTTVLGNLLIILLIRLDPHLHTPMYFFLSHLALTDVSFSSVTVPKMLMDMQTQDQSIPYAGCLTQTYFFIFFGCT
DNFLLVVMAYDRYVAICHPLHYTIIMREELCLCLLAGSWLLSCAYALTHTLLLAQLSFCADNIIPHFFCDLDALLKLSCSDTSLSELVIFTAGSAVVIFPLSGILVSCGR
IGFSLLRVPSTKRLCKAWSTCGSHLSVVSMFYGTMIALYLSSSSGQSHDKDIIASVMYTVVTPMLNPFIYSLRNRDMTLALGILFRNIHIFVK*
1048 >lcl|XP_003353692.1|Plus1complement(7403..8398) NW_003299422 olfactory receptor 1J2 LOC396792 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSKFLLLGLPIQPEHQGMFFALFLCMYLTTVLGNLLIIILIRLDPRLHTPMYFFLSHLALTDISFSSVTVPKMLMNMQTQDKSIPYAGCVTQTYFFLHFACI
DNLLLAVMAYDRYVAVCHPLHYAIFMRERLCIFLLAGSWLLSGASALTHTLLLVQLSFCADNIILHFFCDLVPLLKLSCSDTSLNELVIFTVGSVGLVFPLSGILVSYGR
IGLSILRVPSTKGVCKALSTCGSHLSVVSLFYGTIMAVYFSSSSGQSHEKDIIASMMYTVVTPMLNPFIYSLRNRDMKQALGILFRKRIFFPSENHLTMFLFNSIPLLKK
P*
1049 >lcl|XP_003353693.1|Plus184678..85616 NW_003534166 olfactory receptor 1J4-like LOC100621623 __SEG__ Chr1 {Sus scrofa} MRRENQSSMSEFLLLGLPIQPEHQGMFFALFLGMYLTTVLGNLLIILLIRLDPRLHTPMYFFLSHLAFTDVSFSSVTVPKMLMYMRTHDQSIPYAGCISQMYFFLLFGCL
DNFLLAVMAYDRYVAICQPLHYTTVMRQELCVSLVAASWVLCSILALLHTLLLAQLSFCAANTIPHFFCDLTSLLKLSCSDTSINELVIFIVGGTIFILPLSSILGSYVH
IGTAVMSVSFTKSLFKVFSTCGSHLFVVSIYYGTIASVYFFSSSWESNDKDVIASFVYAVVTPMLNPFIYSLRNRDIKQAFEIFVNRANFLK*
1050 >lcl|XP_003353694.1|Plus1complement(93897..94841) NW_003534166 olfactory receptor 1L8-like LOC100621729 __SEG__ Chr1 {Sus scrofa} MERVNQTSSVSEFILLGLSSQPEDQKPLFSLFLTIYLVTITGNLLIILAICSDPQLQTPMYFFLAFLSFTDICFTTTIVPRMLVNFLSHKTISYAECLTQMYFIYALGNT
DSCLLAVMAFDRYVAICDPFHYVTIMSHHRCVLMVALSCSLPHLHSLLHTLLLNQLTFCDSNIIHHFLCDISPLMKLSCSSTFVNETVMMIEGPILLVTPFLCITFSYIQ
ILTVVLKIPSAAGKHKAFSTCGSHVTVVTLFYGSIFYVYLQPVSSYTVRDHMATIVYTVLTSTLNPFIYSLRNKDLKQGLRKLVVRSKFQATSP*
1051 >lcl|XP_003353697.1|Plus1complement(22974..23915) NW_003299423 olfactory receptor 1J4-like LOC100622108 __SEG__ Chr1 {Sus scrofa} MRRENQSSVSEFLLLGLPIQPEQQAVFFALFLGMYLTTVLGNLLTILLIRLDPRLHTPMYFFLSHLAFSDVSFSCVTLPKMLLNMQTQQQSISYVGCITQMYFFLLFICL
DNFLLAVMAYDRYVAICQPLHYRTIMRDGFCVLLVVGSWFFSCVHALLHTLLLSRLSFCADNAIPHFFCDFTAVLKMTCSDTSINELVIFIEGGLLTSLPLSAILGSYVR
IGASILRVPSMKRICKALSTCGSHLFVVFLYYGTIAMTYFFPSSYNSKVKGIIASVIYTVVAPMLNPFIYSLRNRDMKLALGILYRRAIIFAK*
1052 >lcl|XP_003353698.1|Plus1complement(131151..132092) NW_003299423 olfactory receptor 1J4-like LOC100622893 __SEG__ Chr1 {Sus scrofa} MRSQKHSNMSEFFLLGLPIHPEQQGVFFALFLGVYLTTLLGNLLIILLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPKMLMNMQTQDRSISYAGCVTQVYFSIFFACI
DNLLLVVMAYDRYVAICHPLRYTIIMREELCLCLLAGCWLLSSAYALTHTLLLAQLSFCADNTIPHFFCDLASLLKLSCSDISLNELVIYTSGAAVFIFPLSGILVSYGR
IGISILRVPSTKGIFKALSTCGSHLSVVSLFYGTIMALYFSPSSGQSFDKGIIASVMYTVVTPMLNPFIYSLRNRDMTLALEILIRNNNIFTT*
1053 >lcl|XP_003353699.1|Plus149868..50986 NW_003534167 olfactory receptor 1J4-like LOC100623462 __SEG__ Chr1 {Sus scrofa} MLNVESVSCALATLGNKGESGSFSFSPQESERASVVATVMNSMSLIFPLSSFPSRHNRTMRRENQSCMSEFILLGLPIQPGQQSMFFALFLGMYLTTVLGNLLIILLIRL
DPHLHTPMYFFLSHLALTDISFSSVTVPKMLMNMQTKDLSIPYAGCVTQTYFFLFFTGLDDFLLTSMAYDRYVAICHPLHYTTIMRGELCTLLVTVSWILSCANALCHTL
LLAQLSFCADNTIPHFFCDLGALLKLSCSDTSLNELVIFIAGVVVIMLPLLCILVSYGYIGATILKVPSTKGICKALSTCGSHLSVVFLYYGTIIGLYLVPSSSTSSEKD
IVTSVMYTVVTPLLNPFIYSLRNRDMKGALEKLFYKAPVLSQ*
1054 >lcl|XP_003353701.1|Plus1complement(315977..317026) NW_003534168 probable G-protein coupled receptor 21 GPR21 __SEG__ Chr1 {Sus scrofa} MNSTLDGNQSSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLNHHTTSYFIQTMAYADLLVGISCLIPSLSLLHYPLPVEESLACQVFGFVVS
VLKSVSMASLACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQWCAESWYTSPYFTLFIVMMLYAPAALIVCFTYFNIFRICQQ
HTKEISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHSNRFASFLTTWLAISNSFCNCVIYSLSNSVFQRGLKRLSGAMCASCASQM
IAKDPYTVRSKGPLNGCHV*
1055 >lcl|XP_003353768.1|Plus1147390..148331 NW_003299436 olfactory receptor 10AG1-like LOC100512761 __SEG__ Chr1 {Sus scrofa} MNHQEKPPEENLTKLMEFVLLGFTDVPHLQWFLFGLFLVIYIIILISNGIIFLITKLDPALQTPMYYFISNFSFLEICYASVTLPRMLINLWTQKRTISFIACATQMCCV
LVLAATECFLLAVMAYDRYVAICNPLHYPLIMKHKMCIQLVAGSWISGIPVQIGQTFQIFSLPFCGSNLINHFFCDIPPILKLACGDTFVNEMMVSTVAVLFVTVPFLLI
LVSYGKLISTILKLSSATSRTRAFSTCSSHLMVVVLFFGSGMITYLRPRTSHSAGTDKVLSLFYTIVTPMINPMIYSLRNKDVVRALRKLLCK*
1056 >lcl|XP_003353772.1|Plus1126669..127013 NW_003299439 notch-regulated ankyrin repeat-containing protein-like LOC100620133 __SEG__ Chr1 {Sus scrofa} MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYS
GSGR*
1057 >lcl|XP_003353868.1|Plus1427365..428066 NW_003534209 LOW QUALITY PROTEIN: LRRN4 C-terminal-like protein-like LOC100620756 __SEG__ Chr2 {Sus scrofa} MPPGSPCLLWLLAVTYSVVPGVQPLAAGDLEEEQDETPLPAVLCDYDRCRHLQVPCQELQRASPTACLCPGLSSASQPPNPPRLGEVRVEAEAGRAVVHWCAPSSPVHQY
WLLLWEGGGAPQKGPPLNSTVRRAELNGLKPGGAYIVCVVAANAAGESRVPPAGAEGLDGAGGPTLGPCGRLSVPPAAAHAAARGRGRGLGAGAHQRRRPGLALLPARAL
GLPPPRPREPRGAL
1058 >lcl|XP_003353894.1|Plus1454722..455660 NW_003534215 olfactory receptor 5AN1-like LOC100623052 __SEG__ Chr2 {Sus scrofa} MTRGENTTNITDFVLLGFSDFPQIRAALFVVFLVIYILTLTWNLCLIVLIRMDSHLHTPMYFFLRNLSFIDICYVSSTAPKMLYDFFQAKPTITVVGCAIQYFVCSTMGL
SECGLMTVMAYDRYAAICNPLLYSSTMSPSLCGRMVLGSYMAGLSASLSQVCAMLQLHFCGPNVIHHFFCDMPQLLVLSCSDTFFLQLLTIILTVIFGIINALVIMMSYV
YIVISIMKITSAKGRSKAFNTCASHLTAVTLFYTSSIFVYLSSSSGRSSSFDRFAAVFYTVVIPMLNPLIYSLRNKDIKDALKRLKKRKECC*
1059 >lcl|XP_003353900.1|Plus1559610..560554 NW_003299464 olfactory receptor 5B12-like LOC100628183 __SEG__ Chr2 {Sus scrofa} MENSTEVTEFLLRGLSNDPELQIPLFIIFSLIYLITAVGNLGMIQLILLDARLHTPMYVLLSHLSLVDLGYSSAVTPKAMMGFLTGDAVISHNACATQFFFFVAFITVES
FLLASMAYDRYAAVCTPLHYTTAVTTNVCACLVIGSYVGGFLNASIHTGNIFRLSFCRSNVVDHFFCDAPPLLALSCSDTYVSEMVIFFVVGFNDLFSVLVILVSYLFIC
ITILKMHSSEGRQKAFSTCTSHLTAVSIFYGTGIFMYLQPSSSHSMNTDKVASVFYTMVIPMLNPMVYSLRNKEVKSAFKKAVGRAKSSIRLVF*
1060 >lcl|XP_003353901.1|Plus1complement(580542..581486) NW_003299464 olfactory receptor 5B2-like LOC100620101 __SEG__ Chr2 {Sus scrofa} MENYTEVTEFILLGLTNAPELQVPLFIMFTLIYLINVVGNLGMIVLILLDPRLHIPMYFFLSHLSLVDFCYSTAVTPKVMAGFLIGDKVISYNACAAQMFFFVALGTVEN
FLLASMAYDRFAAVCKPLHYTTTMMTGVCAWLAIGSYVYGFLNASIHVRDTFSLSFCRSNLVHHFFCDIPAVMALSCSDRHISELILVVVASFNIFFALLVILVSYLFIF
ITTLKMHSIEGYLKALSTCASHLTAVSIFYGTVIFMYLQASPSHSTDTDKIASVFYGMVIPTLNPLVYSLRNKEVKNAFKKVVEKAKLSIGFTF*
1061 >lcl|XP_003353902.1|Plus1599264..600208 NW_003299464 olfactory receptor 5B12-like LOC100620204 __SEG__ Chr2 {Sus scrofa} MENSTEVHVFRLLGLTDTPELQGPLFIIFTLIYLFTLIGNLGMITLILSDARLHTPMYFFLSHLSLVDCVYSSAVTPKVMAGFLTGDKVISYGGCVAQMFFFVAFASIDC
FLLAVMAYDRHAAVCKPLRYTTTVTTRVCAQMAVACYSWGFVESAIHTGFTFCLSFCHSNVVHHFFCDIPPILALSCSDVSINEIVLFILAAFNVFFALTVILTSYLFIF
IAILRMRSAEGRRKAFSTCTSHLTAVTIFYGTVIFMYLQPGSSHSMDNDQMASVFYTIVIPMLNPIVYSLRNKEVSNALRKATEKMKMMFSTQV*
1062 >lcl|XP_003353903.1|Plus1complement(609570..610538) NW_003299464 olfactory receptor 5B2-like LOC100620298 __SEG__ Chr2 {Sus scrofa} MENYTEVTEFVLLGLTNAPELQVPLFIMFTLIYLVSVAGNLGMMVLILMDSRLHIPMYFFLSHLSLADFCYSTAVTPKVIAGLLTGDSVISYNACAAQMFFFAVFVTVES
YLLASMAYDRYAAVCRPLYYTTTMTTSVCARLGIGSYFCSLLNASIHTGNTFRLYFCKSNVVDHFFCDIPAVMALSCSDKQSSELILIVVASFNIFFAFLVILLSYLFIF
FTILKMHSIEGYLKALSTCASHLTSVTIFYGTAMFMYLQPSSSHSMDTDKIASVFYTIIIPMLNPLVYSLRNKEVKNAFKKLVDKAKLSLSFTFKVVGSKMS*
1063 >lcl|XP_003353904.1|Plus1624318..625259 NW_003299464 olfactory receptor 5B2-like LOC100620388 __SEG__ Chr2 {Sus scrofa} MENRTGMTRFMLLGLTTAPELQMLLFIVFTLIYLITLVGNLGMITLILLDARLHTPMYFFLSNLSLVDLGYSSSVTPKTMAGLLLGDKVISYNACAAQMFFFVAFATVEN
YLLASMAYDRYAAVCKPLHYTTTMTTSVCARLAIGSYVCGFLNASFHIGNIFSLSFHKYNEVHHFFCDVPAVLILSCSAKHISEIVLVFTSSFNVFLALVVILISYLFIF
VTILKMHSAQGHQKAFSTCASHLTAVSIFYGTVIFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPVVYSLRNKEVKGAFKTVFKTNFSVGLGF*
1064 >lcl|XP_003353905.1|Plus1634554..635492 NW_003299464 olfactory receptor 5B3-like LOC100620485 __SEG__ Chr2 {Sus scrofa} MKNSTEVTQFILLGLTDDPELQVPLFTTFILVYLITLIGNLGIIMLILLDSHLHTPMYFFLSNLSLVDICYSSAVTPIVMAGFIPGDKVISYSACAAQMFFFAAFATVEN
YLLASMAYDRYVAVCKPLHYTTTMTTGVCVCLATGSYVCGFLNASIHIGDTFTLSFCRSNMVHHFFCDVPAVMVLSCSDRHVSELVLVYVVSFNIFFALLIILISYLLIF
ITILKMPSSAGYQKALSTCASHFTAVSIFYGTIIFMYLQPSSSHSMDTDKIASVFYAMIIPMLNPVVYSLRNKEVKSAFMKVVLEAKLSLGL*
1065 >lcl|XP_003353916.1|Plus1complement(362769..363920) NW_003534216 apelin receptor-like LOC100625268 __SEG__ Chr2 {Sus scrofa} MEEGGDFDNYYGVDNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGAFACKLSSYLIF
VNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVFRTTGAILHAENGTKVQCYMDYSMVAAPNSEWAWEVGLGVSSTAVGFVVPFTVM
LTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSVLCWG
QSQCGSASTSSSGEKSASYSSGHSQGPGPGLGKGGEQTQEKSIPYSQETLVVD*
1066 >lcl|XP_003353918.1|Plus1complement(123259..124188) NW_003299469 olfactory receptor 4S1-like LOC100624489 __SEG__ Chr2 {Sus scrofa} MGTKSNVTEFVLFGLFQSREMQHVCFVVFSLVHVLTVLGNLLVIITINASKTLKAPMYFFLSHLSFADMCYPSATTPKMIADTFVERKTISFNGCMSQLFSAHFFGGTEI
FLLTAMAYDRYVAICRPLHYTTIMDRWKCGLLAGASWVAGFLHSILQTLLTVQLPFCGPNEIDNFFCDVHPLLKLACADTYVVGLIVVANSGMISLVSFIILIISYVVIL
LNLRSRSSESRHKALSTCGSHIITVLLVLVPPMFMYIRPSTTLAADKLVILFNIVMPPLLNPLIYTLRNNEVKNAMRKLFRVKGSLGEK*
1067 >lcl|XP_003354000.1|Plus11088668..1089597 NW_003534260 olfactory receptor 4C46-like LOC100620421 __SEG__ Chr2 {Sus scrofa} MENRNNVTEFILLGLTRNPKTQKIIFVVFLIIYIVSVVGNVLTMVIVTASPLLKSPMYFFLAHLSFIDASYSSVNTPKLIVDLLHERKTSPFNECMTQIFGQHLFVGVDI
ILLTVMAYDRYVAICKPLHYITIMNWQVCWLLVGVVWVGGFLHSTIQILFIFRLPFCGPNIIDHFMCDLNPLLNLACTDTHTLGLFVALNSGFICLLNFVLLIGSYVVIL
LSLRTHSLEARHKALSTCVSHITVVILFFVPCIFVYLRPAANLPIDKAVTIFYTMITPMLNPLIYTLRNAQMKNAIKNLCSRKAISGDK*
1068 >lcl|XP_003354088.1|Plus1200064..200408 NW_003534271 insulin receptor-like LOC100627985 __SEG__ Chr2 {Sus scrofa} MRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMESVPLDRSSHSQREEAGGRDGGSALGLKRNYEEHISYTHMNGGKKNGRILTLPR
