Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor T    

ID / Description / Sequence
6 >lcl|NP_001000006.1|Plus1complement(31174195..31175157) NW_047334 olfactory receptor Olr1423 Olr1423 __SEG__ Chr10 {Rattus norvegicus} MDLTSWINNYTGQSDFTLVGFFSQCKYPALLAVVIFVVFLIALSGNALLILLILSDTHLHTPMYFFISQLSLMDIMYISVTVPKMLMDQVLGSHRISAAACGMQMFLYLT
7 >lcl|NP_001000007.1|Plus1complement(31146645..31147589) NW_047334 olfactory receptor Olr1422 Olr1422 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQSGFALVGFLSQSKHPALLAGVIFVVFLMALSGNALLILLILSDTHLHTPMYLFISQLSLMDMMYISVTVPNMLMDQVLGNHRISAAACGMQMFLYLTLAGSEF
8 >lcl|NP_001000008.1|Plus1complement(31077648..31078592) NW_047334 olfactory receptor Olr1418 Olr1418 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQSGFTLVGFLSQSKHPALLAVVIFMVFLMALSGNALLILLILSDTHLHTPMYFFISQLSLMDMMCISVTVPKMLMNQMLENYRISAAACGMQMFLYLTLAGSEF
9 >lcl|NP_001000009.1|Plus1complement(30971758..30972687) NW_047334 olfactory receptor Olr1416 Olr1416 __SEG__ Chr10 {Rattus norvegicus} MNNYTEQSGFTLVGFLSQSKDPALLSVVIFVVFLMALSGNILLILLILSDTHLHTPMYFFISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLTLAGSEF
10 >lcl|NP_001000010.1|Plus1complement(31220806..31221753) NW_047334 olfactory receptor Olr1425 Olr1425 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQFSDFTLLGFFSQYKYPTLLAGVIFVVFLMALSGNAFLILLILFDTQLHTPMYFFISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLSLGGSE
12 >lcl|NP_001000012.1|Plus1complement(31312705..31313676) NW_047334 olfactory receptor Olr1432 Olr1432 __SEG__ Chr10 {Rattus norvegicus} MEPQNLSKVTEFQLLGFRNLLEWQSLLFAIFLCFYLLTITGNMVIIAVVSEDPRLRAPMYTFLQHLSFLEIWYTSTTVPLLLSNLATWGHMLSFPACMTQLYFFVFFGAT
14 >lcl|NP_001000014.1|Plus1complement(31441629..31442549) NW_047334 olfactory receptor Olr1436 Olr1436 __SEG__ Chr10 {Rattus norvegicus} MEKGNHSCGTDFTLVGLFQYGHTDTFLFTVIILLFAVALIGNITLVHLIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCVIQAFVFLTLGAS
17 >lcl|NP_001000017.1|Plus1complement(31540378..31541298) NW_047334 olfactory receptor Olr1440 Olr1440 __SEG__ Chr10 {Rattus norvegicus} METGNCSCGTDFTLVGLFQYGHMDTFLFTVIALLFAVALIGNITLVHLIRMDRTLHTPMYFLLSQLSIIDMIYISTTVPKMAANFLSDTKTISFLGCAIQTFVFVTLGGS
23 >lcl|NP_001000023.1|Plus1complement(32720076..32721035) NW_047334 olfactory receptor Olr1463 Olr1463 __SEG__ Chr10 {Rattus norvegicus} MQVAVKRQNVSFPHTFVLVGFSDHPWLEMPLFGVLLVSYIFTMIGNSSIIILSLLEPRLQTPMYFFLDNLSMLDLCATCTIVPQLLVNLWGPEKTIASWSCITQSYLFHW
29 >lcl|NP_001000050.1|Plus1complement(4984936..4985865) NW_047355 olfactory receptor Olr1557 Olr1557 __SEG__ Chr11 {Rattus norvegicus} MEKKNETLWSEFILTGLTCQPQWKTPLFLMFLVIYLMTIVGNLGLITLIWNDPHLHIPMYLFLSNLAFVDTWLSSTVTPKMLFNLLDKGKVISIAECKTQFFSFAISVTT
30 >lcl|NP_001000051.1|Plus1complement(4927397..4928326) NW_047355 olfactory receptor Olr1553 Olr1553 __SEG__ Chr11 {Rattus norvegicus} MEKKNETLWSEFILTGLTCQPQWKTPLFLVFLVIYLMTIVGNLGLITLIWNDPRLHIPMYLFLSNLAFVDTWLSSTVTPKMLFNLLDKGKVISVAECMTQFFSFAISVTT
39 >lcl|NP_001000062.1|Plus1complement(8465001..8465969) NW_047773 olfactory receptor Olr1072 Olr1072 __SEG__ Chr7 {Rattus norvegicus} MGEKERDNHSEVTDFIHHSEVTDFILVGIRVRPELHSVLFLLFLVVYGMVLLGNLSMIGIIVTDPRLNTPMYFFLGNLSVIDLSYSTVIVPKAMVNILSQKKTISFVGCV
40 >lcl|NP_001000063.1|Plus1complement(8424057..8424998) NW_047773 olfactory receptor Olr1071 Olr1071 __SEG__ Chr7 {Rattus norvegicus} MGDREINNHSDMTDFILVGFRVSHELHILLFLLFLLVYTMILLGNLGMMAIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIAPKAMSNFWTESKSISFAGCVAQLFLFALF
42 >lcl|NP_001000065.1|Plus1complement(8016399..8017361) NW_047773 olfactory receptor Olr1061 Olr1061 __SEG__ Chr7 {Rattus norvegicus} MSNSGLRKNGSLSFCSEFTLVALSSLAELQPVLFLVFLVTYLFTVGGNLTIICVIWVTRSLHTPMYFFLANLSFLEMCYISSVVPQMLVHLLVQIKTISVRGCAVQMYIF
43 >lcl|NP_001000066.1|Plus1complement(7923538..7924476) NW_047773 olfactory receptor Olr1058 Olr1058 __SEG__ Chr7 {Rattus norvegicus} MKNHTEVTVFILAGLTDDPRCKVVLFIFLLLTYLLSITGNLTIITLTLVDTHLKTPMYFFLRNFSFLEFSYTTTCIPKLLLTMATGDKTISYSNCVTQVFFAFLFGASEF
44 >lcl|NP_001000067.1|Plus1complement(7860576..7861520) NW_047773 olfactory receptor Olr1055 Olr1055 __SEG__ Chr7 {Rattus norvegicus} MKNQSGELEFILVGLTDDPQLQILIFLFLFFNYILSMIGNFMIILLTLLDPHLKTPMYFFLRNFSFIEITFTTVCIPRFLINILSGDRRISYNDCAAQLFFVFLLGTTEF
45 >lcl|NP_001000068.1|Plus1complement(7079283..7080206) NW_047773 olfactory receptor Olr1024 Olr1024 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFMFFNYILSLMGNLMIIFLTLLDLRLKTPMYFFLRNFSFLETAFTSSCIPRFLMSILTGDKTISYGACLTQLFFFFLLLITEF
46 >lcl|NP_001000069.1|Plus1complement(7012696..7013655) NW_047773 olfactory receptor Olr1020 Olr1020 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFLFLNYILSMMGNLVIILLTLLDPHLKTPMYFFLRNFSFLEIAFTTACIPRFLMSILTGDRTISYNSCAAQFFFFFLLLVTEF
48 >lcl|NP_001000072.1|Plus1complement(7912859..7913797) NW_047773 olfactory receptor Olr1057 Olr1057 __SEG__ Chr7 {Rattus norvegicus} MKNHTRQIEFILLGLTDNPQLQIVIFVFLLLNYFLSMIGNLTIIALTLLDPLLKTPMYFFLRNFSFLEILFTTTCIPRFLITTVTQEKTISYNGCICQLFFYIFLGGTEF
51 >lcl|NP_001000075.1|Plus1complement(6592173..6593123) NW_047773 olfactory receptor Olr1006 Olr1006 __SEG__ Chr7 {Rattus norvegicus} MRNHTSITTFILLGLTDDPQLQILLFIFLFITYLLSVTDNLTIITPTTVDPYLKTPTYFFLQNFSFLEISFTSACVPRFLYSISTGDRTITYNACATQLFFTDLFGVTGF
52 >lcl|NP_001000076.1|Plus1complement(6620859..6621803) NW_047773 olfactory receptor Olr1007 Olr1007 __SEG__ Chr7 {Rattus norvegicus} MKNQSMELDFILLGLTDDPQLQIVVFLFLFLNYMMSLVGNLIIVLLTLLDPRLKTPMYFFLRNFSLLEIMFTTVCIPRFLTTIVTGDKTISYNNCASQLFFILLLGVTEF
53 >lcl|NP_001000077.1|Plus1complement(6429404..6430339) NW_047773 olfactory receptor Olr1000 Olr1000 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFMFFNYILSLMGNLIIIFLTLLDLRLKTPMYFFLRNFSLLEIAFTTACIPRFLMSIITGDKTITYNACVAQLFFFVLLLITEF
54 >lcl|NP_001000078.1|Plus1complement(6624716..6625648) NW_047399 olfactory receptor Olr1579 Olr1579 __SEG__ Chr13 {Rattus norvegicus} MKTVNCTQVREFVFQGFSNFQEHQLTLFIVFFTLYILTLTGNLIIVTIIRIDHHLHTPMYFFLSVLSTSETFYSLVIIPRMLGSLVGLSQSISLECCGIQLFFFLGFGIT