SNPS*
1069 >lcl|XP_003354112.1|Plus11661338..1662261 NW_003534273 olfactory receptor 7D4-like LOC100622042 __SEG__ Chr2 {Sus scrofa} MEAGNHTGVSKIFFLLGLSDDPELQPFLFGLFLSMYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFVSTIVPKMLVNIQAQSKDISYVGCLTQVYFFVVFAG
MDDFLLTVMAYDRFVAICHPLHYMVIMNARLCVLLVLMCWFVFFCVALVHLLLLTQLTFCVGTEIQHYSCELDQILKVACSDTFINDVCMYVATALLCMLPLTGILFSYY
QIVSTLMKMASTEGKYKAFSTCGSHLSVVTLFYGTSLGVYFTSAVTHSPHRISIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLS*
1070 >lcl|XP_003354121.1|Plus11600931..1601869 NW_003534273 olfactory receptor 7A10-like LOC100624355 __SEG__ Chr2 {Sus scrofa} MDAGNQTGVLEFLLLGLSEDLEWQPLLFGLFLSMYLVSVLGNLLIILAVSSDSRLHTAMYFFLSHLSFSDICFNSTIVPKMLVNIQTASKAITYGGCITQMYFYLVFLYL
DHFLLTVMAYDRFVAICHPLHYMTMMNPHFCSQLALVSWSVSILVALLHSLMVLRLSFCTHTEIPHFFCELTEVLQSSCSDALSNYIVLFSVTGLLGIPPLTGILFSYSK
ILSSILKMSSTEGRYKAFSTCGSHLTVISLLYGTGLGVYLSSAFSSSSSKGAVASVMYTVVIPMLNPFIYSLRNRDMQGALRTFVSRSFFPL*
1071 >lcl|XP_003354122.1|Plus132908..33540 NW_003534274 olfactory receptor 7D2-like LOC100625583 __SEG__ Chr2 {Sus scrofa} MDAGNQTWVLEFLLLGLSEDAEWQPLLFGLFLSMYLVSVLGNLLIILAVSSDSHLHTPMYFFLSHLSFSDICCSSTIVPQMLLNIQTASKAIIYSGCITQMYFSSVFLCL
DNLLLTVMAFDRFVAICHPLHYMIMMNPLLCDLLALFSWSVSILFPLIPCLMALHLSFCTHTEIPHFFCELAEVLKSALSDAFRXLYAMYSLTGLLAIPH*
1072 >lcl|XP_003354123.1|Plus148706..49644 NW_003534274 olfactory receptor 7D2-like LOC100625777 __SEG__ Chr2 {Sus scrofa} MDAGNQTWVLEFLLLGLSEDPEQQPLLFGLFLSMYLVSMLGNLLIILAVSSDSRLHTPMYFFLSHLSFSDICYSSTIVPQMLVNIQTASKAITYADCITQMYFSSVFLCL
DNLLLTVMAFDRFEAICHPLHYRIMMNPLLCDLLALFSWSVSILFPLIPCLMALHLSFCTHTEIPHFFCELAEVLKSACSDAFRNYIAMYSLTGLLAIPPLTGILVSYSK
IIYSILKMSSLEGKYKAFSTCGSHLTVISLFYGTGLGVYLSSAFSASSSKGAVASVMYTVVTPMLNPFIYSLRNRDLQGALRKFVSRSSFPL*
1073 >lcl|XP_003354133.1|Plus1complement(770166..>771134) NW_003299519 olfactory receptor 7G1-like LOC100623927 __SEG__ Chr2 {Sus scrofa} HRSIFSIRFLNNMEWRNETRVSDFLLMKVTEDPELRSLLFSLFLLMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSINDICLSTTTIPKMLVNIHTQNQSIPYAGCL
TQIYFVLVFASLESCLLAAMAYDRYVAICHPLRYTVIMNSRLCGLLILLPLLIIIVDALLHSLMVLQLTFCTDLQIPLFFCEVVQVIKLACSDALINNILIYVATSVFGG
IPVCGIIFSYVQIVSSVLRMPSVGGKYKAFSTCGSHLSVVSLFYGTGLGVYISSALTNSSRKTAVVSMMYTVVPQMMNPFIYSLRNRDMKGALKKLIKTSLL*
1074 >lcl|XP_003354156.1|Plus1complement(4856..5800) NW_003534278 olfactory receptor 7A17-like LOC100624973 __SEG__ Chr2 {Sus scrofa} MVPGNYTQNSEFFLQGLSKEPELQPLIFGLFLSMYLITVFGNLLIILAASSDSHLHTPMYFFLSNLSFVDICFTTTTILKMLINIHTRSKVISYEGCISQMYFYILFAVL
DDFILSVMVYDSFLAICHPLHYTVIMNPWLCGLLVLVSWIISALHSLLESLLVLRLSFCTDLEIPHFFCEIKQIVNLACDTFLNDTIMYFTALLIGGGPLAGILYSYSKI
ISSIHGMTSAGGKHKALSTCASHLLVVFLYYCSGVGVYLSSAPTHSSHLSTIATVMYTVVTPMLNPFIYNLRNKDIKRALKKVIQMAVIKRQVT*
1075 >lcl|XP_003354157.1|Plus1complement(44809..45753) NW_003534278 olfactory receptor 7A17-like LOC100625058 __SEG__ Chr2 {Sus scrofa} MVPGNYTQNSEFFLQGLSKEPELQPLIFGLFLSMYLITVFGNLLIILAASSDSHLHTPMYFFLSNLSFVDICFTTTTILKMLINIHTRSKVISYEGCISQMYFYILFAVL
DDFILSVMAYDRFLAICHPLHYTVIMNPRLCGLLVLVSWIISALHSLLESLLVLRLSFCTDLEIPHFFCEIKQIVNLACDTFLNDTIMYFTALLIGGGPLAGILYSYSKI
ISSIHGMASAGGKYKALSTCASHLLVVFLYYCSGVGVYLSSAPTHSSHLSTIATVMYTVVTPMLNPFIYSLRNKDIKRALKKVIQMAVIKRQVT*
1076 >lcl|XP_003354159.1|Plus1151519..152484 NW_003534279 olfactory receptor 7A10-like LOC100626271 __SEG__ Chr2 {Sus scrofa} MGPDNDTQISTFLLLGLSKERDFQPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHIPMYFFLSSLSFVDICFTSTIIPKMLVNIQTENKVITYAGCITQLYFSTLFGGW
DNFLLAVMAYDRFLAICHPLHYTVKMNPQFCGLLVLVSWILSVLNSLLQSLIVLQLSYTDMEIPHFFCDLNQMVKLGCSDTFLNDTVLYFSTGLLAGGPLAGILYSYSKI
VSSLCRISSAQGKYKAFSTCASHLSVVSLFYFSVLGVYLISAATHSSHSTAGASVMYSVVAPMLNPFIYSLRNKDIKGALKRFYEMAGIKRTTVLKVTNCH*
1077 >lcl|XP_003354160.1|Plus1180705..181658 NW_003534279 olfactory receptor 7A10-like LOC100626456 __SEG__ Chr2 {Sus scrofa} MDTGNNTQTSEIFLLGFSEEPEPQLLIYGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYIFLSNLSFVDICFISTTIPKMLWNIQMQSKVITYSGCITQMYFFTLFVGL
DDFLLTMMAYDRFVAICHPLHYTIIMNPQLCGLLVLVSWTVSVLHSLLQILMVLQLSFCKDLEIPHFFCELRQMVQSACSDMFLNNIVMYFAVGLLGVGPLAGILYSYSK
IVSSIHGLSSGQGKYKAFSTCASHLSVVSLFYCTCLGVYFSSAATKSSQSSATASVMYTVVTPMLNPFIYSLRNKDIKGALKRICGENTIKGPFFLG*
1078 >lcl|XP_003354176.1|Plus1complement(46584..47519) NW_003534283 olfactory receptor 1F1-like LOC100620917 __SEG__ Chr2 {Sus scrofa} MDNQTQVSEFILLGLSEQPLQRQMFFTLSFSLYLIGCMGNLLTILAIVSDPHLHSPMYFFLSNLSLLDICFTSTTIPKVLVNHLCGLSTISFSACLAQMYFFVAFGAADS
FLLSAMAYDRYLAICCPLHYMTIMSILRCALLVVIPWISANLISMVHTILMTRLSFCSNRIPHFFCDINALINLSCSDTQVNKILVLVLGGSGVLIPFVCIMASYTPIAV
AVWKVPSARGRWKAFSTCGSHLCVVSLFYGTIIGVYFNPASTHTPQRDMAATVIYTMVTSVLNPFIYSLRNQDLKGALRKFIRWGHFAKSL*
1079 >lcl|XP_003354177.1|Plus1147019..147786 NW_003534283 olfactory receptor 1361-like LOC100621438 __SEG__ Chr2 {Sus scrofa} MYFFLSNLSLLDICFTSTTIPKVLVNHLCGLSTISFSACLAQMYFFVAFGAADSFLLSAMAYDRYLAICCPLHYMTIMSILRCALLVVIPWISANLISMVHTILMTRLSF
CSNRIPHFFCDINALINLSCSDTQVNKILVLVLGGSGVLIPFVCIMASYTPIAVAVWKVPSARGRWKAFSTCGSHLCVVSLFYGTIIGVYFNPVSTHTTQRDMAATVMYT
MVTSVLNPFIYSLRNQDLKGALRKFIRWGHFAKSL*
1080 >lcl|XP_003354196.1|Plus1complement(62609..63532) NW_003534289 olfactory receptor 13G1-like LOC100624876 __SEG__ Chr2 {Sus scrofa} MNNSIVTEFMIMGITQKPELQRVLFFVFLFIYLVAFLGNMLIVIAIIYNTTLHMPMYVLLLALAIVDIICTTSIIPKILETMLTSRKTISYGGCMSQLFFFTWSLGAEMV
LFTTMAYDRYVAICFPLRYIAIMNRYMCVALLSIVMAIAVTNSWVHTGLILRLTFCGSNIIDHFFCEIPPLLALSCSPVRINEVMVYVADISLAIGDFILTCISYSFIIV
AILRIHTTEGKRKAFSTCSSHLIVVSLYYSPVIYTYIRPASSYTFERDKVVAALYTLVTPTLNPIVYSFRNKDMQAGIRKVFALLKR*
1081 >lcl|XP_003354198.1|Plus1complement(93792..>94745) NW_003534289 olfactory receptor 14A16-like LOC100625059 __SEG__ Chr2 {Sus scrofa} LLLQIRISMAKKSTNTTIVTEFLLMRFPDDQVLQGLYVTFFLLIYLAALMGNFLIITLTTTDKCLQSPMYFFLKNLSLIDICFISVTVPKAIINALTKSQTISFLGCASQ
IFLFIFLAGTEYALLIAMSYDRYVAICHPLYYEAIVNRGTCWQMVTASWSSGCIYGSVHVGGTFSAHFCGPNIVHQFFCDIPSVLTLACSGENLEYAFIIASCIFAFVCF
LFLIASYIYIFSAVLRIPSAKGRLKSFSTCMPHLIVVMLFLFSGIVTYLGSNYKSASSLNLLISVLYSMLPPSLNPLIYSLRNKDMKEALGKMVKYW*
1082 >lcl|XP_003354201.1|Plus1complement(814445..815380) NW_003534289 olfactory receptor 2T12-like LOC100626564 __SEG__ Chr2 {Sus scrofa} MENWNLTSDFILLGLFNHTGPHLFLFVMVLTTAFTSLVGNALMLLLILLDPQLHRPMYFLLSQLSLMDMMLVSTVVPKMAADYFTGRNSISPAGCGLQIFFFLTLEGGEC
FLLAAMSYDRYVAICHPLRYPVLMTWPLCLRMILGSWFLGAADGLMQAAATLTFSYCNSHEVDHFFCEAPSLVRLACADTSLFEYAMYVCCVLMLLVPISLILISYSLIL
STVLQMHSKNARKKAFATCSSHLSVVGLFFGAAIFTYMRPKSYRSANHDKIVSAFYTIFTPVLNPLIYSLRNSEVKGALRKCIDQCAALKS*
1083 >lcl|XP_003354202.1|Plus123218..24156 NW_003299536 olfactory receptor 2L3-like LOC100627234 __SEG__ Chr2 {Sus scrofa} MENYTQTSTDFILLGLFPPSKIGMFLFILIVLIFLMALFGNLSMILLIYLDTQLHTPMYFLLSQLSFIDLNYISTIVPKMASNFLFGNKSISFIGCGVQSFFFLTLAVAE
ALLLTSMAYDRYVAICFPLHYPIRISRRVCVLMIMGSWIMGSINSCAHTTYALHIPYCKSRAINHFFCDVPAMLTLACMDTWVYEYTVFVSTTLFLVLPFIIIACSYGRV
LLAVFHMNSAEGRKKAYSTCSTHLTVVTFYYAPFVYTYLRPRSHRSPTEDKALAVFYTILTPMLNPVIYSLRNKEVMEALRRVTQRIYFVKM*
1084 >lcl|XP_003354203.1|Plus196929..97867 NW_003299536 olfactory receptor 2L2-like LOC100627324 __SEG__ Chr2 {Sus scrofa} MENYNQTSIYFILLGLFPSSRIGMFLFIIIVLIFLIALFGNFSMILLIFLDNNLHTPMYFLLSQLSLMDLTYISTIVPKMAYNFLFNDKSISFIGCGIQSFFFLTLAGAE
GLLLAAMAYDRFVAICFPLHYHIRVSKRICVLMIIGSWIMGSINSFAHTAYALNIPYCQSRAINHFFCDVPAMLTLACIDTWVYESTVFVSTTIFLLVPFTCIAFSYGRI
LLVVHHMNSTEGKKKAYSTCSTHLTVITLYSAPFAYTYLRPKFLRTPTEDKVLAMLYTIFTPMLNPIIYSLRNKEVMGALRRVIQRICSVKM*
1085 >lcl|XP_003354204.1|Plus14724..5680 NW_003299536 olfactory receptor 2AJ1-like LOC100627809 __SEG__ Chr2 {Sus scrofa} MGHVNHTFSNDFILLGLFSSSQTCLIFFSFIVIIFSTAVTENAIMILLIHRESRLHTPMYFLLSHLSFMDILHISNIVPKMITDFLSGNRAISFAGCGFQIFLSLTLSGG
ECLLLAAMSYDRYVAICHPLRYPILMDDYVSILMAGGSWLIATVNSIVHTVYTLHLPFCGSRAIDHFFCDVSAMLVLSCVDTTHYERGVYVSSIIFLLVPFSLIFASYVQ
ILLTVLQMKSSEAWKKSFSTCFFHMIVVIMYYGPFIFTYMRPKMYHTPGQDKFLAIFYTILTPSFNPIIYSFRNKDVLEALKNMIKSNFLHKNNRKSA*
1086 >lcl|XP_003354205.1|Plus1complement(233967..234899) NW_003299537 olfactory receptor 2M3-like LOC100620490 __SEG__ Chr2 {Sus scrofa} MALENQTFNSDFILLGIFDHSPTHIFLFSLVLGIFTVAFMGNTIMILLIYLDTQLHTPMYFLLSQLSLMDLMLICTTVPKMAYNYLSGSTSISFAGCATQIFFYTSLLGC
ECFLLAVMAYDRNIAICHPLRYTNLMSPKICGLMVASSWILGSTDGVIDAVATFSFSYCGSREIAHFFCDFPFLLIISCNDTSIFEEVLFYCCIIMIVFPVAVVLVSYAR
VILAVIRMGSGKGRHKAFATCSSHLMVVGMYYGAGLFIYMRPTSNRSPTQDKMVSVFYTILTPMLNPLIYSLRNKEVARAFMKVLGKGKN*
1087 >lcl|XP_003354206.1|Plus1complement(266110..267045) NW_003299537 olfactory receptor 2M4-like LOC100620594 __SEG__ Chr2 {Sus scrofa} MVWRNQTFNFDFILLGIFNHRPIHIFLFSLVLGIFIVAFMENIIMILLIYLDTQLHTPMYFLLRQLSLMDLMLICTTVPKMTFNYLSGRKSISLAGCGIQIFFYVSLLGA
ECFLLAVMAYDRYVAICNPLRYTILMNQKLCILMTIASWILGSLDGIIVLAAVLSFSYCSSLEIHHFFCDVAALLPLSCTDTSAFERLLFICCVVMLVLPVSVIIGSYSR
VIQAVISMHSEESRRKAFTTCSSHLSVVGLYYGAAMFMYMRPASSHTPDQDKIVSAFYTILTPMLNPLIYSLRNKEVSRGFQKLLRKGKLM*
1088 >lcl|XP_003354216.1|Plus1complement(94746..95681) NW_003534292 olfactory receptor 2L3-like LOC100625209 __SEG__ Chr2 {Sus scrofa} MVGWNESSVTNFILVGLFPEFKHSIYLNSIIIFLYILAFLGNILLIVLIWGDSRLHTPMYILLSQLSLIDLTLTSTIVPKMASNFFTGKKTISWIGCGMQSFFYLMLGMS
ECLILTLMAYDRYVAVCNPLHYPIIMNPKFCLHMIAVCWIGGSIGSFIHTVYPMHFPICGSREIHHFFCEVPALIKLSCEDTSVYQSVVVVTSIVLLVLPFILIIASYTL
IFLAVLHMNSVKGRKKTLATCSSHLTVVSLFFGPNIFIYMTFTSSHSPEQDQALSVFSNILTPLLNPLIYSLRNKDVVAALTKLMGRYGVS*
1089 >lcl|XP_003354232.1|Plus1479814..480743 NW_003534294 olfactory receptor 1L1-like LOC100622111 __SEG__ Chr2 {Sus scrofa} MGRDNQTRVTEFLLLGLSGQSEQEEVLSGLFLCMYLITIIGNLLIVLAIGCDRHLHTPMYFFLANLSCVDICVSSVTIPKMVVNHILGSQSISYAECMTQIYFFITFTNM
DGFLLSVMAYDRYNAICCPLHYTMIMRPKLCVLLVAASWVVTNLHALLHTLLMGTLTFCSNNAVHHFFCDPYTVLKLSCSNTFINDLMVLTEGGLIFMTPFTCIIVSYAF