60 >lcl|NP_001000084.1|Plus1complement(7175255..7176178) NW_047399 olfactory receptor Olr1592 Olr1592 __SEG__ Chr13 {Rattus norvegicus} MVIEFLFSVFPPLHEGGLLFFILLILVYAFIISGNLVIFVAVQLDLALHTPMYFFISVLSFLEIWYTTTTIPKMLSSLVSEKKTISLGGCLMQMYFFHSLGITEGCVLTA
64 >lcl|NP_001000089.1|Plus1complement(1970384..1971310) NW_047453 olfactory receptor Olr1624 Olr1624 __SEG__ Chr15 {Rattus norvegicus} MEIKNSSVVTEFILLGLTQSQEAQLLVFTMISVFYLIILPGNFLIIFTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFFCEKKVISYKACITQLFFLHFLGAG
65 >lcl|NP_001000090.1|Plus1complement(2035371..2036342) NW_047453 olfactory receptor Olr1626 Olr1626 __SEG__ Chr15 {Rattus norvegicus} MNETNYTRVSEFVLLGLSSSKELQPFLFLIFSLLYLAILLGNFLIILTVTSDSRLHTPMYFLLANLSFIDICVSSFATPKMLADFLVERKTISFEACMAQIFCVHQFAGG
67 >lcl|NP_001000092.1|Plus1complement(2134851..2135822) NW_047453 olfactory receptor Olr1630 Olr1630 __SEG__ Chr15 {Rattus norvegicus} MDSTNYSVVSEFVLLGLSRSRELQIFYFVFFSALYIVIVLGNLLIIIAVTSDSSLHSPMYFLLGNLSFFDICQASFATPKMIVDFLSERKTISFTGCIAQIFFIHLFTGG
68 >lcl|NP_001000093.1|Plus1complement(1502697..1503650) NW_047453 olfactory receptor Olr1608 Olr1608 __SEG__ Chr15 {Rattus norvegicus} MTVANKSIVTEFVLLGLSNSWELQIFFFIVFSVFYVATMVSNSIIVVIVISDSHLHSAMYFLLTNLSLIDMSLASFATPKMIIDYLTDHKTISFDGCIAQIFFLHLFTGT
69 >lcl|NP_001000094.1|Plus1complement(1580692..1581618) NW_047453 olfactory receptor Olr1610 Olr1610 __SEG__ Chr15 {Rattus norvegicus} METENRTVVTEFILIGLTQSHDIQRLVFVLSLIFYIIILPGNILIILTIKSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDIFSEKKIISYKACITQLFFLHFLGGG
70 >lcl|NP_001000096.1|Plus1complement(1607558..1608499) NW_047453 olfactory receptor Olr1612 Olr1612 __SEG__ Chr15 {Rattus norvegicus} MEPANDTTVTEFVLTGLSQTREVQLVLFVIFLSFYLFILPVNILIICTIRLDPHLSSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGAS
72 >lcl|NP_001000099.1|Plus1complement(3416123..3417064) NW_047453 olfactory receptor Olr1640 Olr1640 __SEG__ Chr15 {Rattus norvegicus} MERVNHTLLTEFVLTGVPHPPRLRTFLFVFFLLIYILTQLGNMLILITVCADTQLHARPMYVFLGALSVIDMGISTIIVPRLMMNFTPGIKPIPFGGCVAQLYFYHFLGS
73 >lcl|NP_001000100.1|Plus1complement(3444288..3445244) NW_047453 olfactory receptor Olr1641 Olr1641 __SEG__ Chr15 {Rattus norvegicus} MRRNRNTSLDTVVTDFLLLGLAHPPNLRTFLFLVFLLIYILTQLGNLLILLTVWADPKLHARPMYILLGVLSFLDMWLSSVIVPRIILNFTPANKAIAFGGCVAQLYFFH
74 >lcl|NP_001000101.1|Plus1complement(3518820..3519752) NW_047453 olfactory receptor Olr1644 Olr1644 __SEG__ Chr15 {Rattus norvegicus} MEKAVLINHTSVTSFRLTGLSANPKVQMAVFFIFLIFYVLTLVGNILIVITIIFDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTLSEDKLISFDACVVQMFFLHLF
75 >lcl|NP_001000102.1|Plus1complement(3543653..3544657) NW_047453 olfactory receptor Olr1645 Olr1645 __SEG__ Chr15 {Rattus norvegicus} MEKAVLINQTSVTSFRLTGLSANPKVQMFVFFIFLVFYVMTLVGNILIVITIIFDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTLSDEKVISFDACVVQIFFLHLF
76 >lcl|NP_001000103.1|Plus1complement(4206100..4207044) NW_047454 olfactory receptor Olr1646 Olr1646 __SEG__ Chr15 {Rattus norvegicus} MENSTTIVTEFILLGLSDACELQVIIFLGFLLTYFLILLGNFLIIFITLADRRLYTPMYYFLRNFAVLEIWFTSVIFPKMLTNIVTGHKTISLLGCFLQTFFYFFLGTTE
80 >lcl|NP_001000107.1|Plus1complement(4647849..4648802) NW_047492 olfactory receptor Olr1662 Olr1662 __SEG__ Chr17 {Rattus norvegicus} MDPSNYSTLHVFILLGFSDHPHLEMILSGVVTFFYIVTLVGNTAIILASLLDPHLHTPMYFFLRNLSFLDLCFTTSIVPQMLVNLWGPEKTISSVGCIVQLYVYMWLGSI
112 >lcl|NP_001000145.1|Plus1complement(3825632..3826591) NW_047562 olfactory receptor Olr104 Olr104 __SEG__ Chr1 {Rattus norvegicus} MSYSNLTSPSFFLIGLPGLEAVYIWLSIPLCTMYFASLAGNSLILWVVKSEPSLHQPMYYFLSMLAVTDLGLSASTMPTMLTIYMLGVSEVPLDMCFAQLFFIHTFSIME
113 >lcl|NP_001000146.1|Plus1complement(3839510..3840457) NW_047562 olfactory receptor Olr105 Olr105 __SEG__ Chr1 {Rattus norvegicus} MAVSKHSNASSFFFILMDLPGLETSHCWTAIPICLIYILSVLGNIIIMHIVKSVPSLHTPMYLFLSMLSMADLGLSASTLPSMVAVFLLGQRLIGAAACFMQLFFIHTFS
114 >lcl|NP_001000147.1|Plus1complement(3850049..3851020) NW_047562 olfactory receptor Olr106 Olr106 __SEG__ Chr1 {Rattus norvegicus} MLHINITNSIFSASLVTGIPGLETVYIWVSIPFCAMFLITIVGNMTIIIVIWHEQTLHVPMYLILAMLASSDLGLSLFTFPTLLRIFLLNAREVTASACFTQMFFIHTFQ
118 >lcl|NP_001000151.1|Plus1complement(3949768..3950709) NW_047562 olfactory receptor Olr113 Olr113 __SEG__ Chr1 {Rattus norvegicus} MSALSVTNFTSSKFALTGFPGLEIYYFWLSVPFSIIYVTVFLGNCMILHVIRTELSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWGLIQEISLDACIAQSYFIHGLS
119 >lcl|NP_001000152.1|Plus1complement(3972305..3973258) NW_047562 olfactory receptor Olr115 Olr115 __SEG__ Chr1 {Rattus norvegicus} MVENVTHEHIASFFLVGIPGLENVHCWIGIPVCLLFVLTLLGNSIIIATIKLEPSLHQPMYFFLCMLATNDMCLASSAALKMLAIFWFDAHWINFDACLTQMYFIHTLCI
120 >lcl|NP_001000153.1|Plus1complement(4042083..4043036) NW_047562 olfactory receptor Olr119 Olr119 __SEG__ Chr1 {Rattus norvegicus} MPVIWLNTSSCPFLLTGFPSLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPMYYFLGMLAATDLGVTLTTMPTVLGVLWLNHREIGHGACFSQAYFIHTLSI
121 >lcl|NP_001000154.1|Plus1complement(4050015..4050959) NW_047562 olfactory receptor Olr120 Olr120 __SEG__ Chr1 {Rattus norvegicus} MSLFLMSNLSTSRFVLTGFPGLEVYYILFAIPFSVIYAMVFLGNCMILHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWSFLQEISLDACIAQSYFIHGLS
122 >lcl|NP_001000155.1|Plus1complement(4066595..4067548) NW_047562 olfactory receptor Olr121 Olr121 __SEG__ Chr1 {Rattus norvegicus} MAGNATCQHIASFFLVGIPGLENVHCWIGIPVCLLFVLTLLGNSIIIATVKLEPSLHQPMYFFLCMLASNDMCLASSAALKMLAIFWFDAHWINFDACLTQMYFIHTLCI
124 >lcl|NP_001000157.1|Plus1complement(4100277..4101224) NW_047562 olfactory receptor Olr124 Olr124 __SEG__ Chr1 {Rattus norvegicus} MAGNASHQIASFFLVGIPGLENFHCWIGIPVCLLFVLTLLGNSIIIATVKLESSLHQPMYFFLCILAMNDMCLTCSTALKMLNIFWFDAHWIDFDACLTQMFFIHTLCIM
125 >lcl|NP_001000158.1|Plus1complement(4130238..4131188) NW_047562 olfactory receptor Olr126 Olr126 __SEG__ Chr1 {Rattus norvegicus} MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIPMYIFLAILAVTDIVLSTCILPKMLGIFWFHMPQISFDACLLQMELIHSFQ