IFSNVLKLPSAHGVRKALSTCGSHLTVVSLFYGAILGVYMRPSSSYSVQDVVATVIFTAVTPLVNPFIYSLRNRDMKRALRKLISDSIV*
1090 >lcl|XP_003354233.1|Plus1486377..487306 NW_003534294 olfactory receptor 1L1-like LOC100622204 __SEG__ Chr2 {Sus scrofa} MGRDNQTRVTEFLLLGFSGQSEQEEVLSGLFLCIYLITIIGNLLIVLAIGCDRHLHTPMYFFLANLSCVDICVSSVTIPKMVVNHILGSQSISYAECMTQIYFFITFTNM
DGFLLSVMAYDRYNAICCPLHYTMIMRPKLCVLLVAASWVVINLHALLHTLLMRTLTFCSNNAVHHFFCDPYTVLKLSCSNTFINELMVLTEGGLIFMTPFTCIIVSYAF
IFSNVLKLPSAHGVRKALSTCGSHLTVVSLFYGAILGVYMRPSSSYSVQDVVATVIFTVVTPLVNPFIYSLRNRDMKRALRKLISDSIV*
1091 >lcl|XP_003354240.1|Plus1complement(104058..105140) NW_003534298 histamine H2 receptor-like LOC100625720 __SEG__ Chr2 {Sus scrofa} MASNSTASSSCLDPLAFKVTVSLILILLIFITIAGNVVVCLAVGLNRRLRSLTNCFIVSLAVTDLLLGLLVLPFSAFYQLSCRWSFGKVFCNIYTSLDVMLCTASILNLF
MISLDRYCAVTDPLRYPVLITPARVAISLVLIWVISITLSFLSIHLEWNSSRMDPSGVNHTISKCKVQVNLVYGLVDGLVTFYLPLLVMCITYYRIFKIARDQAKRIHNI
SSWRAATIREHKATVTLAAVMGAFIICWFPYFSVFVYRGLKGDEAVDETVEAIVLWLGYANSALNPILYAALNRDFRTAYQQLFRCSPTSHNAHRTPLRSNSSQLMRNQS
QETRWQEERPLRLQVWSGAEVAAAQEATDR*
1092 >lcl|XP_003354289.1|Plus1complement(268386..270779) NW_003299583 adenomatous polyposis coli protein-like LOC100628215 __SEG__ Chr2 {Sus scrofa} MPKKKKPSRLKGDNEKHSPRNMSGILAEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEE
KPFTSNKGPRILKPGEKSTLETKKMESENKGIKGGKKVYKSLITGKVRSNSEISSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSESQA
ATTSPRGAKPSVKSELSPVTRQTSQTAGSNKGPSRSGSRDSTPSRPAQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQT
NLTKQTGLSKNGSSIPRSESASKGLNQMSCSNGSNKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSP
SLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPIKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSIS
GTKQTKESQVSTKGTWRKIKESEISPTNTTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTISEKGNPNAKDSKDNQGKHNV
SNGGAPTRTMGLENRLNSFIQVDAPDQKGTETKPGQSNSVPASETNESSIAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKR
DSKTDNTDSSGTQSPKRHSGSYLVTSV*
1093 >lcl|XP_003354367.1|Plus1complement(359889..361727) NW_003534374 protocadherin alpha-4-like LOC100621600 __SEG__ Chr2 {Sus scrofa} MEFSWAIGQESRRLLLSLLFLAAWEAGSSQIHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKGGGDLLEVNLQNGILFVNSRIDREELCGRSLECSIHLEVIV
ERPLQVFHVEVEVRDINDNPPVFPGTQKNLFMAESRPLDSRFPLEGASDADIGVNAVLTYTLSPNEYFSLEKPSGDERVKRLGLVLRKPLDREEAPQIFLVLTATDGGKP
ELTGTVQILVTVLDANDNAPAFDRTLYAVKLLENVPNGTLVIKLNASDLDEGSNGNIFYSFSTDISPNVKSKFYIDPITGKIMVKGYIDFEESKFYEILVDGIDSGQPPL
SGHCTVMVEVEDTNDNVPVIEFKSLSLPVREDAPLGTTIALISVSDRDSGANGQVTCSLTPHVPFKLVSTFKNYYSLVLDGTLDRESVASYELVVTARDGGSPSLWATAR
VSVEVGDVNDNAPVFAQPEYTVFVKENNAPGCHIFTVSARDADAQENARVAYSLVERRVGERALSSYVSVHAESGQVFALQPLDREELELLQFRVSARDAGAPPLGSNVT
LQVFVLDENDNAPALLPPPPPSPWPPHGWAGGPGAGPGVVSQRVARWVGAAQVVPKDQRPPV*
1094 >lcl|XP_003354369.1|Plus1complement(635088..637733) NW_003534374 protocadherin alpha-C2-like LOC100622074 __SEG__ Chr2 {Sus scrofa} MELAGTRPAATEHPRLRPPMSWLLLLLLLLLLFLLLPGPAASQLRYSVPEEQTPGTLVGNVARALGLELQRLGPGCLRINHLGAPSPRYLELDLSSGELFVNERIDREAL
CEQRPRCLLSLEVLAHSPVAVSAVGVEVLDINDNSPRFPRPDYQLQVSESVAPGARFHIESAQDPDVGTNSVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQA
ALHHLVLTAVDGGRPARSGTAQISVRVLDTNDNSPAFDQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELTYSLSSYTSDRERQLFSIDARTGEVRVSGALDYEEASS
YQIYVQATDRGPVPMVGHCKVLVDIMDVNDNAPEVVLTDLYSPVPEDAALNTVVALLSVNDQDSGPNRKVSLGLEAALPFRLNGFGNSYTLVVSGPLDRERVAAYNITVT
ATDGGVPALRSQRTLQVEISDVNDNPPSFLQDSYAIYIQENNLPGVLLCTVQATDPDEKENAEVTYSLLDREVQGLPVTSYVSINSASGSLYAVNSFDYEKFREFLVTVE
AQDKGSPPLSSTVTASVYVVDVNDHAPYILYPTSTNSSAAIEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLVQTSDLDLFKVELHTGEIRTTRKMGDESGTTFNLTV
VVRDNGEPSLSASVAITVAVVDRVSRILPDTQRHVRSPRTYSEITLYLIIALSTVSFIFLLTIIVLSIIKCYRYTAYGTACCGGFCGVRERCPAELYKQANNNIDARFPH
GLKVQPHFIEVRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPGGAHAAAGDSRHLTGQSGQSAGNLIILKNEAVSQNEVRESSRGLPQSHAFSIQCHVVGFME
V*
1095 >lcl|XP_003354373.1|Plus1250883..253294 NW_003534376 protocadherin gamma-B4-like LOC100623536 __SEG__ Chr2 {Sus scrofa} MGSGAGKRGWAPRRPGLFACLLSLFCLALSEQIRYRIPEEMAQGSVVGNLAKDLRLSVHELATRNLRVSSEKPYFAVSAESGELLVSSRLDREQICGKKPACALEFEAVA
ENPLNFYHVNVEIEDVNDHTPKFTQSSFELQISESTKPGARFILGSAHDADIGTNSLQNYQLSPDDHFSLVVKEKFDGNKYPELVLKTPLDREEQTSHHLTLTALDFGDP
PLSSTAQIRVQVTDANDNPPVFSQELYRVELPENVLPGFTVLRVMATDQDEGVNAEITFFFTEADQITQFDLNSNTGEITILNTLDYEEVKEYSIVLEARDGGGMIAQCT
VEIEVLDINDNVPEVIFQSLPGLIMEDTKLGTHIALLKVRDKDSGHNGEVICKLEGYVPFKILTSSRNAYRLVTDGDLDREQTAEYNITITATDKGEPPLSSRSSITLHI
GDVNDNAPVFQQASYEVHVAENNPPGASIAQVSARDPDLGPNGHVSYSLVAGDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRALELTLQARDHGSPALRANVSLRVLV
GDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADAGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGERDAARQRLLVAVRDGGQPPLSATATLLL
VFADSLQEALPDLGDAPAPSDAQAELQLYLVVALALISVLFLVAVILAVALHVRRSSRPAAWGCFQPGLCVKAGPVGPPNYSEGTLPYSYNLCVAHTGKTEFNFLTCSEP
LSSGQDILCAESPGALFPLCNSSESTSNQVSFL*
1096 >lcl|XP_003354377.1|Plus1266370..268868 NW_003534376 protocadherin gamma-A9-like LOC100625782 __SEG__ Chr2 {Sus scrofa} MAAPVNRLPHRGLVLLCLFLGRLWESGARQIRYSVPEETEKGYIVGNISKDLGLEPRELAERGVRIVSRGRTQLFALNARSGSLVTAGRIDREELCAQSAPCLVNFKVLV
EDRVQLYGVEIEVTDVNDNNPKFQVESLEVKINEIAAPGTRYPLPEAVDPDVGANALQSYQLSPSPHFSLDVQTGDDGTVRPELVLQRALDREEEAAHHLVLMASDGGDP
RRSSTVHVRVTVLDTNDNAPVFAQPVYRVKVPENVPPGTLLLTVSASDPDEGTNGDVAYRFWKISEKQSPLFHLNEQTGEISAAKSLDYEECAFYDMEIQAEDGGGLKDR
AKVLISVEDVNDNRPEVTVTSLFSPVREDAPQGTVIVLFNAHDQDSXKNGXVVCSIQDALPFRLEKSTEDYYRLLTTGNLDREKNFEYNITVTATDRGTPPLSTEIHITL
NVVDINDNPPSFPQTSYSVYLPENNLRGMSIFSVSAHDPDSDENARVVYSVAEDTIQGAPLSSYVSINSDTGVLYALRSFDYEQFRDLHLRVIASDSGDPPLSSNVSLSL
FVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPDVLADLDSLESPANPDDSGLTLYLVVAVASVSCVFLAFVIVLLALRLRRWHLSRVLQASGGGLGGVPASHFVGVDGVRAFLQTYSHEVSLTADSRGSHVIF
PQPNYADTLISQESCGKSEPLCIADDSKFPIEDTPLVPVSSIFPLSSIKICFLFLFKCWHLQ*
1097 >lcl|XP_003354378.1|Plus1289689..292112 NW_003534376 protocadherin gamma-B5-like LOC100626127 __SEG__ Chr2 {Sus scrofa} MGNRVKQRSSAWRLRQVLFPFLLPLFCGALSEHIRYSIPEEMARGSVVGNLAEDLGLHVRDLLTRNLRVSSEKQYFTVNTENGNLLVNDRIDRESLCSPNPLCVVPLEVV
VENPLNVFHIDVTIEDINDNPPHFPQDSIVLQINELAIPGTRFGLESAIDADVGLNSLQSYQLSYSKHFSLTIEGKTESKNAPELVLEKPLDREQQSSHLLVLTAVDGGD
PVRTGTAQIRVKVTDANDNPPVFSQDVYKVSLRENSSPGTPVLXVKATDQDEGINAEITYSFRTLRDIGNVLTLDHQSGEIKSKDPVDFEISSSYTISLEARDGGGMNTE
CKIILEILDENDNAPEVVFTSVSSSITEDAEPGTVIALFKTHDKDSGENGKVTCLIKEKVPFRIESSANNYYKLVTDGALDREQTPEYNVTITATDRGKPPLSTSTTITL
HIADVNDNAPVFQQASYEVHVAENNPPGASIAQVSARDPDLGPNGHVSYSLVAGDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRALELTLQARDHGSPALRANVSLRV
LVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADAGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGERDAARQRLLVAVRDGGQPPLSATATL
LLVFADSLQEALPDLGDAPAPSDAQAELQLYLVVALALISVLFLVAVILAVALHVRRSSRPAGWGCFQHGLCVKAGPVGPPNYSEGTLPYSYNLYGADSQQTRFNFLTMT
PEMVPGQDLSNEASLVVSVTEENKLNSNCCCYSHEFQ*
1098 >lcl|XP_003354388.1|Plus1complement(233951..235204) NW_003534381 probable G-protein coupled receptor 151-like LOC100621805 __SEG__ Chr2 {Sus scrofa} MPPAALANSNSSTMNVSFAHLHFAGGYLPSDSKDWRSTVPALLVAVCLVGSVGNLCVVGVLLRGARKGKPSLIHSLILNLSLADLSLLLFSAPVRATAYSRGVWDLGWFV
CKSSDWFIHTCMAAKSLTIVAVAKVCCAHARDPAGQVSTHSCTIWSVLGAIWAVACLLPLPEWFFSTTRHHAGVEMCLVAVPAVAREFMSVFGKLYPLLVFCLPSLFASF
YFWRAYGQCRKRGTKPQNLRDQMRSRQLTLMLLSVAVTSALLWLPEWVAWLWTWHLKAGGPAPPQGFIALSQLLMFSISSANPLIFLVASEEFREGREGLWKWVISKKRP
TASVSQETPAGDSQAFPDSVPASPASIPERGETGSPSSGRGKADKAEIPTLPDVEQFWHERDSAPCVQDSDPAPWEHDDQETGDRDK*
1099 >lcl|XP_003354411.1|Plus1879585..880502 NW_003534386 olfactory receptor 9G1-like LOC100513978 __SEG__ Chr2 {Sus scrofa} MERSNYTVTEFILVGFTTDPVVQLVLFVVFLGVCSVTMVGNTTLMVLICYDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCVAQFFFSAGLAYSE
CYLLAAMAYDRYMAISKPLLYAQAMSIKLCAFLVAASYLGGFINSSIITKKTFTMNFCNDNVIDDFFCDLLPLVKLACGRKEGYQALMYFLLASNVVAPAVLILASYLFI
ITTILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPQSSYSLDRDKIVSTFYTVVFPMLNPMIYSLRNKDVKEALNKLLK*
1100 >lcl|XP_003354412.1|Plus1complement(206753..207715) NW_003534386 olfactory receptor 5L1-like LOC100620990 __SEG__ Chr2 {Sus scrofa} MGSMGKENCTSVTEFLLLGFSEVPELRVFLVLVFLVIYGVTVLGNLGMVGLIQVSPRLHTPMYFFLSHLSFVDLTYSTIIVPKMLANIINKDKAISFLGCVVQFYLFCLC
VVTEVILLAVMAYDRFVAICNPLLYKVTMSRNVCVELVSCCYLCGTVCSLIHLCLALKIPSYRSNVINHFFCDLPPLLSLACSDVTMNQLVLYIVATFNETISSVIILTS
YLFILITILRMRSAEGRSRAFSTCASHLATIAVLQGTILFIYCRPNSGNKSMATDKVATVFYTVVIPMLNPLIYSLRNKDVKEALRKVVKSKRFSQRTFS*
1101 >lcl|XP_003354413.1|Plus1complement(216167..216757) NW_003534386 olfactory receptor 5L1-like LOC100621097 __SEG__ Chr2 {Sus scrofa} MGSMGKENCTSVTEFLLLGFSEVPELRVFLVLVFLVIYGVTVLGNLGMVGLIQVSPRLHTPMYFFLSHLSFVDLTYSTIIVPKMLANIINKDKAISFLGCVVQFYLFCLC
VVTEVILLAVMAYDRFVAICNPLLYKVTMSRNVCVELVSCCYLCGTVCSLIHLCLALKIPSYRSNVINHFFCDLPPLLSLACSESL*
1102 >lcl|XP_003354414.1|Plus1complement(235388..236338) NW_003534386 olfactory receptor 5D13-like LOC100621307 __SEG__ Chr2 {Sus scrofa} MMLSEGNQSIIPTFTLLGFSEYPDLQVPLFLVFLSIYTVTVVGNLGMMIIIRISSKLHTIMYFFLSHLSFVDFCYSTTVTPKLLENLIVEDRTISFFGCITQFCFACIFG
VTETFLLASMAYDRFVAVHNPLLYSTAMSQKLCVLLVAGSYSWGIVCSLTLTYFLLALSYRESNIMNNFICDHSVIVSVSCSDPYISEILCFMIAVFNEACSLMIILTSY
ILIFITVMRMPSASGRQKTFSTCASHLTAITIFHGTILFLYCIPNPENSWLTVKVASVFYTVVIPMLNPLIYSLRNKDVKITFRKLVVTKFLHHSM*
1103 >lcl|XP_003354415.1|Plus1complement(244103..245050) NW_003534386 olfactory receptor 5D14-like LOC100621413 __SEG__ Chr2 {Sus scrofa} MEKANQSVGITFILLGFSEYPHLRVPLFLVFLAIYTVSVVGNVGMIAIIRINPKLHTPMYFFLSHLSFLDFCYSSAITPKLLETLVVNIGTISYMGCMMQFFFGCTFVIT