126 >lcl|NP_001000159.1|Plus1complement(4175582..4176544) NW_047562 olfactory receptor Olr128 Olr128 __SEG__ Chr1 {Rattus norvegicus} MKVVSFFHNHTNPQDVWYVLIGIPGLEDLHTWIAIPICSMYIVAVIGNVLLIFLIMTERSLHEPMYFFLSMLALADLLLSTATAPKMLAVFWLHSRGISFGSCVTQMFFI
131 >lcl|NP_001000164.1|Plus1complement(4500044..4500988) NW_047562 olfactory receptor Olr144 Olr144 __SEG__ Chr1 {Rattus norvegicus} MRSFHTNTSSTSSFILTGFPEMESLEHWLAALLLLLYVISIVGNALILFIIKEEQSLHQPMYYFLSLLSVNDLGVSFSTLPTVLASMCFHIPETAFDACLAQMFFIHFFS
133 >lcl|NP_001000166.1|Plus1complement(4624053..4625003) NW_047562 olfactory receptor Olr149 Olr149 __SEG__ Chr1 {Rattus norvegicus} MITYNVSSYNPGPFLLVGIPGLEQFHVWIGIPFCVIYVIAMTGNCVLLYLIVAERSLHEPMFFFLSMLALTDLILSTAGVPKTLSIFWMGAREITFPGCLTQMFFLHYSF
139 >lcl|NP_001000172.1|Plus1complement(5029736..5030704) NW_047562 olfactory receptor Olr165 Olr165 __SEG__ Chr1 {Rattus norvegicus} MSVQNNTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLHRPMYYFLAILSLTDLVMCLSAIPKALCIFWFHQKEIGFDDCLVQMFFTHTFT
140 >lcl|NP_001000173.1|Plus1complement(5061869..5062828) NW_047562 olfactory receptor Olr167 Olr167 __SEG__ Chr1 {Rattus norvegicus} MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANTVIVSIIYQEASLHQPMYHFLGILAIVDMGLATTIMPKILAIFWFNAKAISFNECFVQMYAI
142 >lcl|NP_001000175.1|Plus1complement(5119678..5120643) NW_047562 olfactory receptor Olr170 Olr170 __SEG__ Chr1 {Rattus norvegicus} MSILNVSSLTPASFILNGIPGLEEVHLWISFPLFTMYSIALTGNFGLIYLIYSEEVLHRPMYIFLALLSFTDVLMCTSTVPNTLCILWFNFKEIDFKACLAQMFFVHTFT
144 >lcl|NP_001000177.1|Plus1complement(5180785..5181741) NW_047562 olfactory receptor Olr172 Olr172 __SEG__ Chr1 {Rattus norvegicus} MSRANSSSLTPEFFILNGVPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIGHEESLHRPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNFKKIEFNSCLAQMFFVHMLT
145 >lcl|NP_001000178.1|Plus1complement(5235651..5236607) NW_047562 olfactory receptor Olr176 Olr176 __SEG__ Chr1 {Rattus norvegicus} MSGSNSSSLIPEFFILNGVPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIGHEEALHRPMYYFLALLSFTDVTWCTTTVPNMLCIFWFNFKKIGFNSCLVQMFFVHMLT
147 >lcl|NP_001000180.1|Plus1complement(5349048..5349998) NW_047562 olfactory receptor Olr180 Olr180 __SEG__ Chr1 {Rattus norvegicus} MTERMSLSNDTQAHPSSFLLLGIPGLEDAHIWIGFPFCFLYLIAILGNVAILFVIQTEHSLHEPMYYFLAMLDSIDLGLTTATIPKMLGIFWFNLREISFGGCLSQMFFI
148 >lcl|NP_001000181.1|Plus1complement(5392252..5393193) NW_047562 olfactory receptor Olr183 Olr183 __SEG__ Chr1 {Rattus norvegicus} MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLIAVLGNVILLFVVHLEHSLHQPMFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFT
149 >lcl|NP_001000182.1|Plus1complement(5403304..5404257) NW_047562 olfactory receptor Olr184 Olr184 __SEG__ Chr1 {Rattus norvegicus} MTERMSLSNDTQAHPSSFLLLGIPGLEDAHVWIGFPFCFLYLIAILGNAAILFVIQTEHSLHEPMYYFLAMLDSIDLGLTTATIPKMLGIFWFDLREISFGGCLSQMFFI
153 >lcl|NP_001000186.1|Plus1complement(5505286..5506227) NW_047562 olfactory receptor Olr193 Olr193 __SEG__ Chr1 {Rattus norvegicus} MALSNNNSEAPTPEFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRMEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDHKSIGFSACFLQMFVMNSF
154 >lcl|NP_001000187.1|Plus1complement(5575882..5576832) NW_047562 olfactory receptor Olr196 Olr196 __SEG__ Chr1 {Rattus norvegicus} MALSNSSWRQPQPPFFLVGVPGLEESQHWIALPLGVLYLLALVGNVTIIFIIWTDSSLHQPMYLFLAMLAAIDLVLASSTAPKALTVLLAHAHEIGYIVCLTQMFFIHAF
155 >lcl|NP_001000188.1|Plus1complement(5596079..5597032) NW_047562 olfactory receptor Olr197 Olr197 __SEG__ Chr1 {Rattus norvegicus} MTFSNNSLLLPHTFFLTGIPGLTAAHVWISLPFCFMFVLSLTGNAVLLSLIWKEHRLHQPMFLFLAMLSFVDLVLSLSTLPKMLAIFWFGATAISSYACLSQMFLIHAFS
156 >lcl|NP_001000190.1|Plus1complement(5679412..5680356) NW_047562 olfactory receptor Olr201 Olr201 __SEG__ Chr1 {Rattus norvegicus} MLGANFTIIHPAVFILLGIPGLEQYHTWLAIPFCLMYIAAVLGNGALILVPSEHTLHEPMYVFLSMLAGTDILLSTSTVPKALAIFWFHAGEIPFDACIAQMFFIHVAFV
158 >lcl|NP_001000192.1|Plus1complement(6443309..6444256) NW_047562 olfactory receptor Olr204 Olr204 __SEG__ Chr1 {Rattus norvegicus} MELWNSTLGSGFILVGILDGSGSPELLCATITALYFLALTSNGLLLLVITMDARLHVPMYLLLGQLSLMDLLLTSVITPKAVVDFLLKDNTISFGGCALQMFLELALGSA
159 >lcl|NP_001000193.1|Plus1complement(6502229..6503176) NW_047562 olfactory receptor Olr206 Olr206 __SEG__ Chr1 {Rattus norvegicus} MELWNSTLGSGFILVGILDGSGSPELLCATITALYFLALTSNGLLLLVITMDARLHVPMYLLLGQLSLMDLLLTSVITPKAVVDFLLKDNTISFGGCALQMFLELALGTA
160 >lcl|NP_001000194.1|Plus1complement(6537705..6538655) NW_047562 olfactory receptor Olr208 Olr208 __SEG__ Chr1 {Rattus norvegicus} MELWNSTLGSGFILVGILDDSGSPELLCATFTALYMLAMISNGLLLLVITMDPQLHVPMYLLLWQLSLMDLLLTSVITPKAVIDFLLKDNTISFGGCALQMFLELTLGGA
162 >lcl|NP_001000196.1|Plus1complement(6596734..6597660) NW_047562 olfactory receptor Olr211 Olr211 __SEG__ Chr1 {Rattus norvegicus} MGGRNKTYIVEFILLGLSENPKVQILLFCIFLVIYFLSVFGNLLIIILIHIDSRLHTPMYFFLKNLSFADLCFSTSIVPQMLVHFLSKKKTISFIGCSIQIVVFLLAGCT
165 >lcl|NP_001000199.1|Plus1complement(6712035..6712985) NW_047562 olfactory receptor Olr217 Olr217 __SEG__ Chr1 {Rattus norvegicus} MELWNFTLGSDFILVGILDDSGSPELLCATFTALYILALISNGLLIMVITMDARLQVPMYFLLGQLSLMDLLFTSVVTPKAVIDFLLGDNTISFEGCALQMFLALTLGGA
166 >lcl|NP_001000200.1|Plus1complement(6789488..6790411) NW_047562 olfactory receptor Olr221 Olr221 __SEG__ Chr1 {Rattus norvegicus} MGEHNRTSVTEFILLGLSQDPQTQVLLFFLFLLIYLLTVLGNLLIIVLIHSDPRLHTPMYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKAISFAGCSIQLVMLLLVGCT
167 >lcl|NP_001000201.1|Plus1complement(6816128..6817060) NW_047562 olfactory receptor Olr222 Olr222 __SEG__ Chr1 {Rattus norvegicus} MGKLNDTYLTEFILLGLSSDHQTQILLFVVFLIIYLITVFGNLLIILLIHVDSRLHTPMYFFLKILSLNDLCFSTTIVPKMLVHFLGVRKTISFAGCSMQMFFFLIMGCT
168 >lcl|NP_001000202.1|Plus1complement(6834813..6835763) NW_047562 olfactory receptor Olr223 Olr223 __SEG__ Chr1 {Rattus norvegicus} MENITSISEFILMGFPTAPWLQILLFFIFFITYLFVLLENLIIILTVWVTGSLHKPMYYFLSTMSFLEAWYISVTVPKMLAGFLFRPNTISFLGCMTQLYFFMSLACTEC
170 >lcl|NP_001000204.1|Plus1complement(6971598..6972542) NW_047562 olfactory receptor Olr229 Olr229 __SEG__ Chr1 {Rattus norvegicus} MGRENQTFVVEFLLLGLSQDAQTQILLFVLFFIIYVLTVLGNLLIIILILMDSRLHTPMYFFLRNLSFADLCLSSSIVPQVLSHFLVKRKTISFWGCVTQVIVSLQIGCT
173 >lcl|NP_001000207.1|Plus1complement(7020627..7021574) NW_047562 olfactory receptor Olr233 Olr233 __SEG__ Chr1 {Rattus norvegicus} MRQANQTQVTEFLLLGLSDDPHTQTLLFILFLGIYLVTVLGNLLLMFLVWADSRLHTPMYFFLCNLSLADLCFSTNIVPQALTHLLSRKKSISFRRCAAQLLLFLIFGCT
176 >lcl|NP_001000210.1|Plus1complement(7856253..7857197) NW_047562 olfactory receptor Olr237 Olr237 __SEG__ Chr1 {Rattus norvegicus} MAFQEDGNHTTVTEFILLGLTDDPVLKVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLVNFLVERSTISYLGCTIQLGSGAFF
177 >lcl|NP_001000211.1|Plus1complement(7873074..7874012) NW_047562 olfactory receptor Olr239 Olr239 __SEG__ Chr1 {Rattus norvegicus} MKPGNHTMVTEFIILGLTEDPTLCCIFFVLFLGVYLTTVLGNASIIMLIRRSPQLHTPMYLFLSHLAFVDIGYSSSVTPVMIVNFLRERTAIPVAGCIVQLGSDVVFGTA
179 >lcl|NP_001000214.1|Plus1complement(8017212..8018156) NW_047562 olfactory receptor Olr244 Olr244 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILFGLTRDPVLRVILFIVILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVERHTISYIGCAIQLGSVVFF
183 >lcl|NP_001000218.1|Plus1complement(8172781..8173725) NW_047562 olfactory receptor Olr251 Olr251 __SEG__ Chr1 {Rattus norvegicus} MSWLENGNHTTVAEFLLLGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLVNFLVERNIISYLGCGIQLSLVAFF
184 >lcl|NP_001000219.1|Plus1complement(8199111..8200082) NW_047562 olfactory receptor Olr252 Olr252 __SEG__ Chr1 {Rattus norvegicus} MALLKHGNNTAVTEFILLGLTDDKVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLGFADMGYSSSVTPNMLVNFLIKQNTISYLGCSIQFGSAALF
186 >lcl|NP_001000221.1|Plus1complement(8430054..8431010) NW_047562 olfactory receptor Olr262 Olr262 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILLGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLFNFLVEKNTISYLGCAIQLSLAAFC
187 >lcl|NP_001000222.1|Plus1complement(8380629..8381570) NW_047562 olfactory receptor Olr259 Olr259 __SEG__ Chr1 {Rattus norvegicus} MAFLERNHTVVTEFILLGLTDDPVLRLLLFTIILCIYLVTVSGNLSTILLIRVSPQLHHPMYFFLSHLASVDIGISSSVTPNMLVNFLVKRNTISYLGCGIQLSSAAFFG
191 >lcl|NP_001000226.1|Plus1complement(8770360..8771304) NW_047562 olfactory receptor Olr279 Olr279 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNYTAVTEFILLGLTDDPVLRVILFIIILCIYLVTVSGNFSTILLIRVSSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVERNTISYLGCGIQLGSAVFF
197 >lcl|NP_001000233.1|Plus1complement(8823716..8824648) NW_047563 olfactory receptor Olr295 Olr295 __SEG__ Chr1 {Rattus norvegicus} MARPNQTVVTEFVLQGFSEHPTLRLFLTGCFLSLYAMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMAQLFFLVWSLSS
198 >lcl|NP_001000234.1|Plus1complement(8852815..8853738) NW_047563 olfactory receptor Olr297 Olr297 __SEG__ Chr1 {Rattus norvegicus} MAPVNQSVVTMFILQNFVDDPWIQDVLFCLFFALFMMAIAGNGLIIMTIYSSANLHTPMYFFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFVFSWVLGSE
199 >lcl|NP_001000235.1|Plus1complement(8907608..8908519) NW_047563 olfactory receptor Olr298 Olr298 __SEG__ Chr1 {Rattus norvegicus} MNGTLVTEFLILGFSEMPHLRVPLLSFLCLYMAAISGNLLIMVTVSASPALHTPMYFFLVNLAVVDILCTSTILPKLLDIMVGGRTISYGGCMAQLFFFTWSMGAELLLF
200 >lcl|NP_001000236.1|Plus1complement(8926803..8927732) NW_047563 olfactory receptor Olr299 Olr299 __SEG__ Chr1 {Rattus norvegicus} MAVSNYTTVVEFVLQGLSGDPRLQALFLVFFSLLYILALAGNTLIIIAITLNPSLHTPMYFLLANLALLDIVCTSTVLPKLLEGLVGKSSHISYKGCLTQIFFMTWILAA
203 >lcl|NP_001000239.1|Plus1complement(9010046..9010969) NW_047563 olfactory receptor Olr303 Olr303 __SEG__ Chr1 {Rattus norvegicus} MASGNQSAITMFILQSFIDDPWIQNVLFCLFFALFVAAIAGNGLIITVIHSSANLHTPMYFFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFIFTWVLGSE
208 >lcl|NP_001000244.1|Plus1complement(23419848..23420780) NW_047563 olfactory receptor Olr321 Olr321 __SEG__ Chr1 {Rattus norvegicus} MELRNNTRVKEFIFLGLTQSQHLSLVLFLVLCFVYVTTLLGNLLIMIIVTFESRLHTPMYFLLRNLAILDICFSSITAPKVLVDLLTKKKTISYAECMTQMFFFHLLGGA
209 >lcl|NP_001000245.1|Plus1complement(23467816..23468751) NW_047563 olfactory receptor Olr323 Olr323 __SEG__ Chr1 {Rattus norvegicus} MENYTRVKELIFLGLTQSHEVSMVLFLFLLLVYVTTLLGNLLIMVTVTYESRLHTPMYFLLRNLSIADICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDV
210 >lcl|NP_001000246.1|Plus1complement(23482239..23483174) NW_047563 olfactory receptor Olr324 Olr324 __SEG__ Chr1 {Rattus norvegicus} MELRNHTKVTEFIFCGLTQSQELSLLLFFFLSVVYIATVLVNVTIMVTVTWESHLHTPMYFLLRNLSVLDICFSSITVPKVLMDLLSRRKTISFNGCFTQIFFFHLLGGA
211 >lcl|NP_001000247.1|Plus1complement(23491013..23491957) NW_047563 olfactory receptor Olr325 Olr325 __SEG__ Chr1 {Rattus norvegicus} MGQINHTHVKEFVFLALTRFRELEFFLFSVFFLVYVTTVLGNALIVVTITSESRLHTPMYFLLRNKSVLDIVFSSITVPKLLVDLLSERKAISYNGCLTQIFFFHFAGGA
212 >lcl|NP_001000248.1|Plus1complement(23502740..23503693) NW_047563 olfactory receptor Olr326 Olr326 __SEG__ Chr1 {Rattus norvegicus} MALTNPRNSSSVIMFIFLGFSDHPELRTFLFLTFLGIYLVTLTWNLALIFLIRGDIRLHTPMYFFLSNLSFVDICYSSSVAPKMLFDFFREQKTISFLGCAAQFFFFVGL
213 >lcl|NP_001000250.1|Plus1complement(23765618..23766577) NW_047563 olfactory receptor Olr332 Olr332 __SEG__ Chr1 {Rattus norvegicus} MAGGRNSTTVTRFILLGFSDQPQIKAFLFMFFLGIYLLTLAWNLSLITLIRMDSHLHTPMYFFLSNLSFLDICYSSSTAPKMLSDIVTDENTISFLGCATQYFVFCGMGL
217 >lcl|NP_001000254.1|Plus1complement(24577039..24577983) NW_047563 olfactory receptor Olr343 Olr343 __SEG__ Chr1 {Rattus norvegicus} MKNSTEVTEFILAGLTDDPELQIPLFIVFLLIYLSTLLGNLGMVGLILLDSHLHTPMYLFLSHLSLVDFGYSSAVTPKVMAGLLSIDKTISHNACGTQFFFFVGFITTES
224 >lcl|NP_001000261.1|Plus1complement(25450719..25451654) NW_047563 olfactory receptor Olr379 Olr379 __SEG__ Chr1 {Rattus norvegicus} MDKVNLTLVTEFFLIAFTEHPEWGLPLFHLFLFIYFFTLLGNSGMIFLIRTDHRLHTPMYFLLSHLSFMDICYSSVTVPQTMAVLLEHGAALSYARCVAQFFLFTFFGSI