EMFMLAVMAYDRFVAVCNPLLYTVAMSPKLCIRLVASTYSWGGLCSLTLTCSLLELSFCGSNILNHFGCEYSAIISASCSDTYFILMLIFIMSIFSEACSLLIILSSYLF
IIVTVTKMPFAGGLRKAFSTCASHLTTITIFHGTLFLLYSVPSSKRSLLFIKVASVFYAVVIPMLNPLIYSLRNNDVKETIRGLINAKQLFSHST*
1104 >lcl|XP_003354420.1|Plus1333262..334194 NW_003534386 olfactory receptor 5W2-like LOC100621991 __SEG__ Chr2 {Sus scrofa} MEEENCSSVTEFIFLGITSTPGMKVTLFTTFLLIYLINLLANLGMIVLIRMDPQLHTPMYFFLSHLSFCDLCYSTAIGPKMLFDVLAENKSIPFFGCALQFLISCTFADS
ECLLLAVMAYDRYKAISNPLLYTVSMSNRVCSLLMAGVYVVGMADALIHTTLTFRLCFCGSNEINHFFCDIPPLLSLSCSDTQINELAIFTIYGFIELSSISGVLVSYGY
IILSVLRIHSAEGRFKAFSTCTSHLTVVAIFQGTLLFMYFRPSSSYSLDQDKITSLFYTLVIPMLNPLIYSLRNKDVKKTLEKLKTKLKN*
1105 >lcl|XP_003354422.1|Plus1complement(374665..375600) NW_003534386 olfactory receptor 5F1-like LOC100622171 __SEG__ Chr2 {Sus scrofa} MVKKNDTLLTEFVLLGLADTPELQVTLFLLFLVMYTLTVLGNVGMILLIWVDARLHTPMYFFLAVLSFVDVSYSSTVTPKMLADLLSEKKTISFAGCFLQMYFFIAFATT
ECILFGLMAYDRYVAICSPLLYSLIMSRSVCLQMAGGALTAGLLNSMVHTGYISSLPFCKSNVIHHFFCDSPPIFKLSCSNTHLYEMIVSTFAGVNTVGTLLVILTSYSY
ILLSILRMHSGEGRQKAFSTCASHLTALILFYSTGIYTYLRPTSGYSLNQDKVASVFYTVVIPMLNPLIYSLRNKEVKKALCNVITRKRVP*
1106 >lcl|XP_003354423.1|Plus1complement(382888..383823) NW_003534386 olfactory receptor 5F1-like LOC100622260 __SEG__ Chr2 {Sus scrofa} MVQKNDTLLTEFILLGLADTPELQVTLFLLFLVMYTLTVLGNVGMILLIRVDARLHTPMYFFLAVLSCVDVSYSSTVTPKMLADLLSEKKTISFAGCFLQMYFFIAFATT
ECILFGLMAYDRYVAICSPLLYSLIMSRSVCLQMAGGALTAGLLNSMVHTGYVSSLPFCKSNVIHHFFCDSPPIFKLSCSNTHLYEMIVSTFAGVNMVGTLLVILTSYSY
ILFSILRMHSGEGRHKAFSTCASHLTALILFYSTAVYTYLKPTSSYSLNQDKVASVFYTVVIPMLNPLIYSLRNKDVKKALCNVITRKRVP*
1107 >lcl|XP_003354425.1|Plus1421061..422011 NW_003534386 olfactory receptor 5AS1-like LOC100622472 __SEG__ Chr2 {Sus scrofa} MLESNYTTPLEFLFVGFTDYLPLRVTLFLVFLTIYTLTVVGNIGLIILVNFSSSLQTPMYYFLSNLSFLDISYSTAITPKMLVNFFASKKSISPYGCALQMFFFGCFADA
ECLILAAMAYDRYAAICNPLLYSTLMSRRVCVCLIVLAYASGSMTSMVHVSLTFRLPFCGSNIVNHFFCDIPPLLALSCADTHVNELLLFALCGFIQTSTFVVICISYFC
ILITVLGIKSSGGRSKTFSTCASHLIAVALFYGTLLFMYLRPAASYSPDTDKVVAVFYTVVFPMFNPIIYSFRNKDVKNALRKVLDRNCTFKCVCL*
1108 >lcl|XP_003354426.1|Plus1430316..>430993 NW_003534386 olfactory receptor 1052-like LOC100622577 __SEG__ Chr2 {Sus scrofa} MAGWNHTGVKEFLLVGLTENPHLQVPLFLLFTLIYFITLVGNGGMIMLIWLNAQLHTPMYFFLSNLSFCDICYSTVFAPKMLVHFLSKHKSSTFSGCVLQSFFFAVYVTT
EGILLSVMAYDRYVAIASPLLYTVIMTQKVCIRMVLVSYLGGLINSLTHTIGLLKLDFCGPNTVNHYFCDIPPLLRLSCSDAQNNELLLLIFSGVIAMFTLMTIMVSYIC
IITAIQ
1109 >lcl|XP_003354427.1|Plus1441329..442273 NW_003534386 olfactory receptor 1052-like LOC100622677 __SEG__ Chr2 {Sus scrofa} MANRNVSGITEFILLGLTDDPELNTVLFVLFLLIYLITVVGNLWVIIVVLVSAQLHSPKNFFLSQLAFLDFCYSSVFIPKMLVNYLAGQKAISYRGCLLQYSFVSLFLTT
ECFLLAAMAYDRYLAICRPLHYKGLMTTTSCIHLVTVSYLLGCAHSLTHLTGLLGLSFCGPNVLNHYFCDISLLFRLSCSDTQYNKALFTVLSGTTSVATFLIVVSSYLG
ILLTVLKIQSLRGRYKAFSTCASHLTVVTLFYGTVIFTYLGTSSSYPQDTAKILSVFYTLLLPILNLLIYSVRNTEAKEAMKRITMRKIFAQWP*
1110 >lcl|XP_003354428.1|Plus1451203..452135 NW_003534386 olfactory receptor 8I2-like LOC100622779 __SEG__ Chr2 {Sus scrofa} MTGNNFTEVTFFILSGFANRPELQIRLFLMFLFIYLFTVLGNLGLIVLIKIDSQLHTPMYFFLSNLAFIDIFYSSTVTPKALVNFLSNQKTISFVGCFVQMYFFVGLLCS
ECFLLESMAYDRYVAICNPLLYSVVMSQKVCNWLGAIPYTVGFTNSLISICVISSLAFCDISINHFFCDTTALLALSCVDIFSTEMVIFVLAGFTILSSLFIIITTYIVI
ISAILKIRSAAGRQKAFSTCASHLLGVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKSALLRAMQRKHFA*
1111 >lcl|XP_003354429.1|Plus1459948..460895 NW_003534386 olfactory receptor 8H3-like LOC100622880 __SEG__ Chr2 {Sus scrofa} MGRRNDTHVSDFILLGLTDSEAVQRILFMLFLLIYLMTLLGNAGMMLIIRLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLENLLTSTKYISYMNCFTQMYFFIFLAAT
ECFLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFFGFMDSFVNVLCMSRLDFCDSNVIHHFFCDTSPILALSCTDIQSIEIVIFISAGSTLVVSLIAIVVSYVS
ILSTILKITSTSGKQRAFSTCASHLLGVTVFYGTIMFTYLRPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVLQNTVGSRQLK*
1112 >lcl|XP_003354431.1|Plus1493550..494497 NW_003534386 olfactory receptor 8H3-like LOC100623144 __SEG__ Chr2 {Sus scrofa} MGRRNATHVSDFILLGLTDSEAVQRILFMLFLLIYLMTLLGNVGMILIIHLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLGNLLTSTKYISYMNCFTQMYFFVFLAAA
ECFLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFIGFMDSFVNVLCMSRLDFCDSNVIHHFFCDTSPILALSCTDVQGIEIMIFILAGSTLAVSLTITVVSYVS
ILSTILKITSTSGKQRAFSTCASHLLGVTIFYGTMIFTYLKPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVMQKTVGSRQLK*
1113 >lcl|XP_003354432.1|Plus1502576..503523 NW_003534386 olfactory receptor 8H3-like LOC100623244 __SEG__ Chr2 {Sus scrofa} MGRRNATHVSDFILLGLTDSEAVQRILFMLFLLIYLMTLLGNAGMMLIIRLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLGNLLTSTKYISYMNCFTQMYFFVFLAAT
EYFLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFFGFMDSFVNVLCMSRLDFCDSNVIHHFFCDTSPILALSCTDVQGIEIMIFILAGSTIVASVTTIVVSYVS
ILSTILKITSTSGKQRAFSTCASHLLGVAIFYGTMIFTYLKPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVLQNTVGSRQLK*
1114 >lcl|XP_003354433.1|Plus1517965..518912 NW_003534386 olfactory receptor 8H3-like LOC100623337 __SEG__ Chr2 {Sus scrofa} MGRRNDTHVSDFILLGLTDSEAVQRILFMLFLLIYLMTVLGNAGMMLIIRLDLQLHTPMYFFLSHLSFLDLSYSTVITPQTLENLRTSTKYISYMNCFTQMYFFVFLAAT
ECFLLSSMAFDRRVAICNPLHYPVVMSTRSCCSLVFGSYFFGFMDSFVNVLCMSRLDFCDSNVIHHFFCDTSPILALSCTDIQSIEIAIFILAGSTLVASVTTIVVSYVS
ILSTILKITSTSGKQRAFSTCASHLLGVTIFYSTTIFTYLKPSKSYSLGRDQVASVFYTIVIPMLNPLIYSLRNKEVKNAFIRVLQNTVGSRQLK*
1115 >lcl|XP_003354435.1|Plus1586870..587841 NW_003534386 olfactory receptor 8K3-like LOC100624301 __SEG__ Chr2 {Sus scrofa} MAWVDKHNLTMLNEFILMGITDIPELQAPLFGLFLIVYLISVVGNLGLSILIKVDCRLQTPMYFFLRHLAFTDFGYSTAVGPKMLANFAVDQPTISYHGCATQLMFFSVF
ITSEIFILSAMAYDRYVAICHPLLYMGLMSPRLCQALVTIPYLYSLFLSLLTIIKIFGSSFCGYNVIRHFYCDSLPLIALLCSDTYEIKWIILIFSAFNLLSSLLIVLVS
YVFILATILQMNSAESRCKAFSTCGSHLTVIVIFYGALFFMYVQPKSSDSLDADQVASLFYTLVIPMLNPMIYSLRNKEVKNALPRAWRMCANILFKTHSRIH*
1116 >lcl|XP_003354437.1|Plus1797392..798366 NW_003534386 olfactory receptor 8U8 LOC396793 __SEG__ Chr2 {Sus scrofa} MAQINCAQINCTQVQEFILTGFTDQRELKMPLFVIFLSIYLFTVGGNLGLILVIRTDAKLNTPMYFFLSNLAFVDFCYASVITPKMLGNFLYKQNIISFNACAAQLGCFL
TFMVSECLLLASMAYDRYVAICNPLLYTVSMSPGVCIQLVAAPYSYSFSMALFHTILTFRLSYCHSNIINHFYCDDMPLLRLTCSDTHSKQLSVLACAGVTFICSVLVVF
VSYTYIISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKVIINRNQAFVFITFKK*
1117 >lcl|XP_003354438.1|Plus1complement(188706..189644) NW_003534386 olfactory receptor 5L1-like LOC100626902 __SEG__ Chr2 {Sus scrofa} MGKENCTSVTEFLLLGFSEVPELRVFLVLVFLVIYGVTVLGNLGMVGLIQVSPRLHTPMYFFLSHLSFVDLTYSTIIVPKMLANIINNDKAISFLGCVVQFYLFCLCVVT
EIILLAVMAYDRFVAICNPLLYKVTMSRNVCVELVSCCYLCGTVCSLIHLCLALKIPSYRSNVINHFFCDLPPLLSLACSDVTMNQLVIYIVATFNELITILIILTSYLF
ILVTILRMRSAEGRSRAFSTCASHLTAIIVFHGTILFIYCRPNSGNKSMATDKVATVFYTVVIPMLNPLIYSLRNKDVKESLRKVVNFKTFS*
1118 >lcl|XP_003354439.1|Plus1complement(195891..196832) NW_003534386 olfactory receptor 5D18-like LOC100627003 __SEG__ Chr2 {Sus scrofa} MIPSERNKSGATFTLLGFSDSPELQVPLFLIFLAIYSVTAVGNLGMMLIIQINPKLHTPMYFFLSHLSFVDFCYSSIVAPKTMVNLVVEDRTISLVGCVIQFFFFCTFVV
TESFVLAVMAYDRFVAICNPLLYTVAMSPKRCVLLVMGSYAWGVACSLILTCSVTPLSFCGFNTINHFFCEFSALLSLACSDTSLNQLLLFIFATFNEVSTLFIILLSYV
FIVVTILKMPSATGRRRAFSTCASHLTAITIFHGTILFLYCVPNSQNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKDTISKIMDTNIFSH*
1119 >lcl|XP_003354440.1|Plus1302294..303238 NW_003534386 olfactory receptor-like protein OLF1-like LOC100627206 __SEG__ Chr2 {Sus scrofa} MEFADGNYTLVTEFILLGFPTRPELQFVLFLLFLTLYSMILMGNIGLMTLIRIDPHLQTPMYFFLSNLSFVDLCYSSVIVPKMLVNFLSENKSISYHGCALQFYFFCMFA
DTESFVLAAMAYDRYVAICNPLLYTVVMSRGICLWLVVLSYFGGNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTSLNELLLSTYGSSVEIICFVIIIISY
FFILLSVLKIRSSSGRKKTFSTCASHLTSVAIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAAKKVLRSKIDSS*
1120 >lcl|XP_003354441.1|Plus1complement(366818..367762) NW_003534386 olfactory receptor 5F1-like LOC100627303 __SEG__ Chr2 {Sus scrofa} MVRTNDTLLTEFVLLGLADTPELQVTLFLLFLVMYTLTVLGNVGMILLIRVDARLHTPMYFFLAVLSFVDVSYSSTVTPKMLADLLSEKKTISFAGCFLQMYFFIAFATT
ECILFGLMAYDRYVAICSPLLYSLIMSRSVCLQMAGGALTAGLLNSMVHTSYVSSLPFCKSNVIHHFFCDSPPIFKLSCSDTHLNETIFSTFAGMNMVGVLLLILTSYSY
ILFSILRMHSGEGRHKAFSTCASHLTALILFYSTAVYTYLRPTSSYSLNQDKVASVFYTVVIPMLNPLIYSLRNKEVKKALCNVITRKRVPSFL*
1121 >lcl|XP_003354443.1|Plus138533..39456 NW_003299635 olfactory receptor 2M2-like LOC100627769 __SEG__ Chr2 {Sus scrofa} MDIWNHTSLSDFILLGLFSYSPYEFFLFSLVLLASATALTGNIFFLLLIQADRRLHTPMYFFLSQLSIMDLTMMGTVVPKMAANFLLGSKFISWGGCATQVFLVVMVGGA
ECFLLAVMAYDRYVAVCHPLMYPVLMNWKACRLMALASWMGGVADSMIDVGVVFSFPYCSSLQVDHFFCEVPALLRLSCADTLLFEDLIYACCVVMLLLPLGVIVASYAR
ILMAVMRMPSTEGKQKALTTCSTHLAVVGLYYGGAIFSYMQRASARTPAGDRATSIFYTVLTPMLNPLIYSLRNKDVMRALKKVLSR*
1122 >lcl|XP_003354444.1|Plus1complement(79007..79945) NW_003299641 olfactory receptor 2L3-like LOC100622541 __SEG__ Chr2 {Sus scrofa} MENYTQTSTDFILLGLFPPSKIGMFLFILIVLIFLMALFGNLSMILLIYLDTQLHTPMYFLLSQLSFIDLNYISTIVPKMVSNFLSGNKSISFIGCGVQSFFFLILAVAE
ALLLTSMAYDRYVAICFPLHYPIRISRRVCVLMIIGSWIISSINSCAHTAYALHIPYCRSRAINHFFCDVPAMLTLACMDTWVYEYTVFVSTTLFLVLPFIIIACSYGRV
LLAVFHMNSAEGKRKAYSTCSTHLTVVTFYYAPFFYTYLRPRSHRSPTGDKALAVFYTILTPMLNPVIYSLRNKEVMEALRRVTQRIYFMKM*
1123 >lcl|XP_003354445.1|Plus1complement(176886..177797) NW_003299641 olfactory receptor 2T33-like LOC100622639 __SEG__ Chr2 {Sus scrofa} MENANDTTGINFILLGLFNHTQTHQFLFSIVLMTFLTSLMGNTFMILLIHVDPHLHTPMYFLLSQLSLMDMMLVLTIVPKMAVNYLMNTRSISPVGCGSQIFLLLTLGGG
ECFLLAVMAYDRYVAICHPLRYPILMNQKLCLHMTAGSWVLGGVDGLMQAGATLSFPYCHSREINHFFCEAPSLVRLACADTMIFEFFMYVCCILMLLIPLFLILASYSL
ILTAVLHMKSTATRKKAFATCSSHLAVVGLFYGTSIFIYMWPKSYHSVAYDKVVSAFYTVFTPMLNPLIYSVRNKEVDGALRK*