225 >lcl|NP_001000262.1|Plus1complement(25542368..25543315) NW_047563 olfactory receptor Olr383 Olr383 __SEG__ Chr1 {Rattus norvegicus} MADNGTRLTEFILMGFQLQAEIQLGLFFMFLAFYLITIVGNLGMIMLIQSDPQLHTPMYFFLSHLSFLDICYSSVIVPQLLETLGNNKMVITYERCATQFFFFTLYASTE
227 >lcl|NP_001000266.1|Plus1complement(178032..178970) NW_047596 olfactory receptor Olr1671 Olr1671 __SEG__ Chr20 {Rattus norvegicus} MVENFNASWEGYFIFLGFSKWPHLEVVLFVVILIFYMMTLTGNLFIIVLSHLDSHLYTPMYFFLSNLSALDLCYTTSSVPQLLFNLWGPEKTISYAGCMLQLYFVLALGT
229 >lcl|NP_001000268.1|Plus1complement(196471..197409) NW_047596 olfactory receptor Olr1673 Olr1673 __SEG__ Chr20 {Rattus norvegicus} MTPINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDMCYTTSIVPQMLINLGGSTKTISYMRCAIQLYFYHTMGGT
230 >lcl|NP_001000269.1|Plus1complement(334752..335690) NW_047596 olfactory receptor Olr1683 Olr1683 __SEG__ Chr20 {Rattus norvegicus} MKLINTSHPEEFILLGFADRPWLELSLFIILLVTYPTAMIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLGGSTKTISYMRCAVQLYFFHTMGGT
233 >lcl|NP_001000272.1|Plus1complement(678312..679277) NW_047596 olfactory receptor Olr1695 Olr1695 __SEG__ Chr20 {Rattus norvegicus} MINSSVNSDFILVGFSDQPQLEKRLFIVVLISYLLTLVGNTIIILISSIDSKLKTPMYYFLTHLSFVDICFTTSIVPQLLWNLKGPAKTITAVGCVVQLYVSLTLGSTEC
234 >lcl|NP_001000273.1|Plus1complement(609214..610185) NW_047596 olfactory receptor Olr1691 Olr1691 __SEG__ Chr20 {Rattus norvegicus} MTARNITTMSGFLLMGFSDNHELQVLQALLFLVTYLLGTAGNFIIITITTLDPKLQSPMYYFLKHLSILDLSSLSVTVPQYVYSSLAQSGYISFGQCVMQVFFFTALAWT
235 >lcl|NP_001000274.1|Plus1complement(581243..582214) NW_047596 olfactory receptor Olr1690 Olr1690 __SEG__ Chr20 {Rattus norvegicus} MTAKNITTMSGFLLKGFSDNHELQILQALFFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVYSSLAQSGYISYGQCMMQVFFFTALAWS
238 >lcl|NP_001000277.1|Plus1complement(1185189..1186118) NW_047596 olfactory receptor Olr1724 Olr1724 __SEG__ Chr20 {Rattus norvegicus} MNCTQAPGFILLGLSRDPEKWQLFFSIFLALYLLGLLGNLLLLLAIGADIHLHTPMYFFLSQLSLVDLCFITTTAPKMLQALWTGDGSISFSGCLTQFYFFAVFADMDNL
240 >lcl|NP_001000281.1|Plus1complement(10009733..10010662) NW_047657 olfactory receptor Olr439 Olr439 __SEG__ Chr3 {Rattus norvegicus} MGHSNDTKVTEFILLGFAGQHESWHILFVVFLIIYIATLVGNIGMILLIKLHSSLHTPMYFFLQHLAFVDLCYSSAITPKTLQNFVSSKPSISFTGCIVQLLVYGIFVTS
241 >lcl|NP_001000282.1|Plus1complement(10027080..10028027) NW_047657 olfactory receptor Olr440 Olr440 __SEG__ Chr3 {Rattus norvegicus} MIQYNETEVKGFYLLGFGVRHDIQYVLFIVFLVIYVTSMLGNTGMILLIHTDSRLQTPMYFFLQHLAFVDICYTSAITPKMLQNFVVEDRSISFGGCVAQLLIYAIFATC
242 >lcl|NP_001000283.1|Plus1complement(10048178..10049122) NW_047657 olfactory receptor Olr441 Olr441 __SEG__ Chr3 {Rattus norvegicus} MAQDNGTKVTDFYLLGFGVQRDIQCILFIVFLVIYVISMVGNTGMILLINTDSRLQTPMYFFLQHLAFVDICYTSAITPKMLQNFMVEDKSITFKGCVVQLFVYAIFATS
243 >lcl|NP_001000284.1|Plus1complement(10058592..10059539) NW_047657 olfactory receptor Olr442 Olr442 __SEG__ Chr3 {Rattus norvegicus} MTQRNATEVTDFYLLGFGVQQNTQCVLFIVFFVIYVTSMVGNTGMILLINTNSRLQTPMYFFLQNLAFVDICYTSAITPKMLQSFMVEDCSISYTGCVIQLLVYATFATS
246 >lcl|NP_001000288.1|Plus1complement(10292766..10293704) NW_047657 olfactory receptor Olr450 Olr450 __SEG__ Chr3 {Rattus norvegicus} MEVDNRTILTEFILVGFSADPHWQLVLFGIFLTIYLLTLSGNMMLVVLIRIDSKLHTPMYFFISNLSFLDFWYTSVYTPKILATCISEDKRISLAGCGAQLFFSCVVAYT
249 >lcl|NP_001000291.1|Plus1complement(10369547..10370482) NW_047657 olfactory receptor Olr455 Olr455 __SEG__ Chr3 {Rattus norvegicus} MERSNHTVTDFILLGFSTDPVMEKILFVLFLGVYSMTLIGNTTLIILICNDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLAQFFFSAGLAYSE
251 >lcl|NP_001000293.1|Plus1complement(10439749..10440678) NW_047657 olfactory receptor Olr459 Olr459 __SEG__ Chr3 {Rattus norvegicus} MERGNHTVSEFILLGFTSDPTTQLVLFVMFLIMYTLTVLGNCILMVLICSDPKLHTPMYFFIGNLSFLDLWLSTVYTPKILVICISENKSMSFASCVAQFFFSAGLDYSE
253 >lcl|NP_001000295.1|Plus1complement(10489119..10490051) NW_047657 olfactory receptor Olr462 Olr462 __SEG__ Chr3 {Rattus norvegicus} MHKENHSVVTEFIFMGITQDPQLQIIFFVVFLIVYLVNVIGNVGMIILIITDSQLHTPMYFFLCNLSFVDLGYSSAIAPRMLADCLTKHKVISFSSCATQFAFFVGFVDA
261 >lcl|NP_001000303.1|Plus1complement(10654496..10655461) NW_047657 olfactory receptor Olr476 Olr476 __SEG__ Chr3 {Rattus norvegicus} MAERNSTGVTEFILLGFAVHREVEIILFMLILVVYSLTLIGNVGMISLIRMDSRLHTPMYFFLSNLAFVDLCYSSSVAPKFLEILLSNKRSISFYACATQLGFFLNFLIS
263 >lcl|NP_001000305.1|Plus1complement(10710389..10711330) NW_047657 olfactory receptor Olr479 Olr479 __SEG__ Chr3 {Rattus norvegicus} MADGNISAVSQFIFVGLTDDPGLEIILFAVFLVIYLTTVSGNLGLIMLIHYSPQLHTPMYFFLSHLAFVDFCYTSSVTPNTIINFLRKVKSITFYACATQVCCFITFAVC
264 >lcl|NP_001000306.1|Plus1complement(10780118..10781065) NW_047657 olfactory receptor Olr484 Olr484 __SEG__ Chr3 {Rattus norvegicus} MAPRNLSHITEFILVGVSDLPELQVPLFFVFLIIYLLTAAGNLGIITLTTVDSRLQTPMYFFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVA
265 >lcl|NP_001000307.1|Plus1complement(10795712..10796662) NW_047657 olfactory receptor Olr485 Olr485 __SEG__ Chr3 {Rattus norvegicus} MGKFNHTARTQVTEFILLGLTNNPDLKAPLFGLFLTIYLVTLMGNLGMVVLTHLDSKLHTPMYFFLRHLSITDLGYSTVIGPKMMVNFVMQQNIISYTECAVQLTFFEIF
266 >lcl|NP_001000308.1|Plus1complement(10833242..10834168) NW_047657 olfactory receptor Olr488 Olr488 __SEG__ Chr3 {Rattus norvegicus} MAQPNVTMPTEFILMGVTQTAVLKLPLFAVFLAVYAITVVGNLGMIILTKLDSRLHTPMYFFIRHLAFIDLGNSTTICPKMLVNFVVDQNTITYYACATQMACFIMFIVS
267 >lcl|NP_001000309.1|Plus1complement(10916695..10917636) NW_047657 olfactory receptor Olr493 Olr493 __SEG__ Chr3 {Rattus norvegicus} MENQNLSVLSEFILLGITDRPELQAPFFVLFFLIYVASMVGNLGMIILTKLDERLQTPMYFFLRHLAFIDFGYSTAVGPKTLVNFVTNNNTIPYNWCAIQLSLFIFFIIS
268 >lcl|NP_001000310.1|Plus1complement(10932105..10933052) NW_047657 olfactory receptor Olr495 Olr495 __SEG__ Chr3 {Rattus norvegicus} MAPGNLTHVTEFILMGVSDRPELQVPLFFLFLVIYLLTAAGNLGIITLTTVDSRLQTPMYFFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVA
269 >lcl|NP_001000311.1|Plus1complement(11023872..11024813) NW_047657 olfactory receptor Olr502 Olr502 __SEG__ Chr3 {Rattus norvegicus} MESHNFTMVTEFILVGITDSSELQVPLFGLFLFIYLITLVGNLGMVILTMVESRLQTPMYFFLRYLATTDLGYSTAVGPKMLRNFLVEQNTISFYFCAVQLSFFNMFIVS
270 >lcl|NP_001000312.1|Plus1complement(11149812..11150744) NW_047657 olfactory receptor Olr510 Olr510 __SEG__ Chr3 {Rattus norvegicus} MENITEVTEFILKGFTDNADLEILSFFLFLAIYLFTLMGNIGLIALVIGDSRLHNPMYYFLSVLSSVDACYSSVITPQMVVDFLLEKKVISFIGCATQMFLAVTFGTTEC
271 >lcl|NP_001000313.1|Plus1complement(11204843..11205778) NW_047657 olfactory receptor Olr513 Olr513 __SEG__ Chr3 {Rattus norvegicus} MEKQNLTVVNDFILIGFTNHPDLKGPLFVLFLIIYLISFMGNMGMIILTIVDSRLQTPMYFFLKHLAVTDLGYSTAVGPKMLENFVVNQNTISYYLCATQLACFLLFVTC
272 >lcl|NP_001000314.1|Plus1complement(11221222..11222163) NW_047657 olfactory receptor Olr514 Olr514 __SEG__ Chr3 {Rattus norvegicus} MKEHNFTVMTEFILLGITDRSDLEVPLFGLFLVIYMTSMVGNLGIIVLTKVDSRLQTPMYFFLRHLAITDLGYSTAVGPKMLENFVVDQNTISFHLCATQLAFFLVFIGS
274 >lcl|NP_001000316.1|Plus1complement(11284441..11285376) NW_047657 olfactory receptor Olr516 Olr516 __SEG__ Chr3 {Rattus norvegicus} MKNITEATSFILKGLTDNMELQIILFFLFLAIYLFTLIGNVGLIILVVGDPQLHNPMYCFLSVLSSVDACYSSDITPNMLVGFMSKSKIISIHGCATQMFLAVTFGTTEC
277 >lcl|NP_001000319.1|Plus1complement(11680872..11681813) NW_047657 olfactory receptor Olr528 Olr528 __SEG__ Chr3 {Rattus norvegicus} MNAWNHTTETEFILMGLTDSKEVQLVLSVLFLLIYMLTVLGNIGMILIIHLDVQLHTPMYFFLTHLSFLDLSYSTVITPKTLQNLLTSIKNISFMGCFTQLYFFVLLAAT
278 >lcl|NP_001000320.1|Plus1complement(11839762..11840700) NW_047657 olfactory receptor Olr539 Olr539 __SEG__ Chr3 {Rattus norvegicus} MANVNFTFVTEFILLGLTDRGEIKVFLFILFLLIYVISLVGNLGLFMLIHITPKLHTPMYHFLRSLSFVDACYSSVFAPTLLLNFFVERERISFSACILQYFLFASLLTT
279 >lcl|NP_001000321.1|Plus1complement(11881336..11882274) NW_047657 olfactory receptor Olr540 Olr540 __SEG__ Chr3 {Rattus norvegicus} MRLWNHTGVKEFILVGLTENLNWQVGLLFLFSIIYFIILVGNWGMILLIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSKYKSSTFFGCVIQSFFFAVYITT
280 >lcl|NP_001000322.1|Plus1complement(12187515..12188453) NW_047657 olfactory receptor Olr550 Olr550 __SEG__ Chr3 {Rattus norvegicus} MRLWNHTGVEEFILVGLTENLNWQVGLFFLFSIVYFIILVGNWGMILLIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSEYKSSTFFGCVIQSFFFAVYITT
283 >lcl|NP_001000326.1|Plus1complement(12597218..12598144) NW_047657 olfactory receptor Olr567 Olr567 __SEG__ Chr3 {Rattus norvegicus} MVKRNCSSLDEFIFLGITNNPEMKVALFTTFLLVYLINLLANLGMIILIRMDTQLHTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAEEKSIPTVGCALQFFTLCAFVDS
285 >lcl|NP_001000328.1|Plus1complement(12740276..12741202) NW_047657 olfactory receptor Olr576 Olr576 __SEG__ Chr3 {Rattus norvegicus} MDKKNCSSVGEFIFLGITNNPDMKVALFTTLLLVYLINLLANLGMIILIRVDTQLQTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAEEKSIPIVGCALQFFTFCVFADS
290 >lcl|NP_001000333.1|Plus1complement(13133088..13134026) NW_047657 olfactory receptor Olr602 Olr602 __SEG__ Chr3 {Rattus norvegicus} MVEENCSTVAQFILLGFSDVPELSGFLSSIVLLIYGVTVLANLGMTTLIQFSSQLHTPMYFFLSHLSFVDFCYSSVIVPKMLANIFNMDKAISFLACMVQFCLFCTCVIS
291 >lcl|NP_001000334.1|Plus1complement(13283967..13284917) NW_047657 olfactory receptor Olr607 Olr607 __SEG__ Chr3 {Rattus norvegicus} MVPMERNVSVEIIFVLVGFTDYPELQIPLFLVFLFMYIITVVGNLGMIVLINIDPKFHTPMYFFLSHLSFVDFCYPTIIMPKLLENLILADKTILYFSCMLQYFLSCVAV
292 >lcl|NP_001000335.1|Plus1complement(13316968..13317918) NW_047657 olfactory receptor Olr609 Olr609 __SEG__ Chr3 {Rattus norvegicus} MMLDLGNESTVTMFILLGFSEYPHLHAPLFLLFFMIYAVTLFGNMGIIVARKINPKLHTPMYFFLSHLSFLDICYSTVFTPKLLEILIVENKTISFKGCMTQFFFICAFV
293 >lcl|NP_001000336.1|Plus1complement(13343674..13344624) NW_047657 olfactory receptor Olr610 Olr610 __SEG__ Chr3 {Rattus norvegicus} MASEVTNQSSVTTFILVGFSEYPQLQIPLFLLFLAIYSVTLMGNLGILVVIKINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLQILIMEDRTISFTGCMIQFFFICTFV
294 >lcl|NP_001000337.1|Plus1complement(13386186..13387136) NW_047657 olfactory receptor Olr614 Olr614 __SEG__ Chr3 {Rattus norvegicus} MIHAMINQSSVTTFILVGFSEYPHLQLPLFLMILTIYTITLVGNVGIIVIRRINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLEILIVENRTIFLKDCMTQFFFGCACV
296 >lcl|NP_001000341.1|Plus1complement(14131116..14132042) NW_047657 olfactory receptor Olr651 Olr651 __SEG__ Chr3 {Rattus norvegicus} MQLNINVTEFILLGLTQDPSRKKIVLAIFVFFYMGTLIGNLLIIVTIKTSQALGSPMYFFLFYLSLSDTCFSTTVAPRTIVDSLLKTASISFNECIIQVFTFHLFGSLEI
298 >lcl|NP_001000343.1|Plus1complement(14271370..14272302) NW_047657 olfactory receptor Olr657 Olr657 __SEG__ Chr3 {Rattus norvegicus} MQLNINVTEIILLGLTQDPSRKNIVFAIFLFFYMGILLGNLLIIVTIKTSQALGSPMYFFLFYLSLSDTCFSTTVAPRTIVDSLLKEASISFTECIIQVFTFHFFGCLGI
299 >lcl|NP_001000344.1|Plus1complement(14285777..14286706) NW_047657 olfactory receptor Olr658 Olr658 __SEG__ Chr3 {Rattus norvegicus} MENHKNVTEFIFMGLWENRQIELLFFLLFLLCYLAVLMGNSVILVTITCSHLIEQPMYYFLCHLSLMDLCYTSTVIPRLIRDLAATRKNISYNECMTQLFTAHLLAGVEI
301 >lcl|NP_001000346.1|Plus1complement(14418252..14419187) NW_047657 olfactory receptor Olr663 Olr663 __SEG__ Chr3 {Rattus norvegicus} MQNQSLVTEFIFLGLSQNPKFQKIVFIVFLFVYIATVGGNMIIVVTIVCSPALIDCPMYFFLAFLSLLDACFSSVITPKMVVDSLYEKKTISFEGCMIQLFAEHFLAAVE
303 >lcl|NP_001000348.1|Plus1complement(14570634..14571569) NW_047657 olfactory receptor Olr668 Olr668 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFLLLGLSQNPKVHKIIFIAFLFVYIATFGGNMIIVVTIINSHALLGSPMYFFLAFLSFLDACISSVITPKITVDLLYERRTISFDGCMAQVFAVHFFTGVE
304 >lcl|NP_001000349.1|Plus1complement(14586028..14586963) NW_047657 olfactory receptor Olr669 Olr669 __SEG__ Chr3 {Rattus norvegicus} MYNQSFVNEFILLGLSQNPQIKKISFVIFLLVYIATLVGNMMIVVTIAYSPALLGSPMYFFLAVLSFLDACVSSVVTPKMIVDMVYERKSISFECCMTQVFAVHFLTAVE
305 >lcl|NP_001000350.1|Plus1complement(14634516..14635430) NW_047657 olfactory receptor Olr672 Olr672 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNLNVEKMLFVLFLFIYLATIGGNMIIVITIMYSPTLLGSPMYFFLAFLSFLDACTSSTVTPKIIIDCFYERKIMSFDCCMIQLFAVHFFTGAE
306 >lcl|NP_001000351.1|Plus1complement(14710628..14711563) NW_047657 olfactory receptor Olr673 Olr673 __SEG__ Chr3 {Rattus norvegicus} MQNQSSVTEFVILGLSQNPKVEKILFFVLLLVYLATVGGNMIIVVTIMYSPALLSCPMYFFLAFLSFLDLCVSSTVTPKMIVDFLHEKKTISFGWCMTQLFSVHFFSGTE