1124 >lcl|XP_003354446.1|Plus1complement(4836..5792) NW_003299641 olfactory receptor 2AJ1-like LOC100622735 __SEG__ Chr2 {Sus scrofa} MGPENHTFSSDFILLGLFSSSQKGLIFFSFIVIIFIMTVTENSVMILLIHKESRLHTPMYFLLSHLSFMDILHVSNIVPKMIINFLSGNRTISFAGCGFQIFLSLTLLGG
ECLLLAAMSYDRYVAICHPLRYPILMNDYVSILMAGGSWLIGTVNSIVHTAYTLHFPFCGSRAVDHFFCEFPAMLVLSCVDTTHYERGVYVSGIIFLLVPFSLIFASYVQ
ILLTVLQMKSSEAWKKSFSTCFFHMIVIIMYYGPFIFTYMKPKKYHIPGQDKFLAIFYTILTPSFNPIIYSIRNKDVLEAMKNMIKSNFLHKNSRENA*
1125 >lcl|XP_003354447.1|Plus1complement(110394..111332) NW_003299641 olfactory receptor 2T8-like LOC100623024 __SEG__ Chr2 {Sus scrofa} MENWNLTSDFILLGLLNHTGPHLFLFMMVLTIAFSSLVGNALMLLLILLDPQLHRPMYFLLSQLSLMDMMLVSTVVPKIAADYLTGRNSISPAGCGLQIFFFLTLGGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWQICLRMILGSWFLGAADGLMQSAATLTFSYCSSHEIDHFFCEAPSLVRLACADTSLFESVMYICCVLMLLVPISLILISYSLIL
ATVLQMRSNEARKKAFATCSSHLSVVGLFFGAAIFTYMRPKSYRSANHDKIVSAFYTIFTPVLNPLIYSLRNSEVKGALKKCIDQCVALNHD*
1126 >lcl|XP_003354450.1|Plus1complement(73671..74633) NW_003534387 olfactory receptor 2T4-like LOC100623714 __SEG__ Chr2 {Sus scrofa} MEDTTWMTNHTESTDFVLIGIFSQSKHPALLCVVIFVIFLMALSGNIILILLIHSDTHLHTPMYFFISQLSLMDMMYISVTVPKMLMDQVMGVNKISLPECGMQMFLYVT
LAGSEFFLLASMAYDRFVAICHPLHYPVLMNHRVCLLLAFGCWFLGSVDGFLFTPITMTFPFCRSREIHHFFCEVPAVLKLSCSDTSLYEIFMYLCCVLMLLIPVIIISG
SYYFILLTIHKMNSAEGRKKAFATCSSHMTVVILFYGAAIYTYMLPSFYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALKKTLNVGMVRQETIK*
1127 >lcl|XP_003354451.1|Plus1complement(88538..89500) NW_003534387 olfactory receptor 2T4-like LOC100623804 __SEG__ Chr2 {Sus scrofa} MENVNWETNHSGQSGFILVGIFSQSKHPTLLCVVIFIVLLMALIGNTVLIFLIHSDTHLHTAMYFFISQLSLMDVMYISVTVPKMLIDQAMGVNKISAPECAVQMFLYVT
LAGSEFFFLAAMAYDRYVAICHPLRYSVLMNHRVCLLLASGCWFLGSVDGFMLTPITMTFPFCRSREIHHFFCEVPAVMKLSCSDTSLYETLMYLCCVLMLLIPVTVISS
SYFFILLTIHRMNSAEVRKKAFATCSSHMTVVILFYGAAVYTYMLPNSYHTPEKDMVVSVFYTILTPVLNPLIYSFRNKDVMGALKKMLNVGPVHQETIK*
1128 >lcl|XP_003354452.1|Plus1120482..121507 NW_003534387 putative olfactory receptor 14L1-like LOC100623897 __SEG__ Chr2 {Sus scrofa} MANLTMSVTEFTLMGFSDIWEQQVLHAVLFLLIYLTALVDNFLIVLLTTLDQHLHSPMHFFLRTLSLLDICFISVTVPKAIIQSLTQNSSISFLGCVAQVFLVVSFACAE
LALLTVMSYDRYVAICQPLHYQVIMKKAHCEQMVFASWLSGIISGFLNTSVTFSLPFCRSNFVHQFFCEIPSLLKLSCSEKYLAEIGAIIVTTSLGIICFISILVSYKQI
FSTVMRIPSVKSRSKAFSTCIPHLVVVTVFLNTGSIAYLKPVSESPSVCDLMVSVFYTVVPPTLNPIIYSLKNKDMKAAFSKMLKRLSSYIMTRKTTTKTHTVPSDKHEA
TSVNSNRLPAI*
1129 >lcl|XP_003354453.1|Plus1complement(113450..114403) NW_003299642 olfactory receptor 2T11-like LOC100624358 __SEG__ Chr2 {Sus scrofa} MENRNSTSDFILLGLLVNNKATGVVFAGIFTIFVVAVTANLVMIFLIQVDSHLHTPMYFLLNQLSIMDTLFICTIVPKLLVDMVSKEKTISFVACGIQIFLCSTMIGSEF
FLLSLMAYDRYVAICNPLRYPVLMNHKVCLLLAAGAWFGGSLDGFLLTSVTMTFPYCGSRSINHFFCEIPAVLRLACADTSLYETLMYICCVLMVLIPISIISTTYTLIL
LTVHRMRSAEGRKKAFTTCSSHLTVVSFFYGASFYNYVLPKSFHTPEQDKVVSAFYTMVTPMLNPLIYSLRNKDVLGAFKKILAQFLSTQKVSTIYT*
1130 >lcl|XP_003354454.1|Plus1complement(151748..152701) NW_003299642 olfactory receptor 2T11-like LOC100624524 __SEG__ Chr2 {Sus scrofa} MENRNSTSDFILLGLLVNNKATGVVFAGIFTIFAVAVTANLVMIFLIKVDSRLHTPMYFLLSQLSIMDTLFICTTVPKLLVDMVSKEKTISFVACGIQIFLYLTMIGSEF
FLLGLMAYDRYVAVCNPLRYPVLMNRRVCLLLAAGAWFGGSLDGFLLTPVTMTFPYCGSRSINHFFCEIPAVLRLACADTSLYETLMYSCCVLMLLIPISIISTSYTLIL
LTVHRMRSVEGRRKAFTTCSSHLTVVSIFYGAAFYNYVLPQSFHTPEQDKVVSAFYTMVTPMLNPLIYSLRNKDVMGAFKKIFAQCLSIQNVSTIYA*
1131 >lcl|XP_003354530.1|Plus141362..42273 NW_003299656 olfactory receptor 14C36-like LOC100621207 __SEG__ Chr3 {Sus scrofa} MSNSTMVTEFLLISFADTWKIRVLYSMLFLFIYLATLLGNLLIVTVTTFDQKLNTPMYFFLRNLSISNVCYITVTVPNACVYFLTGNRTISLAACATQVFLVIYFAYVEI
LFLTVMAQDRYMAICQPLHYTITMNRKVCIQMTLVSLLSGLVYSGVHTGKTFQLTFCQSNVIHQFFCDVPSLLRISCSDTSSNFTLLLVSIIVVGGICFIFITVSYINIF
RTMLKFSIKEQGKAFSTCVPHIFVLTVFLSSIISVYLRPSVTSETINDMILSAFYTMVAPFLNPIIYSLRNTQIKEAVRRVIF*
1132 >lcl|XP_003354544.1|Plus1334565..336340 NW_003534412 frizzled-9-like LOC100625784 __SEG__ Chr3 {Sus scrofa} MAVPPLRRALLLWQLLAAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQAEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIP
ACRAMCKQARQRCALIMEQFNFGWPDSLDCARLPTRNDPHAFCMEAPENPRPALPSPTRGLGMLPVAPRPGRPPGDAAPGPGGGTCENPEKFQYVEKSRSCAPRCGPGVE
VFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLW
WVVLTLTWFLAASKKWGHEAIEAHGSYFHMVAWGLPALKTIVILTLRKVAGDELTGLCYVANMDAAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEK
LEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCSAATLPGGRRDCSLQDGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCHRKMAAGRA
RAKACRASGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL*
1133 >lcl|XP_003354578.1|Plus1880598..881578 NW_003534420 olfactory receptor 7A10-like LOC100626532 __SEG__ Chr3 {Sus scrofa} MEQENDTQFSDFILLGLSEEAAMQPLLFWLFLSMYLITLAGNLLIILTTIAASHLHTPMYFFLSSLSFSDICFISTTVPKMLLNLHIQDKSITYKGCLSQMYFFILFAEM
DIFLLSVMAYDRFVAICHPLRYATIMKPQLCGLLLLASWIMSLLDSLLRGLLVLRLSFCTDLEIPHYFCEINQVIQLACSDALLNVIEMYVATVLMGVIPLSGIAVSYSR
IVSSILRITSARGRYKAFSTCGSHLSVVCMFYGTGLGVYLSSATTPNSRARAFASVMYTVVTPMLNPFIYSLRNKDMKGALTSLVSTVTFSERSECFSWGRRSSHG*
1134 >lcl|XP_003354891.1|Plus1complement(248..577) NW_003534512 protein kinase C epsilon type-like LOC100626945 __SEG__ Chr3 {Sus scrofa} MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQTLRSHLSLV
1135 >lcl|XP_003355017.1|Plus1116215..117372 NW_003534572 G-protein coupled receptor 20-like LOC100620399 __SEG__ Chr4 {Sus scrofa} MGVLRGQVSQVGSSLQGHPISFLPGPGLALAAIMPSTSPAPNATAPAAWTNISMPEMPLFHRFALLDEELYAAFPGLWLALMAVHGVIFLAGLVLNGLALYVFGCRTRAK
TPSVIYTINLVVTDLLVGLSLPTRFAVFYGARGCPSCALPHVFGYFLNMHCSILFLTCICVDRYLAIVQPDGSRRWRQPACARAVCACVWLAAGAVTLSVLGVTATGGPC
CRVFALTVLEFLLPLLVISIFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLVIFLVCFTPFHARQVAVALWPDAPPRASLVAYHVAVTLSSLNSCMDPIVYCFVTSSF
QATVRSLFRRHGVEYEPNSCDAVSTLQSAKGPGHRHILSTRPQAPSRALANGPEA*
1136 >lcl|XP_003355108.1|Plus1complement(581294..582286) NW_003299858 neuropeptides B/W receptor type 1-like LOC100628123 __SEG__ Chr4 {Sus scrofa} MHNASSWGPGRLNTSCPGLELRCPNESVPPPPPLPPPLAVAVPVVYGVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAVADELFTLVLPINIADFLLRRWPFGELM
CKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYGAARAVSLAVWGFVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVST
ICVLYTTLLCRLRAIRLDSHAKVLDRAKKRVTILVAAILAACLLCWTPYHLSTVVVLTTDLPQTPLVIAVSYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLMTCRAAA
*
1137 >lcl|XP_003355164.1|Plus1171367..172308 NW_003534663 olfactory receptor 10R2-like LOC100625390 __SEG__ Chr4 {Sus scrofa} MANSSCVTEFFLLGFSSLGDLQLVLFVIFLCLYLIILSGNITIISVIRLDHSLHTPMYFFLCVLSTSETFYTIVILPKMLINLLSVLRTLSFVSCASQMYFFLGFAVTNS
LLLGVMGYDRYAAICQPLHYPILMSWRVCRQLAATCIVTGFLISLLGTSLVFSLPFCGSNRVNHYFCDISPVIRLACAETYINELVIFIGGVLVLVVPLICICISYGFIA
SAILKISSAEGKRKAFSTCASHLIVVIVHYGCASFVYLRPSAKYTSGKDRLVTVTYTVITPLLNPMVYSLRNKDVQLAIRKMLGKTGFSVKTS*
1138 >lcl|XP_003355165.1|Plus1complement(201734..202792) NW_003534663 olfactory receptor 6Y1-like LOC100625595 __SEG__ Chr4 {Sus scrofa} MGSINVNYHKLVLGTWKELILSVLTPQVITKVLEVGNRTVTTHFILLGFPTHPGFQMLLFFLFLATYLLTLLENFLIILAIRSDGQLHKPMYFFLSNLSFLEMWYVTVIG
PKMLVDFLSHDKTISFNGCMTQLYFFVTFVCTEYILLAVMAFDRYVAICYPLRYTVIMTNQLCGTLAAGCWFCGLMTAMIKMLFIARLHYCGTPRINHYFCDISPLLNVS
CEDSSQAELVDFFLALMVIAVPLCVVVASYATILTTILRIPSAQGRQKAFSTCASHLTVVILFYSTTLFTYARPKLMYAYNSNKVVSVLYTVIVPLFNPIIYCLRNREVK
AALKKTILCKRSGPREDGAVIN*
1139 >lcl|XP_003355166.1|Plus1complement(215705..216658) NW_003534663 olfactory receptor 6P1-like LOC100625691 __SEG__ Chr4 {Sus scrofa} MRNFSGDHVEGFVLVGFAASPPLQLLLFTLFLAMYLLTLLENAFIVSTIWLTASLHRPMYFFLGHLSFLELWYINVTVPRLLGAFLSQNRRVSYVGCMTQLYFFIALACT
ECVLLAVMAYDRYLAICEPLRYPSLMPSSMATRLAASSWGSGFFSSMMKLLFISRLSYCGPNIINHFFCDISPLLNLTCSDKEQAELVDFLLALVMILLPLLVVVSSYVA
IIAAILRIPTAQGRHKAFSTCASHLVVVVIYYSSTLFTYARPRAMYTFNHNKIISVLYTVIVPFFNPAIYCLRNKEVKDAFRKTVLGKCHYPRDVPD*
1140 >lcl|XP_003355167.1|Plus1complement(231604..232590) NW_003534663 olfactory receptor 10X1-like LOC100625789 __SEG__ Chr4 {Sus scrofa} MENLIFICCFFPISGIQRMKINHTILKEFILVGFSVYPHAQTLLFVVFFCLYLLTLTGNLAIMYLTWVDRCLHTPMYLFLSALSFSETCYTLTITPKMLSDLLTKNRGIS
VIGCGLQMYFFLGLGGTHSIILTLMGFDRFLAICNPLRYPLLMTNVVCGQLVASAWVAGFIISITETALIFRGSFCGPNLVKHFFCHMRAVVRLSCLDSELTELIVTAIS
VSALMGTFLLIILTYVFILSTVLRIPSAEGKQKAFSTCASHLTVVFIHFGFASIVYLKPGASGGDDTVIAVPYTVITPFLSPLIFSLRNKDMKNAFRKVLGKTSSLNK*
1141 >lcl|XP_003355170.1|Plus1complement(375046..375987) NW_003534663 olfactory receptor 10R2-like LOC100626599 __SEG__ Chr4 {Sus scrofa} MANSSCVTEFFLLGFSSLGDLQLVLFVIFLCLYLIILSGNITIISVIRLDHSLHTPMYFFLSVLSTSEIFYTIVILPKMLVNLLSVLRTLSFVSCASQMYFFLGFAVTNC
LLLGVMGYDRYAAICQPLHYPILMSWRVCGQLAATCIVNGFLISLVGTTLVFSLPFCGSNKVNHYFCDISPVIHLASAETYINQLVIFICGILVLVVPLTCICISYGFIV
STILKIPSTEGKQKAFSTCASHLIVVIVHYGCASFVYLRPSAKYTTGKDRLVTVTYTIITPLLNPMVYSLRNKDVQLAIRKMIGKTGFSVKTL*
1142 >lcl|XP_003355171.1|Plus1401336..402280 NW_003534663 olfactory receptor 10R2-like LOC100626697 __SEG__ Chr4 {Sus scrofa} MKRQNQSAITEFILLGFSNLGHLQILLFFIFLLVYLTTLMVNATIMTVIRLDRALHTPMYFFLFVLSCSETCYTLVIMPKMLTNLLSTSLTISFSACAAQLYFFVGLACT
NCFLIAAMGYDRYVAICNPLNYTLIVSRATCMQLVFASTLCGFLISVVVNVLVFSVPFCASNRINHFFCDISPVIKLGCTDTNQKEMVIFFLSILVLLVPFVLIFISYVF
IVSTILKISSVEGQHKAFATCASHLTVVIVHYGCASFIYLRPTSLYSSDKDRLVAVTYTVITPLLNPLVYTLRNKEVKMALRKVLSRYSFPKTI*
1143 >lcl|XP_003355173.1|Plus1complement(540145..541086) NW_003534663 olfactory receptor 10K1-like LOC100627086 __SEG__ Chr4 {Sus scrofa} MEWVNETTVRQFVFLGFSSLAGLQKLLFVVFLLVYLFTLGTNAIIISTIVLDRALHTPMYFFLGVLSCSETCYTFVIVPKMLVDLLAQKKTISFRGCAIQMFSFLFLICS
HSFLLAAMGYDRYVAICNPLRYTVLMGYGVCVGLVAAACACGFIISLVTTSMIFHLPFHSSNQLHHFFCDVSPVLKLASHHSHLIQLVIFVLGVFVLVIPLLLILVSYVL
IISAILKIPSSVGRYKAFSTCASHLIVVTVHYGCASFIYLRPKSNYSSSQDTLISVSYTILTPLLNPMIYSLRNKEFKSALRKAMVQTSYPTN*