307 >lcl|NP_001000352.1|Plus1complement(14719534..14720469) NW_047657 olfactory receptor Olr674 Olr674 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNVNVEKMLLVLFLFIYLSTIVGNMIIVVTIIYSPILLGSPMYFFLIFLSLLDAFTSSTVTPKIIIDCFYERKTICFECCMTQLFAVHFFTGAE
308 >lcl|NP_001000353.1|Plus1complement(14817553..14818488) NW_047657 olfactory receptor Olr678 Olr678 __SEG__ Chr3 {Rattus norvegicus} MQNQSLVSEFILLGLSQNTKVEKILFLLFLLIYLATIGGNMIIVATIIYSPALLGSPMYFFLVFLSLLDACTSTVVTPKMIIGFFYEMKTISFEGCMTQLFAIHFFTAVE
309 >lcl|NP_001000354.1|Plus1complement(14835467..14836402) NW_047657 olfactory receptor Olr679 Olr679 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVNEFILLGLSQNPKVEKILFVVFLLVYIATIGGNIMIVVTIIYSPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCITQLFTSHFFAGVE
311 >lcl|NP_001000356.1|Plus1complement(14942196..14943128) NW_047657 olfactory receptor Olr687 Olr687 __SEG__ Chr3 {Rattus norvegicus} MLNQSYINEFILLGLSQNSKVEKILFVIFLLIYLATIGGNMIIVVTIIYSPALLGSPMYFFLIFLSFLDACTSSTVTPKMMVDFFHERKTISFECCMTQLFAVHFFTGME
312 >lcl|NP_001000357.1|Plus1complement(15037112..15038038) NW_047657 olfactory receptor Olr694 Olr694 __SEG__ Chr3 {Rattus norvegicus} MELHSPTSNVTEFVLLGLTQNPSLQKILFIVFLFVFLFTVLANLLIVLTISFSPTLSAPMYFFLTYLSFIDAFYTSVTTPKMIIDLLYQRRTISLAGCLTQLFVEHFLGG
313 >lcl|NP_001000359.1|Plus1complement(15256037..15256984) NW_047657 olfactory receptor Olr703 Olr703 __SEG__ Chr3 {Rattus norvegicus} MGQRNNVTEFILLGLTQDPTGQKALFVMFLLIYIVTMVGNLLIVATVIASSSLDSPMYFFLAYLSIMDSVYSTSTSPKLIMDLLSDKKTISFTACMGQLFTEHLFGGAEV
314 >lcl|NP_001000360.1|Plus1complement(15502746..15503690) NW_047657 olfactory receptor Olr713 Olr713 __SEG__ Chr3 {Rattus norvegicus} MGQKNNVTEFILLGLTQDPAGQKALFVMFLLIYIVTMVGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEV
315 >lcl|NP_001000361.1|Plus1complement(15615524..15616468) NW_047657 olfactory receptor Olr718 Olr718 __SEG__ Chr3 {Rattus norvegicus} MGKNNNVTEFILLGLTQDPVGQKALFILFLLMYVVTMAGNLLIMVTIIASPSLSSPMYFFLAYLSLMDAVYSTAISPKLIMDLLCNKKTISFRACMGQLFVEHLFGATEI
316 >lcl|NP_001000362.1|Plus1complement(15678716..15679627) NW_047657 olfactory receptor Olr721 Olr721 __SEG__ Chr3 {Rattus norvegicus} MNNITEFILVGLTQNMELQIFSFVVFFIVYLLTLAGNLLIMVTISSSRALGSPMYFFLSFLSLIDGCCSSSMTPKMLVDSLSAKKTISFTGCMTQVFAEHFFGAAEIILL
318 >lcl|NP_001000364.1|Plus1complement(15901006..15901914) NW_047657 olfactory receptor Olr731 Olr731 __SEG__ Chr3 {Rattus norvegicus} MDSPRNVTEFFMLGLSQNPQVQRMLFVLFLLVFLVSVGGNVLIIITVAFSPTLGSPMYFFLSYLSFIDTCYSSCMTPKLIADSLHEGRAISFEGCLAQFFVAHLLGGTEI
320 >lcl|NP_001000366.1|Plus1complement(38249180..38250091) NW_047657 olfactory receptor Olr750 Olr750 __SEG__ Chr3 {Rattus norvegicus} MEKTNQSEGSEFIILGLCDSWELQAFFLVIFSSLYLTTILGNIFIVLIIITDLRLHSPMYFLLANLSFIDFCLSSVTTPKMIIDFLKEKKTISFGGCMCQIFFGHFFGGG
324 >lcl|NP_001000371.1|Plus1complement(38605064..38606002) NW_047657 olfactory receptor Olr769 Olr769 __SEG__ Chr3 {Rattus norvegicus} MDGENQTVVSEFIFWGLANSKNLQLLLFLIFLMLYLLIVSGNIVILILITTDPHLHSPMYFLLANLSFIDMWLSSNTTPKMITDFLWENKTISFAGCMSQVFFSHCIVGA
327 >lcl|NP_001000374.1|Plus1complement(38826110..38827048) NW_047657 olfactory receptor Olr775 Olr775 __SEG__ Chr3 {Rattus norvegicus} MHGENQTVVSEFIFWGLANSKNLQILLFLIFLMLYLLIVSGNIVILILITTDPYLHSPMYFLLANLSFIDMWLSSNTTPKMITDILRENKTISFAGCMSQVFFSHCIVGA
328 >lcl|NP_001000375.1|Plus1complement(38934397..38935359) NW_047657 olfactory receptor Olr781 Olr781 __SEG__ Chr3 {Rattus norvegicus} MEGVNQSMVSEFVFLGLTNSWDIQLFLFVFSSIFYVASMTGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKHKVISFRGCVTQIFFIHFIGGV
329 >lcl|NP_001000376.1|Plus1complement(38985120..38986058) NW_047657 olfactory receptor Olr783 Olr783 __SEG__ Chr3 {Rattus norvegicus} MGEANCSVVSEFVFLGLSNSWAIQLFLFFFSCIFYVASLLGNFLIVLTVTSDPQLQSPMYFLLGNLSIIDLIFCSSTTPKMIYDLLRKHKTISFGGCITQIFFIHAVGGT
330 >lcl|NP_001000377.1|Plus1complement(39135659..39136597) NW_047657 olfactory receptor Olr789 Olr789 __SEG__ Chr3 {Rattus norvegicus} MEGKNHSIVSEFMFVGLTNSWKMEILLFVFASVFYMGSMMGNSLIIFTVASDPHLHSPMYFLLANLSFIDLGVSCVTCPKMIYDLFRKQKVISFNGCITQIFFIHVIGGV
338 >lcl|NP_001000385.1|Plus1complement(2381217..2382158) NW_047653 olfactory receptor Olr411 Olr411 __SEG__ Chr3 {Rattus norvegicus} MRLKNHSSVSEFLLLGLPIRAEQSGIFFSMFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTVPKMLTKVPNQNIPITYEGCVSQTYFFIFFADL
340 >lcl|NP_001000387.1|Plus1complement(2442128..2443063) NW_047653 olfactory receptor Olr416 Olr416 __SEG__ Chr3 {Rattus norvegicus} MENQSSVSEFFLRGISGFPEQQQLLYGLFLCMYLVTLTGNVLIILAIGSDPHLHTPMYFFLANLSFADMGLISSTVTKMLFNVQTQCHTISYTGCLTQMYLFMMFGDLDS
343 >lcl|NP_001000390.1|Plus1complement(2552647..2553600) NW_047653 olfactory receptor Olr422 Olr422 __SEG__ Chr3 {Rattus norvegicus} MATKNKTEVTEFVLLGLSSRPEMQPVIFGVVLIMYLIAVLGNTLLVLVACSDPKLQTPMYFLLSQLSLIDISLTTITVPQMLVHTLSVDRSISYNCCMTQLFFFMAVGSM
345 >lcl|NP_001000392.1|Plus1complement(2625884..2626876) NW_047653 olfactory receptor Olr424 Olr424 __SEG__ Chr3 {Rattus norvegicus} MATKNRTEVTEFVLMGLSSQPEMQPVIFGVVLIMYLMAVLGNTLLVLVACSDPKLQTPMYFLLSQLSLIDISLTTIIVPQMLVHTLSVSRTISYNCCMTQLFSFMTVGSM
346 >lcl|NP_001000393.1|Plus1complement(2643331..2644284) NW_047653 olfactory receptor Olr425 Olr425 __SEG__ Chr3 {Rattus norvegicus} MNCAPNASHSPIFLLLGFSRAGLPDSLLFLLFLFIYLTTILGNVTLVLLISWDSRLHSPMYYLLRGLSMIDLGLSTVTLPQLLVHLASDSPAIPAARCLTQFFFFYAFGV
351 >lcl|NP_001000399.1|Plus1complement(7329360..7330310) NW_047713 olfactory receptor Olr852 Olr852 __SEG__ Chr5 {Rattus norvegicus} MEWENQTYLEEFFLKGLSGYPGLEHLFFVLILIMYAVILVGNGTLIIIIIFDSHLHTPMYFFLGNLSFLDICFTTSSIPFTLVSFLSERKTISFLGCAVQMFLGLAMGTT
352 >lcl|NP_001000400.1|Plus1complement(7288722..7289681) NW_047713 olfactory receptor Olr851 Olr851 __SEG__ Chr5 {Rattus norvegicus} MARTNDSMLTEFLLVGLSDHPKLQTVLFALVLCMYLMILLGNGILISVVIYDIHLHTPMYFFLCNLSFLDICYTSSSVPLILSSFLSVKKRVSFPECLIQMFFSFAMGAT