1144 >lcl|XP_003355218.1|Plus1976119..977180 NW_003534667 c2 calcium-dependent domain-containing protein 4D-like LOC100622378 __SEG__ Chr4 {Sus scrofa} MWLLEKAGYRVGAAESRARWAPSSLFPKRRTPGQLARACPNVLTPDRIPQFIIPPRLSDPGGAEPPGGRDAGGRGLPTACSLPHLAGREGWAFLPESPHTRRRESLFHSP
PPAPAGGLSPAQSRLHVSAPDLRLCRAPDSDTASSPDSSPFGSPRPGPDRPRPPRPCSLSPEEASSADTSPYTPRRAGPPTPPLFHLDFLCCQLRPTKESVLRLEPRGGQ
LRFSAEYQAAHGRLRLRLVSAEGLPEPRAGPGCGGGGCCVVLRLRPRVRPRGQRSRVVKCSANPIFNEDFFFDGLGPPDLATRSLRAKVLDRGAGFRRDVLLGECETPLI
ALLPPLGGGLGPGTSLAPAHLSL*
1145 >lcl|XP_003355221.1|Plus11016915..1018696 NW_003534667 leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4-like LOC100622649 __SEG__ Chr4 {Sus scrofa} MAVATVPKHAWPPWPPLLFLLLLPAGSSGGCPAVCDCTSQPRAVLCAHRRLEAVPGGLPLDTELLDLSGNRLWGLQRGMLSRLGLLRELDLSYNQLSTLEPGAFQGLQSL
LTLRMQGNRLRIMGPGVFSGLSALTLLDLRLNQLVLFLDGAFRELGSLQQLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGLALARLPALVALRLRELDIERLP
AGALQGLGQLKELEIHHWPSLEALEPGSLAGLNLSSLAITRCNLSSVPFQALHHLSFLRVLDLSQNPISAIPARRLSALVRLQELRLSGACLTSIAAHAFHGLTAFHLLD
VADNALQTLEETAFPSPNKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTTPPACAGPQHVQGKSLREFSDILPPGHFTCQPALIRKSGPRWVIAEEGGHAVFSCSGDGD
PAPTISWMRPQGAWLGRAGRVRVLQDGTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITMPGIPGPFFLDSRGVAMVLAVGFLPFLTSVTLC
FGLIALWSKGKGQVKHHMTFDFVAPRTSGDKNSGGNRVTAKLF*
1146 >lcl|XP_003355483.1|Plus1complement(823..1758) NW_003534750 olfactory receptor 6C3-like LOC100623545 __SEG__ Chr5 {Sus scrofa} MNHTVITEFVLLGLSDDPDLQVVILLFLFVTYVSSVTGNLTIITLTLVDPHLQTPMYFFLRNFSFLEISFTTVCIPRFLGAIITRDKTISYHNCAAQLFLFIFMGVTEFY
ILTTMSYDHYVAICKPLHYTTIMNRKLCILLVLCAWLGGFLTIFPPLMLLLQLDYCASNVIDHFACDYFPLLQLSCSDTWLLEVIGFYLALVTLLFTLALVILSYMYIIR
TILRIPSANQRKKAFSTCSSHMIVISISYGSCIFMYASPSAKEKASLAKGVAILNTSVAPMLNPFIYTLRKQQVKQAFKDMLYKAVFSAKK*
1147 >lcl|XP_003355485.1|Plus1complement(863..1801) NW_003534752 olfactory receptor 6C68-like LOC100627116 __SEG__ Chr5 {Sus scrofa} MGNHTAITTFILLGLTEDPQLQLLLFLFLFLTYILCVTGNLTIITLTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYNISTGDRTITYNACFTQLFFTYLFGITEF
FLLATMAYDRYVTICKPLHYMTIMSTTLCKTMVVCCWGAALLIILPPLSLDFQLEFCDSNLIDHFACDVSPLLKISCSDTWLIEQMVIASAVLTFIITLVGVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPVLNPFIYTLRNKQVKQAFQDTLKKTALLLRK*
1148 >lcl|XP_003355486.1|Plus1complement(19547..20485) NW_003534752 olfactory receptor 6C68-like LOC100627212 __SEG__ Chr5 {Sus scrofa} MGNHTAITTFILLGLTEDPQLQLLLFLFLFLTYILCVTGNLAIIILTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYNISTGDRTITYNACFTQLFFTDLFGITEF
FLLATMAYDRYVAICKPLHYMTIMSNTLCKTMVVCCWGAALLIILPPLSLDFQLEFCDSNVIDHFACDVSPLLKISCSDTWLIEQMVMACAVLTLIITLVGVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPMLNPFIYTLRNKQVKQAFHDALKKTAFLLRK*
1149 >lcl|XP_003355487.1|Plus1complement(37847..38785) NW_003534752 olfactory receptor 6C68-like LOC100627311 __SEG__ Chr5 {Sus scrofa} MRNHTAITTFILLGLTEDPQLQLLLFLFLFLTYILCVTGNLTIITLTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYNISTGDRTITYNACFTQLFFTYLFGITEF
FLLATMAYDRYVTICKPLHYMTIMSTTLCKTMVVCCWGAALLIILPPLSLDFQLEFCDSNLIDHFACDVSPLLKISCSDTWLIEQMVIASAVLTFIITLVGVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPVLNPFIYTLRNKQVKQAFQDSLKKTALLLRK*
1150 >lcl|XP_003355488.1|Plus1complement(139347..140285) NW_003534752 olfactory receptor 6C75-like LOC100627407 __SEG__ Chr5 {Sus scrofa} MRNYTEVTEFILLGLTDDPQWQAVLFTLLLVTYMLSVTGNLTIIALTLSDPHLQTPMYFFLRNFAFLEISFTSVCIPRFLVTLVTGDRTISYDGCVAQLFFLIFLGVTEF
YLLAAMSYDRYVAICKPLHYTIIMSSRVCALLVFSSWLAGFLIIFPPIILLLQLEFCASNIVDHFICDASPILQLSCSSTRLLELMAFFLAVVTLMVTLTLVILSYTYIV
RTILRLPSTSQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFRNMVQRRAFSSNQ*
1151 >lcl|XP_003355489.1|Plus1complement(167707..168639) NW_003534752 olfactory receptor 6C1-like LOC100627493 __SEG__ Chr5 {Sus scrofa} MKNHTEITEFILLGLSDDPQLQVMVFVFLLITYLLSITGNLTIITLTLLDPHLQTPMYFFLRNFSLLEVSFTTVTIPKFLSTIISGDKTISFNDCMAQLFFLILLGVAEF
YLLAAMSYDRYVAICKPLHYLAIMNQRVCVLLVFSSWLVSFLIIFPSLMLFLNLDYCKSNIIDHFTCDYFPLLQLSCSDTKFLEMVGFSFAVFILLFTLALIILSYVYII
RTIVRIPSTSQRTKAFSTCSSHMIVISISYGSCIFMYIKPSAKDRVSLSKRVAMLNTSVAPMLNPFIYSLRNQQVKRAFMDLARKVCIFF*
1152 >lcl|XP_003355490.1|Plus1complement(60719..61672) NW_003534752 olfactory receptor 6C68-like LOC100627871 __SEG__ Chr5 {Sus scrofa} MGNHTAITTFILLGLTEDPQLQLLLFLFLFLTYILCVTGNLTIITLTLLDPHLKTPMYFFLQNFSFLEISFTTACIPRFLYNISTGDRTITYNACFIQLFFTDLFGVTEF
FLLATMACDRYVAICKPLHYMTIMSTTLCKTMAVCCWGAALMIILPPLSLGFHLEFCDSNLIDHFACDASPLLKISCSDTQLIEQMVIASAVLTFIITLVCVVLSYINII
RTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNLNKGVALLISSISPMLNPFIYTLRNKQVKQAFHDSLKKNCISFKKVKCIS*
1153 >lcl|XP_003355491.1|Plus1complement(112658..113599) NW_003534752 olfactory receptor 6C76-like LOC100620182 __SEG__ Chr5 {Sus scrofa} MRNRTSVTEFILLGLTDNPELQAVIFFFLLLTYVLSVTGNLTIIVLTLLHSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTGDKSISYNACAAQLFFFILLGSTEF
FLLASMSYDRYVAICKPLHYPTIMSHKVCYQLVGSSWLAGFLVIFPPLTMGLQLDFCDTNVINHFTCDSAPLLHISCTDTSTLELMSFALAVLTLMSTLTLVILSYCYIL
RTMLRIPSAQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALTKGVAVLNTSVAPMLNPFIYTLRNQQVKQAFKDLTRKILSSKTLT*
1154 >lcl|XP_003355492.1|Plus1complement(119035..119973) NW_003534752 olfactory receptor 6C65-like LOC100620277 __SEG__ Chr5 {Sus scrofa} MPNKTTIREFILLGLTDDPELQAVIFFFMLFTYLLSVSGNMTIIMLTLSNVCLKTPMYFFLRNFSFLEISFTTVCIPRFLISISTGDTTISYNACMTQVFFSILLGSTEF
FLLAVMSYDRYVAICKPLHYTTIMSHKVCHQLVISSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFACDSSPMLLIACTDTKFLEFMAFFLAVFTLMVTLALVILSYTLIL
RTILKIPSGQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALSKGVAVLNTSVAPMLNPFIYTLRNQQVRQALKDITQKMLLSNKH*
1155 >lcl|XP_003355493.1|Plus1complement(128926..129861) NW_003534752 olfactory receptor 6C76-like LOC100152666 __SEG__ Chr5 {Sus scrofa} MKNQTSVNEFILLGLTDDPELNVLIFLFLFFTYILSITGNLTIITLTLIDSHLKTPMYFFLRNFSFLEISFTTVCIPRFLVSIVTGDRAISYHSCMAQVFFFILLGATEF
FLLTAMSYDRYVAIWKPLHYMTIMNSRICNQLVVSSWLVGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPMLLISCTDTAFLELMAFFLATFTLMVTITLVILSYAFIL
KTILRIPSAEQRKKAFSTCSSHIIVVSISYGSCIFMYVKTSAKEGMVMTKGIAVLNTSVAPMLNPFIYSLRNQQVKESFKKLVKKCFLDKF*
1156 >lcl|XP_003355495.1|Plus1168106..169041 NW_003299923 olfactory receptor 6C2-like LOC100524864 __SEG__ Chr5 {Sus scrofa} MKNHTITTFILLGLTDNPQLQIPIFMFLFLTYMLSITGNLTIISLTLVGSHLKTPMYYFLQNFALLEISFTTACIPRYLYNITTGDRSITYNICVIQVFFTDVFGVTEFF
LLAAMSYDRYVAICKPLHYMSIMNSRVCRRLVLCCWISGLLIILPPLTLFLDLKFCDSNVIDYFFCDASPILKISCSDTWLIEQLVIVCAVLTFILTLVCVVLSYLYILK
TILRFPSAQQRKRAFSTCSSHMIVVSITYGSCIFIYIKPSAKESVAINKAVTLLMTSIAPMLNPFIYTLRNKQVRRALSDSFKKLALIAKK*
1157 >lcl|XP_003355496.1|Plus1586201..587136 NW_003299923 olfactory receptor 6C2-like LOC100621974 __SEG__ Chr5 {Sus scrofa} MRNYTITTFILLGLTDDPELQVLIFIFLCLTYTMSVTGNLTIITLTFVDSHLKTPMYFFLKNFSFLEISFTTACVPRYLYTIATGDNIITYNACVIQVFFTDLCAVTEFF
LLATMSYDGYVAICKPLHYVATMSSRVCQRLVFCSWVAGLLVIISPLSLGLNLEFCDSNVVDHFLCDASPLLKISCSDTWFMEQTVFICAVLTLILTLMCVILSYMYIMK
TILGFPSAQQRRKAFSTCSSYMTVVSITYGTCMFIYMNPTAKEEVTTNKVASLLISSISPTLNPFIYTLRNKQVKKAFNDSIKRIASLFKK*
1158 >lcl|XP_003355497.1|Plus1626308..627246 NW_003299923 olfactory receptor 6C2-like LOC100622050 __SEG__ Chr5 {Sus scrofa} MMRNQTITAFILLGLTDDPQLQIPIFMFLFLTYMLSVTGNLAIISLTLVDSHLKTPMYFFLQNFAFLEISFTSACIPRYLYNIATGDRSITYNICVIQVFFIDALGVTEF
YLLATMSYDRYVAICKPLHYVAIMNSRVCRRLVLCCWTAGMLIILPPLIMIVNLEFCDSNVIDYFFCDASPILKISCSDTWLLEQMVIACAVLAFITTLLCVVLSYVYIL
KTILRFPSAQQRKRAFSTCSSHMIVVSITYGSCIFIYIKPSAKESVAINKAVTLLMTSIAPMLNPFIYTLRNKQVRRAFRDSFKRITFPSKK*
1159 >lcl|XP_003355498.1|Plus1638227..639165 NW_003299923 olfactory receptor 6C75-like LOC100622143 __SEG__ Chr5 {Sus scrofa} MRNHSVQTEFVLLGLTDDPVWQIVIFLSLSVTYMLSVTGNLTIIILTLLDSHLKTPMYFFLRNFSFLEISFTTSCIPRFLKSLVTKDRTISYMSCMAQLFFYFFLGVTEF
YLLAAMSYDRYAAICKPLHYTTIMSSKVCYQLVLSSWATGFLLIFPPVILALKLEFCDSNVIDHFICDSSPILQISCSDTHFLELMSFLLAVVTLMVTLTLVILSYGSII
KTILKSPSAQQRTKAFSTCSSHMIVVSISYGSCIFMYIKPSANDRVTLSKGVAMLHTSVAPLLNPFIYTLRNQQVKQAFKDMVQKFLFGSNK*
1160 >lcl|XP_003355499.1|Plus1288317..289255 NW_003299923 olfactory receptor 6C2-like LOC100511632 __SEG__ Chr5 {Sus scrofa} MRNHTVITTFILVGLTEDPELQVLIFIFLFLTYVLSVTGNLTIIILTLTDSHLKTPMYFFLRNFSFLEISFTTVCIPRFLYSISSGDNTITYNACASQIFFIGLFGATEF
FLLAAMSYDRYVAICKPLHYMSIMNGRVCTILILCCWTSGLMIIITPLSVGLQLEFCDSNAIDHFGCDASPLFKISCSDTWFIEQMVIICAVVTFIITLIGVVLSYIYII
RTILRFPSASQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVDINKGVSVLTTSIAPLLNPFIYTLRNKQVKQAFNDTIKKIAFTLHK*
1161 >lcl|XP_003355500.1|Plus1418993..419931 NW_003299923 olfactory receptor 6C2-like LOC100512534 __SEG__ Chr5 {Sus scrofa} MRNHTVITTFILVGLTEDPELQVLIFIFLFLTYVLSVTGNLTIIILTLTDSHLKTPMYFFLRNFSFLEISFTTVCIPRFLYSISSGDNTITYNACASQIFFIGLFGATEF
FLLAAMSYDRYVAICKPLHYMSIMNGRVCTILILCCWTSGLMIIITPLSVGLQLEFCDSNAIDHFGCDASPLFKISCSDTWFIEQMVIICAVVTFIITLIGVVLSYIYII
RTILRFPSASQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVDINKGVSVLTTSIAPLLNPFIYTLRNKQVKQAFNDTIKKIAFTLHK*
1162 >lcl|XP_003355501.1|Plus1476325..477260 NW_003299923 olfactory receptor 6C2-like LOC100625596 __SEG__ Chr5 {Sus scrofa} MRNRTITTFILLGLTDDPKLQVLIFIFLFVAYMLSLTGNLTIITLTFVDSRLKTPMYVFLKNFSFLEISFISSCIPRYLYSIATSDKVITYNACVIQVFFTDLCGVTEFF
LLAAMSYDRYVAICKPLHYVTIMSSRVCGILISSCWMAGLCVLIPPLSLGLNLKFCDSNRLDHFGCDAFPLVKISCSDTWPMEQSVIICAVLTLNMTLTCVVLSYAYIIS
TIFRFPSVHQRKKAFSTCSSHMIVVSITYGTCIFIYMNPTAKGEVTINKVVSLLVTSLSPTLNPFIYTLRNNQVKKAFKDSIKRIALVSTM*
1163 >lcl|XP_003355502.1|Plus1complement(646649..647587) NW_003299923 olfactory receptor 6C2-like LOC100626504 __SEG__ Chr5 {Sus scrofa} MRNHTSLTRFILLGLTDDPHMQILIFLFLLLTYMLSLTGNLIIILLILVDSHLKTAMYFFLQNFSFLEISFTSACIPRFLYSISTGDRAITYNACACQLFFTDVFAVTEF
FLLATMSFDRYVAICKPLHYVTIMNHRVCRRIVFCCWMATLLIISPPFSFGLALEFCDSNVIDHFVCDVNPLLKIACSETRFIEQMTLAGTVLIFILTLVCVVLSYVYII
RTILGFPSAQQRTKAFSTCSSHIIVVSITYGSCIFVYIKPSAKDEMTINKGVTILTTSISPMLNPFIYTLRNKQVKQAFNDLVQRIISLSKN*
1164 >lcl|XP_003355503.1|Plus1661987..662922 NW_003299923 olfactory receptor 6C2-like LOC100626601 __SEG__ Chr5 {Sus scrofa} MKNHSAITSFILLGLTDDPRLQVFLSVFLFLTYIFTVVGNLVIILLTLVDSHLKTPMYFFLRNFSILEILFTTVCVPRFLYSMTTGDKSVTYNACAIQLFFIILIGATEF
FLLTAMSYDRYVAICKPLHYTAIMNGRICTVLVLGCWLIGLIVILPPLSLGVQLDFCDSNLLDHFGCDASPLLKIVCSDTQYVEQLVLIMAVLTLMVTLVCVIVSYTYII
KSILRLPSAQQRKKAFSTCSSHIIVVSITYGSCIFIYIKPAKEGVAINKAVSLLNTSVIPLMNPFIYTLRNKQVKQAFRDLIKKMAFLSKN*
1165 >lcl|XP_003355541.1|Plus1complement(605979..>606704) NW_003534754 inhibin beta C chain-like LOC100620084 __SEG__ Chr5 {Sus scrofa} TRLDFHFPSDRTSGSLEVQQASLMFFVQLPPNATWTLKVRVLELGPHGTNLTLATQHPLEVNNSGWHQLLLGPEAEAAYSQGHLILELVPEGQVAWNSVILDGAAHRPFV
TARVRVGDKHRVRRRGIDCQGRSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCTGHCPLHVAGVPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYD
KDSNIVKTDIPDMVVEACGCS*
1166 >lcl|XP_003355679.1|Plus1716675..717973 NW_003534830 protein FAM113B-like isoform 1 LOC100510964 __SEG__ Chr5 {Sus scrofa} MVHLWTADVQQLLHNKFVVILGDSVQRAVYKDLVLLLQKNDLLTLSQLKAKGEHSFEQDRLVSGGQQGRMHNGIQYREVRQFCSDHHLVRFYFLTRVYSDYLEDILEELQ
SGEHAPDLVIMNSCLWDLTRYGEDSWPSYLRNLESLFGRLHHVLPESCLFVWNTAMPVGDNITSGFIPPELRATASLHLKIQVIEANFYSSAEAQKQGFDVLDLHFHFRR
HTEKHLQPDGVHWNECAHRHLSQLLLAHVADAWGVELPQRNSVSKWIKGGPARGRAGGRWDRQPQAFPPPRPLPLRGRGPLLPLPAPHSVRFPVPPPPPHPFPSRQVMPP
FVPYRQDACFSSDHHFQEDPFSLNHFHSGASPSTQTEFAFEADFVFGPQPPMPPLPLPSQQCAPVVHRGFPRYHPRGPYMPRRGPPRPSRRRAPAHPEPKPQ*
1167 >lcl|XP_003355695.1|Plus170609..71544 NW_003534834 olfactory receptor 8S1-like LOC100622380 __SEG__ Chr5 {Sus scrofa} MALRNHSIITKFILSGLSDNPHIQALLFLLFLGIYLLTLMGNLTMMLVIRADSHLHTPMYFFLSNLSFLDFCFSSVTVPKLLGDLLSEKKTISVEGCLAQVFFVFLTAGN
EACLLSVMAYDRYAAICHPLLYGQVMSSQLCKGLVWGSWGLASLNAVIIVFLALNLDFCDAQTIHHYTCELPSLFPLSCSDTSINISILSFSTIFLGLGNFLPIFFSYAR
IIFNILSISSTTGRSKAFSTCSSHLIAVILYFGSGMVRYLMPPSGSFLDLLSSLQYSVITPMLNPLIYSLKNKEVKTAVKRTLGKCLQYFR*
1168 >lcl|XP_003355696.1|Plus195525..96463 NW_003534834 olfactory receptor 8S1-like LOC100622479 __SEG__ Chr5 {Sus scrofa} MALRNHSTITEFILIGLSDDPHIEALLFVLFLGIYLLTMRENLMILLIIRADSHLHTPMYFFLRNLSFVDLCFSCVTLPKLLEDLLSEEKTISVEGCLAQVFFVFLTAGN
ETCLLSVMAYDHYAAICHLLLYGQVMSNQLCVRLVLISWGLASLDAVIIVLLAINLDFCEAQTIYHYTCELPSLLPLSCSDVSIYIDILICSILLHGLGTFLPIFFSYTR
IVSTILGISSTTGRSKAFSTCSSHLIAVILFFGSGMLRYLMPPSGSSLDLLFSIQYSVITPMLNPLIYSLKNNEVKTAVKRTLRKYRQYFMV*
1169 >lcl|XP_003355697.1|Plus1114065..115003 NW_003534834 olfactory receptor 8S1-like LOC100622582 __SEG__ Chr5 {Sus scrofa} MALRNHSSITEFILIGLSNDPHVETLLFVLFLGIYLLTIIGNLTMLLVIRADSSLHTPMYFFLSNLSFLDLCFSSVTVPKLLEDLLSEEKTISVEGCLTQVFFVFITAGT
EAFLLSVMAYDRYAAICHPLLYGQVMSIQLCVRLVLISWGLASVNASVIVLLAINLDFCDAQTIHHYTCELPSLFPLSCSDISINIDILICLILLHGLGTFLPVFFSYVR
IVSTILSISSTTGRSKAFSTCSSHLIAVILFFGSGLVRYLMPTSGSPLDLLSSLQYSAVTPMLNPLIYSLKNMEVKAAVKRTWEKYLQYFRL*
1170 >lcl|XP_003356139.1|Plus1160331..161269 NW_003534966 olfactory receptor 5-like LOC100623415 __SEG__ Chr6 {Sus scrofa} MERSVKVGNMTRVQEFVLLGLSTRLDIRDVLFVTFLALYLLTLLENTLIVFLICSHTDLHKPMYFFLGNLSCLEMCYVSVTTPSLLVGLWTGPFHISFTACMTQLFFFVS
LICTECTLLASMAYDRYVAICRPLHYPLLMRPQVCLSLAMTSWTGGMLVSVIKTACIASLSYCGPNVLNQFFCDVSPLLNLSCTHVALTELVDFISAIVIFCGTLLVALA
SYSAIGLTVLRMPSAAARHKAFSTCASHLVVVGIFYSAALFIYCRPSRIKSMDLNKVLSVIYTVATPLCNPIIYCLRNKEVHAVLQKTLHWP*
1171 >lcl|XP_003356140.1|Plus1complement(375167..376105) NW_003534966 olfactory receptor 5-like LOC100623518 __SEG__ Chr6 {Sus scrofa} MERSLKVGNMTRVQEFVLLGLSTRLDIRDVLFVTFLALYLLTLLENTLIIFLICSHTDLHKPMYFFLGNLSCLEMCYVSVTTPSLLVGLWTGPFHISFTACMTQLFFFIS
LICTECTLLASMAYDRYVAICRPLHYPLLMRPQVCLNLAMASWIGGLLVSVAKTTCIASLSYCGPNVLNQFFCDVSPLLNLSCTHVALTELVDFISAIVIFCGTLLVALA
SYSAIGLTVLRMPSAAARHKAFSTCASHLVVVGIFYSAALFIYCRPSRIKSMDLNKVLSVIYTVATPLCNPIIYCLRNKEVHAVLQKTLHWP*
1172 >lcl|XP_003356142.1|Plus1146606..147601 NW_003534966 olfactory receptor 10A7-like LOC100623725 __SEG__ Chr6 {Sus scrofa} MPAAWAPPGAPAAPPWANLSSAGQFVLLGFAHVPALRPPLAALFLPAFLLALLGDALIVLLPALDAGLRAPMYFFLRQLALVEMCFSLDVVPRLLGTLLRPGRGVSPAGC
ALQLLLVLSCVSSECFLLTAMAWDRYVAICRPLRYGAIVSPRLCHRLAAACWLAGAPVALVFTVWLFRFPFCGPRGIRHFFCDIAPLLSLVCADTRVFEDNVLVATVLVI
MVPFCLIATSYAQILATVLRMPSARGRRKALSTCASHLIVVVLFYGTTGVIHLRPKASYSPESKQVVSLSYTLVTPMLNPLIYSLRNKEVKAALRRVCCHHLGSGPREGP
P*
1173 >lcl|XP_003356144.1|Plus1169900..170874 NW_003534966 olfactory receptor 5-like LOC100623905 __SEG__ Chr6 {Sus scrofa} MERSLDLANMSRVQEFILLGLSARQGIRDVLFVVFLALYLLTLLENTLIVFLICSHTDLHKPMYFFLGNLSCLEMCYVSVTMPSLLVGLRASPCHVPFAVCIIQFFLFIS
LIGTKCTLLASMAYDRYVAICRPLHYPLLMRPQVCLSLAMTSWLGGLLVSVVKTTCIASLSYCGPNVLNHFFCDVSPLLDLSCTHVALTELVDFISAILTFCGTLLIALG
SYAAIGRAVLRMPSATARCKAFSTCASHLVVVGIFYSVVLFVYSRPSRVEPTNLNKVLSIIYTVATPICSPIVYCLRNREVHAALQKTLHPRRVSSGSAHVSCS*
1174 >lcl|XP_003356145.1|Plus1complement(176701..177639) NW_003534966 olfactory receptor 5-like LOC100624006 __SEG__ Chr6 {Sus scrofa} MERSLKVGNMTRVQEFVLLGLSTRLDIRDVLFVIFLALYLLTLLENTLIVFLICSHTDLHKPMYFFLGNLSCLEMCYVSVTTPSLLVGLWTGPFHISFTACMTQLFFFIS
LICTECTLLASMAYDRYVAICRPLHYPLLMRPQVCLNLAMASWIGGLLVSVAKTTCIASLSYCGPNVLNQFFCDVSPLLNLSCTHVALTELVDFISAIFILWGSLLVAIA
SYSAIGLTVLRMPSAAARSKAFSTCVSHLVVVGIFYSATLFIYARPSRIKSMDLNKVLSVVYTVATPLCNPVIYCLRNKEVQAALQKMLHWR*
1175 >lcl|XP_003356147.1|Plus1complement(453794..454768) NW_003534966 olfactory receptor 5-like LOC100624370 __SEG__ Chr6 {Sus scrofa} MERSLDLANMSRVQEFILLGLSARQGIRDVLFVVFLALYLLTLLENTLIVFLICSHTDLHKPMYFFLGNLSCLEMCYVSVTMPSLLVGLRASPCHVPFAVCIIQFFLFIS
LIGTKCTLLASMAYDRYVAICRPLHYPLLMRPQVCLSLAMTSWLGGLLVSVVKTTCIASLSYCGPNVLNHFFCDVSPLLDLSCTHVALTELVDFISAILTFCGTLLIALG
SYAAIGRAVLRMPSATARCKAFSTCASHLVVVGIFYSVVLFVYSRPSRVEPTNLNKVLSIIYTVATPICSPIVYCLRNREVHAALQKTLHPRRVSSGSAHVSCS*
1176 >lcl|XP_003356216.1|Plus1400919..403309 NW_003534986 kelch domain-containing protein 7A-like LOC100622416 __SEG__ Chr6 {Sus scrofa} MLPRGGGAEAQDWHLDMQLTGKVVLSAAALLLVTAAYRLYKSRPAPAPLGGRNTKAGKETEGSGQPAGQGAVSRLPQQGLKRRRGSKGAGVPRGCSWENPGGSGVLATEV
PSKDSEAGETGKSETEGAGEEHGRQCPDADLAKTPRGGREARTPVGGKPELSNCPALCSEPQSSPTGLIAVDSGHGVGGKPPPWQESGPPEQPGPGGLESPHQGWVAHTE
GKSDMNKSWVFTHVTGVHREEAGALRAASDVDLALYQQQGATDASYTFSSVARVRVEENFIAAEKAEGIRPRLKGKVYDYYVESTSQATSRDRLAPRTAALAESPPPVSV
PGPPGTGAASGGQADDRAGRAETTAPLPPVLPSSTQGFSRKESLLQIVENPELQLQLDGFGDRALACPDQSALLRCPISSESLGSSSAGSSEKPQVHAVAGTNFFYVPLI
PGSAPDVHLDLGNCYEVLTLAKRQKLEALKEAAYKVMSDNYLQVLRSPDIYGCLSGAERELILQRRLRGRKHLVVADICPQEDSSRLCCYDSEQDAWHPLARLPPEAVSR
GCAICSLFNYLFVVSGCQGSGHQPSNRVFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLYTVERYDPRLDRWTFAPPLPNDTFALAHTATACAGEIFVTGG
SLRYLLLRFSAQEQRWRAGPTGGGKDRTAEMVAVNGFLYRFDLNRSLGISVYRCSASARLWYECATYRTPYPDTFQCAVVDHLIYCVGRQRILCFLADSVSPRFVPEELQ
NFPSPQGTLVPTVLTLPGPDVPQTRV*
1177 >lcl|XP_003356246.1|Plus18958..10040 NW_003534994 cannabinoid receptor 2-like LOC100621002 __SEG__ Chr6 {Sus scrofa} MEICWKIEAANGSRDDLDFNPLKDYMVLSSSQKIAIAVLCTPLGLLSALENLVVLYLILSSHRLRRKPSYLFISSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKI
GSVTMTFTASVGSLLLTAIDRYLCLCYPPTYKALLTRRRALVALGIMWALSALVSYLPLMGWTCCPRPCSELFPLLPNDYLLGWLLLIAVLFSGIIYTYGHVLWKAHQHV
ASLAEHHNRQVPGMARMRLDVWLAKTLGVLLAVLFICWLPALTLMVYSLASPLSEQVRKVFAFCSLLCLVNSMVNPIIYALRSGEIRSSAHHRLARWKKHLSCLGPDGKE
EFPRSSITETEADGKITQGPASRELYCSDS*
1178 >lcl|XP_003356385.1|Plus1complement(424412..425389) NW_003535019 melanocortin receptor 5-like LOC100622278 __SEG__ Chr6 {Sus scrofa} MNSSFHLHFLDLQLNATEGNVSGPSVGNTSSPCEDMGIEVEVFLTLGLISLLENILVIGAIARNKNLHVPMYFFVCSLAVADMLVSLSNSWETITIYLIANKHLVLSDTS
VRHLDNVFDSMICISLVASMCSLLAVAVDRYVTIFYALRYQHLMTGRRCGAIIAGIWALCTGCGPVFIVYYESTYVVVCLVAMFLTMLLLMASLYAHMFLQARAHVRRIA
ALPGYRSARQRTSMKGAVTLAMLLGVFIVCWAPFFLHLILMISCPQNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQEMRKTFRELICLHGFLAACRFPSRY*
1179 >lcl|XP_003356629.1|Plus1complement(30089..31027) NW_003535165 putative olfactory receptor 2B8-like LOC100625635 __SEG__ Chr7 {Sus scrofa} MEQRNGSSFTGFILLGFSDRPQLEQVLFVVLLTFYIFTLLGNTTIIALSHVDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLRGSDKSISFGGCVVQLCLALGLGGA
ECILLGVMALDRYAAVCKPLHYTVIMHPCLCALMACASWITGFANSVLQTVLIFLLPLCGRNELDHFFCEVPPLLKIACVDTTVNESEIFFVSVIILLVPVALITFSYSQ
IVRAVLRIKSSAGQRKAFGTCGSHLTVVSLFYGSALYAYLHPSSNDSQDQGKFISLFYTIITPMINPLIYTLRNKEVKGAMRRVLWKDSVSR*
1180 >lcl|XP_003356637.1|Plus1complement(125807..126751) NW_003535166 olfactory receptor 2W1-like LOC100523800 __SEG__ Chr7 {Sus scrofa} MEASNGSSRTDFILLGFSDRPQLERIISAFVFIFYIVTLVGNTTIILVSYLDTQLHTPMYFFLSNLSFLDLCYTTSIIPQMLVNLWGPKKSITYGGCVLQFFFALDLGAT
ECLLLAVMAYDRYAAVCQPLHYTVIMHSQLCQKMVLTAWLGGLGSALILCTLTLKLPRCGHQKVDNFFCEMPALIKMACVYSKVIEVVVFALGVVFLLVPLSLILISYGV
ITQAVMKIKSEARWQKIFNTCGSHLTVVTLFYGTIIYMYMKPHSSTSQDEGKFFTLFYTIVTPSLNPLIYTLRNKDVKSAIKKILWIQKWAAKS*
1181 >lcl|XP_003356641.1|Plus1186778..187725 NW_003535167 olfactory receptor 5V1-like LOC100625491 __SEG__ Chr7 {Sus scrofa} MERENKTLSEFIILGFSDLNDLQFLLFTIFLMIYLCTLGGNTFIILVTLADIRLNTPMYFFLRNLAFLDICYTTTNVPQMMAHLLSEKKSISYGGCVTQLFAFLFFVGVE
CLLLAAMAYDRYIAICKPLRYSVIMNKALYSQLAASCWVSGFLNSAVHTVLTFHLPFCGNNQINYFFCDIPPLLILSCGDTSVNELVLLFIGVFIGWALFLGIILSYLYI
ISTILRIRSSEGRQKAFSTCASHLVIVLLYYGSSIFTYVRPISSYSLTKDRLISVLYSVVTPMLNPIIYTLRNKDIRKALRAVVVKVVVFKCHFP*
1182 >lcl|XP_003356642.1|Plus1complement(240273..241199) NW_003535167 olfactory receptor 12D2-like LOC100626050 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPRMLGNFLSSHKAISFWGCISQLHFFHFLGSTEG