353 >lcl|NP_001000401.1|Plus1complement(7224276..7225226) NW_047713 olfactory receptor Olr850 Olr850 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLLGLSGYPKTEILYFVIMLVMYLVILTGNGVLIIASIFDSHLHTPMYFFLGNLSFLDICYTTSFVPSTLVNLISKKGNISFSGCAVQMFVAFAMGST
355 >lcl|NP_001000403.1|Plus1complement(7144348..7145301) NW_047713 olfactory receptor Olr847 Olr847 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLLGLSGYPKTEILYFVIILVMYLVILTGNGVLIIASIFDSHLHTPMYFFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGST
356 >lcl|NP_001000404.1|Plus1complement(7080137..7081090) NW_047713 olfactory receptor Olr845 Olr845 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLMGLSGYPKAKIVYFVIILVMYLVILTGNGVLIIASIFDSHLHTPMYFFLGNLSFLDICYTTSSVPSTLVSLISKKGNISFSGCAVQMFVGFAMGST
368 >lcl|NP_001000416.1|Plus1complement(14451419..14452375) NW_047773 olfactory receptor Olr1095 Olr1095 __SEG__ Chr7 {Rattus norvegicus} MAVTLGRNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATIWSEHSLHTPMYRFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFMF
372 >lcl|NP_001000421.1|Plus1complement(12042578..12043537) NW_047773 olfactory receptor Olr1075 Olr1075 __SEG__ Chr7 {Rattus norvegicus} MESGNDTQLSEFFLLGFSEKQPEIQPLIFGLFLSMYLVTVTGNLLIIVAIIVDAHLHTPMYIFLSNLSFVDICFTSTTVPQMLVNIHTQSKVITYAGCITQMYFLLLFSG
373 >lcl|NP_001000423.1|Plus1complement(3837206..3838135) NW_047784 olfactory receptor Olr1106 Olr1106 __SEG__ Chr7 {Rattus norvegicus} MRNRSTVPEFFLLGLSADTQIQIPLFVLFLVIYLLTLVGNLLLLLVVKVDRHLHTPMYFFLGQLSFLDLCHSSVTVPKLLENLLSVKKTISVEGCLAQVFFVFATGGTES
377 >lcl|NP_001000427.1|Plus1complement(13988468..13989442) NW_047798 olfactory receptor Olr1139 Olr1139 __SEG__ Chr8 {Rattus norvegicus} MWPLISPPLLIFFRNTEYRNQTFASGFILLGLTDDPELQLILFGIFLFMYLVTVLGNLIIILAVILDSHLHTPMYFFLSNLSFTDICFITSTVPKMLVNIQRESNAISYT
378 >lcl|NP_001000428.1|Plus1complement(13788103..13789041) NW_047798 olfactory receptor Olr1130 Olr1130 __SEG__ Chr8 {Rattus norvegicus} MEVKNKSVVLDIFLRGLTDDTELQPFIFGFFLCMYLITIFGNLPIMLVINCDSHLHTPMYFFLCHLSFNDMYLISVTVPKMLLNIQTHDQKITFAGCLSQGCFVAVCTIF
379 >lcl|NP_001000429.1|Plus1complement(14225015..14225932) NW_047798 olfactory receptor 1145 Olr1145 __SEG__ Chr8 {Rattus norvegicus} MELENQTRVIEFFLLGFSEDPELQPILFGLFLLIYLVTICGNLLIILAIVSDSHLHIPMYFFLSNLSFTDICFSTTTVPKMLINLQKQSKAISYTGCITQLSCVLLFAGM
380 >lcl|NP_001000431.1|Plus1complement(14371564..14372502) NW_047798 olfactory receptor Olr1147 Olr1147 __SEG__ Chr8 {Rattus norvegicus} MELGNKTTTSYFILMRLTHDPTMEPFIFGFFLFTYLVTILGNLLIIIAVSSDAHLQTPMYLFLSKLSFTDICLSTTTVPNMLKNIHTQDQSISYTGCVTQACFVLSFAVL
381 >lcl|NP_001000432.1|Plus1complement(14528980..14529897) NW_047798 olfactory receptor Olr1151 Olr1151 __SEG__ Chr8 {Rattus norvegicus} MELKNQTTVIEFFLLRLSENPELQPILFGLFLLMYLLTVSGNLLIILAIVSDSHLHTPMYFFLSNLSFNDICFSTTTVPKMLINLQKQSKAISYTGCVTQLSFVLLFAGM
382 >lcl|NP_001000433.1|Plus1complement(14631737..14632675) NW_047798 olfactory receptor Olr1155 Olr1155 __SEG__ Chr8 {Rattus norvegicus} MEKRNQTAFPGFFLLGLTEDPKLQPILVSLFFSIYLVTLMGNLLIILFVISDSHLHTPMYLFLSNLSLNDICLSTSTIPKMLVNIQENSQSITFKGCLTQMSFVLIFGGM
403 >lcl|NP_001000454.1|Plus1complement(10390276..10391208) NW_047799 olfactory receptor Olr1252 Olr1252 __SEG__ Chr8 {Rattus norvegicus} MGSENGSSVTEFILVGLTKQPDLQCPLFILFLVMYVVTVLGNLGLITLIALNSHLHTPMYFFLFNLSFVDLWYSSVFTPKMLMSFISEKNIITYKGCMTQLFFFSFFCIS
407 >lcl|NP_001000458.1|Plus1complement(10801590..10802525) NW_047799 olfactory receptor Olr1273 Olr1273 __SEG__ Chr8 {Rattus norvegicus} MSNLSIVTQFILLGIPHTEGVETMLFVLFLSFYIFTLVGNVLILLTIVSSNRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNSRAISYAGCVCQLFFYHFLGCTEC
408 >lcl|NP_001000459.1|Plus1complement(11049647..11050591) NW_047799 olfactory receptor Olr1285 Olr1285 __SEG__ Chr8 {Rattus norvegicus} MEKMAAGNHCTVTVFFLAGLSEKAELQLPLLLLFIGIYLITVAGNLCIILLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLMSFVTEKNIISYPGCLAQLYFAIIF
409 >lcl|NP_001000460.1|Plus1complement(11262348..11263292) NW_047799 olfactory receptor Olr1293 Olr1293 __SEG__ Chr8 {Rattus norvegicus} MEDNTARNHSTVTEFFLAGLSQTPELQLPLFFLFTGIYLITVAGNLGIITLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNLISYPGCMTQLYFFITF
410 >lcl|NP_001000461.1|Plus1complement(11329971..11330915) NW_047799 olfactory receptor Olr1297 Olr1297 __SEG__ Chr8 {Rattus norvegicus} MEEVNQTSVAEFILAGLTENPELQLPLFLIFLAVYLITVVGNLGMIILILFSSQLHTPMYYLLSSLSFIDYCQSTVIIPKMLLNFMTEKNFISYPECIVQFYFFCVFVVA
411 >lcl|NP_001000462.1|Plus1complement(11915320..11916264) NW_047799 olfactory receptor Olr1301 Olr1301 __SEG__ Chr8 {Rattus norvegicus} MEEVNQTSVAEFILAGLTENPELQLPLFLIFLAVYLITVVGNLGMIILILFSSQLHTPMYYFLSSLSFIDYCQSTVIIPKMLLNFVTEKNFISYPECIAQFYFFCVFVVA
412 >lcl|NP_001000463.1|Plus1complement(11941347..11942291) NW_047799 olfactory receptor Olr1302 Olr1302 __SEG__ Chr8 {Rattus norvegicus} MEDMAAGNHCTVTEFFLAGLSEKPGLQLPLFLLFIGIYLITVAGNLGMILLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNIISYPGCMTQLYFFLIF
413 >lcl|NP_001000464.1|Plus1complement(11987108..11988043) NW_047799 olfactory receptor Olr1304 Olr1304 __SEG__ Chr8 {Rattus norvegicus} MAEGNYSTMTEFVLTGLTEKPGLQLPLFFLFLGIYVVTVLGNLGMVMLILFSPHLHTPMYFFLSNLSLVDLCQSSVIMPKMLENFVMVKSVISYAECMAQFYLFDVFAVS
414 >lcl|NP_001000465.1|Plus1complement(12035663..12036601) NW_047799 olfactory receptor Olr1306 Olr1306 __SEG__ Chr8 {Rattus norvegicus} METKNCSMVTEFILLGIPHTEGLETMLFVLFLPFYACTLVGNVCILVAVISSTRLHTPMYFFLGNLSVFDMGFSSVTCPKMLLYLMGLSRLISYQDCVSQLFFFHFLGSI
417 >lcl|NP_001000468.1|Plus1complement(12198106..12199023) NW_047799 olfactory receptor Olr1314 Olr1314 __SEG__ Chr8 {Rattus norvegicus} MANRTLLDEFILLGIPQTQGLETLLFVVFLFIYFFTLLGNSLIFTAIVSSSSLHTPMYFFLGLLSIFDIMFPSVTCPKMLFYLSGQSPAISYKGCVAQLFFYHFLGSTEG
418 >lcl|NP_001000469.1|Plus1complement(12224934..12225869) NW_047799 olfactory receptor Olr1315 Olr1315 __SEG__ Chr8 {Rattus norvegicus} MKNLSVVTQFILLGIPHTEGLETMLFVLFLSFYIFTLVGNLLILLAIVSSTRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTEC
425 >lcl|NP_001000476.1|Plus1complement(12505234