LLLAVMAFDRFVAICKPLRYTLIMNPQICAQMAVTVWIIGFLYALMHSIMTSRLHFCGSNYIHHFFCDIKPLLKLACGNIELNQWLLNTVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKEVKGALSKLVKRRF*
1183 >lcl|XP_003356643.1|Plus1complement(18219..19157) NW_003535167 olfactory receptor 2H1-like LOC100626789 __SEG__ Chr7 {Sus scrofa} MVNHSSPAGFLLLGFSEHPELERILFAVVFASYLLTLAGNTLIILLSALDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPHKTISFLGCAVQLFIFLLLGTTEC
VLLTVMAFDRYVAVCQPLHYATIVHPRLCRQLAAVAWVMGLVQSIVQTPPTLRLPFCPHRQIDDFVCQVPSLIRLSCGDTTFNGIQLAVSSVVFLVVPLALILISYGAIA
RAVLRISSATAWRKALGTCSSHLAVVTLLYSSVIAVCLQPKSPYAQRRGKFFGLFYAVGTPSLNPLIYTLRNKEVKRALGRLLGQDRDARES*
1184 >lcl|XP_003356644.1|Plus1complement(30125..31063) NW_003535167 olfactory receptor 2H1-like LOC100626885 __SEG__ Chr7 {Sus scrofa} MVNHSSPAGFLLLGFSEHPELERILFVVVFASYLLTLAGNTLIILLSALDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPHKTISFLGCAVQLFIFLLLGTTEC
VLLTVMAFDRYVAVCQPLHYATIMHPRLCRQLAAVAWVIGLVESMVQTPPTLRLPFCPHRQIDDFVCQVPSLIRLSCGDTTYNEIQMAVASVFILVVPLSLILVSYGAIA
RAVLRISSATAWRKALGTCSSHLAVVTLFYSSGIAVYLQPKSPYAQRRGKFFGLFYAVGIPSLNPLIYTLRNKEVKRALGRLLGQDGDARES*
1185 >lcl|XP_003356645.1|Plus1complement(174716..175642) NW_003535167 olfactory receptor 12D2-like LOC100626985 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPRMLGNFLSSHKAISFWGCISQLHFFHFLGSTEG
LLLAVMAFDRFVAICKPLRYTLIMNPQICAQMAVTVWITGFLYALLHSVMTSHLNFCGSNHIHHFFCDIKPLLKLACGNIELNQWLLNTVTGTIAMGPFFLTLLSYFYII
IHLFFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKGALRSVIRRRL*
1186 >lcl|XP_003356646.1|Plus1complement(94545..95471) NW_003535168 olfactory receptor 12D2-like LOC100524875 __SEG__ Chr7 {Sus scrofa} MPNQTSVTEFLLLGVTDIQELQPLLFVLFLAIYLVIVAGNGAILMVVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKMLGNFLSSHKAISFWGCISQLHFFHFLGSTEA
LLLAVMAFDRFVAICKPLRYTLIMNPQVCAQMAVTVWIIGFLYALLHSIMTSHLNFCGSNHIHHFFCDIKPLLELACGNIELNQWLLNTVTGTIAMGPFFLTLLSYGYII
THLSFKTHSCSMLHKALSTCASHFMVVVLFFAPVVFTYIRPTSGSSMDQDRIIAIMYSVVTPVLNPLIYTLRNKQVKGALRRVIRRRL*
1187 >lcl|XP_003356647.1|Plus1221620..222561 NW_003535169 olfactory receptor 2G3-like LOC100157316 __SEG__ Chr7 {Sus scrofa} MTKSNESLADDFILVGFSDQPQLEKILFVVVLISYLLTLVGNTAIILVSCLDPILHTPMYYFLSNLSFVDLCFTTSIVPQLLWNLHGPSKTISPIGCAIQLYVSLSLGST
ECVLLAIMAFDRYAAVCRPLHYPRVMHSRLCQSLAGMAWLSGMGNTLIQGTITLRLPRCGNNRIYHFICEVPAMIKLACIDIHANEVQLFVGSLVLLLLPLALILISYGC
IVQAVMRIRSAQAWHKALGTCGSHLLVVSLFYGTITAIYIQPSSSYAHSQGKFITLLYTVLTPTLNPLIYTLRNKDVKGALKRLVRKDQSTAE*
1188 >lcl|XP_003356667.1|Plus1851977..853005 NW_003535178 allatostatin-A receptor-like LOC100621679 __SEG__ Chr7 {Sus scrofa} MEANATSTAGLTAIPERPLRLIFAGVCGLILLVGLLANALMLLVMGRSQGAARPLLALTNSLMVNITLSDLLFLACVVPVLLLSFLRQDWWLGSTICITSQAANSATMFC
TFYSMVATALLRHVAVARPNMALPSCLGARLLLCGAMWVLGLTASLPNWLFQQVVGEGEARACLLLLNPAQTSCYFMLLGALAFLPCTLGLGCSFSHLGWLLWTQPRSPG
GESLREHRENTGLILVVLVVFMLMWGPCSVLGYVAAVGDLPATPGAFVASSLCTILAYSNCAVSPLLCFYLSRPFRAGLRDLFHRPVVARRPRGGGGAGMAIECVQPSHV
SAPGGLWGLAGV*
1189 >lcl|XP_003356690.1|Plus138350..39414 NW_003535193 membrane progestin receptor beta-like LOC100620575 __SEG__ Chr7 {Sus scrofa} MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFLPAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FILDISPVAHRVALCHLSGCQEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYKGRQEIFLHRHSPLSIYAACLSFFFL
VACSGATAALLREKIKARLSKKDS*
1190 >lcl|XP_003356770.1|Plus1complement(27124..28056) NW_003535237 olfactory receptor 4Q2-like LOC100624131 __SEG__ Chr7 {Sus scrofa} MDKNQTEEVREFVLAGFSHRPHIEKGLFVLFLFFYVSTWVGNVLIMVTVASDKHLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFLDNEKLIPYDQCIMQLFFLHFVGA
AEMFLLTVMAYDRYVAICRPLHYTTIMSRGLCCALVAASWMGGFVHSTVQTILTIHLPFCGPKQVDNFFCDVPPVIKLACGDTFVIELLMVSNSGLISTSSFVVLVSSYT
TILVKIRSKEGRRKALSTCGSHLMVVTLFFGPCIFIYARPFSTFSVDKLVSVLYNVITPMLNPLIYTLRNKEVKSAMQKLWDRSGLTWKI*
1191 >lcl|XP_003356771.1|Plus169119..70057 NW_003535237 olfactory receptor 4F6-like LOC100518135 __SEG__ Chr7 {Sus scrofa} MYETNYSSVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFDPHLHSPMYFLLANLSFIDLCLSTLTVPKMISDLCSGRKTISFQGCVFQIFVLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGAWAIGLLHTVVQVAFVVHLPFCGPNEIDSFYCDLPQFIKLACIDTYRMEFMVTTNSGFISMGTFFLLIVSYVF
ILVTVWKRSSGSLCKAFSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMKMAVRRLSSQLLSWQKIS*
1192 >lcl|XP_003356781.1|Plus1complement(32846..34615) NW_001886521 ectoderm-neural cortex protein 2-like LOC100621005 __SEG__ Chr7 {Sus scrofa} MSVSVHETRKSRSSTGSMNITLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELEAEDERVVFEAILQWVKH
DPEQRKAHLPELLRGVRLALLPSDCLTEAVSGEALLMADERTRLIVDEALRCKTRILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYNTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA*
1193 >lcl|XP_003356860.1|Plus1complement(132202..133146) NW_003300302 olfactory receptor 4K3-like LOC100526175 __SEG__ Chr7 {Sus scrofa} MDAGNLSVVSEFVLLGLCQSWTMQVLLLLVFFILFLIIVSGNITIMILITIDTHLHSPMYFLLANLFFVDMWLCSITTPKMITDFVREKKTISFGGCMCQVLFVHFFGGG
EMVLLVVMAYDRYVAICKPLHYLTIMNVQKCIGLVAISWTIGFVHAISQMAVIIQLPFCGPREIDSFFCDIPLVIKLACIDSHSLGILMNADSGVPAMTCFIVLLISYTY
ILFTVRRSSKTGVSRALSTCTAHITVVVLFFGPCIFIYVWPLSITWVDKFLAVFYSVFTPLLNPAIYTLRNKEIKNALKRFRSYYLHSKEKFTA*
1194 >lcl|XP_003356861.1|Plus1complement(230541..231482) NW_003300302 olfactory receptor 4L1-like LOC100623450 __SEG__ Chr7 {Sus scrofa} MDLLNNTPSVSEFILLGLFSAQDIQMFLFAIFTLVYVAIIVGNLLIVISVISDNHLHSPMYFFLANLSFFDLCLSSTATPKVILDFFREHKTISWWGCMTQMFFMHFLGG
GEMSLLIAMAIDRYVAICKPLHYKTIMSHKVLIVFLLLSWAVGFIHTTSQMVFTVGLPFCGPNTVDSIFCDLPLVIRLACTDTYILELLVIVNSGLLSLVCFVLLLISYT
VMLITIWQHSSSASSKALSTLSAHITVVTLFFGPAIFVYAFPFNSYSVDKFLSVFYSMITPLLNPIIYTLRNQEMKAAIKRLSRQHIGSCLIH*
1195 >lcl|XP_003356862.1|Plus1250334..251278 NW_003300302 olfactory receptor 4K3-like LOC100511517 __SEG__ Chr7 {Sus scrofa} MDAGNLSVVSEFVLLGLCQSWTMQVLLLLVFFILFLIIVSGNITIMILITIDTHLHSPMYFLLANLSFVDMWLCSITTPKMITDFVREKKTISFGGCMCQVLFVHFFGGG
EMVLLVVMAYDRYVAICKPLHYLTIMNVQKCIGLVAISWTIGFVHAISQMAVIIQLPFCGPREIDSFFCDIPLVIKLACIDSHSLGILMNADSGVPAMTCFIVLLISYTY
ILFTVRRSSKTGVSRALSTCTAHITVVVLFFGPCIFIYVWPLSITWVDKFLAVFYSVFTPLLNPAIYTLRNKEIKNAVKRFRSYYLHSKEKFTA*
1196 >lcl|XP_003356865.1|Plus1complement(37519..38457) NW_003535312 olfactory receptor 4F6-like LOC100155561 __SEG__ Chr7 {Sus scrofa} MHKANYSSVSEFVFLGLSPSRPVQDFLLAFSTVCYGTIVLGNLLVVFAVIFDPHLHSPMYFLLANLSFIDLCFSTLTVPKTLSDLCSGRKTISFQGCVFQIFLLHILGGS
EMVLLTAMALDRYVAICKPLHYLTIMSPRMCLLLLCGTWAIGLLHAVVQLAFVVHLPFCGPNEINSFYCDLPRFIKLACIDTYRMEFMVTANSGFITMGTFFLLNVSYVF
ILVTVWKRSSGSLCKALSTLSAHISVVILFFGPCIFVYMWPFPTVPVDKFLAILDFMITPLLNPAIYTLRNKDMKMAVRRLRSQLLSWQKIS*
1197 >lcl|XP_003356866.1|Plus1complement(81947..82885) NW_003535312 olfactory receptor 4F21-like LOC100624919 __SEG__ Chr7 {Sus scrofa} MDGANHSVASEFVFLGLTSSWEIQLLLFVFTSTFYMASMLGNSLIMLTVTSDPHLHSPMYFLLANLSFLDLVAASVASPKMIYDLFRKCKVISFSGCIAQTFFMNVIGGV
EGVMLITMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWVTGLIHSMVQLAFVVNLPFCGPNVLDRFYCDLPRFLKLACTDTYQLESMVMANSGFISVGFFFIVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWPSPSIPLDKFLAIFDAVLTPFLNPVIYTFKNQEMKVAMKRVCKQLVSYRKIS*
1198 >lcl|XP_003356867.1|Plus1complement(106991..107929) NW_003535312 olfactory receptor 4F3/4F16/4F29-like LOC100625106 __SEG__ Chr7 {Sus scrofa} MDGTNHSVVSEFVFLGLTNSWEIQLLLFLFSSVFYVASMMGNSLIMLTVTSDRHLHSPMYFLLANLSFIDLGVSSVFSPKMIYDLFRKHKVISFSGCIAQIFFLHLIGSV
EMVLLIAMAFDRYVAICKPLHYLTIMNPKICILFLVAAWIIGLVHSVVQLVFVVKLPFCGPNVLDSFYCDFPRFIKLACTDTYRLEFMVTANSGLISLGSFVILFISYIF
ILITVQKHSSGSSSKALSTLSTHVMVVVLFFGPCIFAYIWPHPTSHLDKFLAVFDAVLTPFLNSVIYTFRNKEMKMAMRKVCSQIFIYRRIS*
1199 >lcl|XP_003356868.1|Plus1complement(160102..161040) NW_003535312 olfactory receptor 4F21-like LOC100625198 __SEG__ Chr7 {Sus scrofa} MDGANHSVASEFVFLGLTNSWEIQLLLFVFTSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFLDLVAASVASPKMIYDLFRKCKVISFSGCIAQTFFMNVIGGV
EGVMLITMAFDRYVAICKPLHYLTIMSPRMCISFLVAAWVTGLIHSMVQLAFVVNLPFCGPNVLDRFYCDLPRFLKLACTDTYQLESMVMANSGFISVGFFFIVIISYIV
IILTVQKHSSAGSSKALSTLSAHITVVVLAFGPFIFVYTWPSPSIPLDKFLAIFDAVLTPFLNPVIYTFKNQEMKVAMKRVCKQLVSYRKIS*
1200 >lcl|XP_003356869.1|Plus1complement(39700..40656) NW_003300306 olfactory receptor 4F3/4F16/4F29-like LOC100515038 __SEG__ Chr7 {Sus scrofa} MSTKPKDGENNSVVSEFVFLGITNSWEIQLLLFVFSSMFYMASMMGNSLNMLTVTSDPHLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKRKVISFSGCITQIFFIH
VIGGVEMVLLIAMAFDRYVAICKPLHYLTIMSPRLCIFLLVAAWIIGLVHSTVQLASVVNLPFCGPNVLDSFYCDLPRFIKLACVDTEQLESMVTANSGLISVGSFFILI
ISYIVIILTVKKQCSVGSSKALSTLSAHITVVILFFGPLIFVYTWPSHYTPLDKFLTIFDAVLTPFLNSVIYTFRNQEMKVSMRRVCRQLVNYRRSLK*
1201 >lcl|XP_003356870.1|Plus1complement(177734..178693) NW_003300307 olfactory receptor 4K2-like LOC100518080 __SEG__ Chr7 {Sus scrofa} MEGANHSRVSEFVLLGLTDSPELQIFFFVMFSLFYLMSMLGNCLILLTVLFSPHLHSPMYFLLSNLSLIDMCLSSFATPKMIVDIFAQHKTISFEGCISQIFFLHLFTGT
EIVLLISMSFDRYIAICKPLHYSSVMSQSMCVGLVVASWTVGFLHTMTQLAFTLYLPFCGPNVVDSFFCDLPLVIQLACIDTYILGIFMISTSGVIALISFLLLLTSYIT
VLVTIKDHSSSGSSKALSTCTAHFIVVSMFFGPCIFIYVWPFTNFLMDKTLSIFYTIFTPFLNPLIYTLRNQEVKTAVKKKLSNQYLNIGKTTPMYSVQ*
1202 >lcl|XP_003357074.1|Plus1complement(44806..47496) NW_003535418 protocadherin-10-like LOC100620123 __SEG__ Chr8 {Sus scrofa} MIVLLFFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTAPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLENPLELFRVEI
EVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGGEGGGGGGG
GGGLLPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELDYEESPVYQVYVQA
KDLGPNAVPAHCKVIVRVLDANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGE
PALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAYSILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGS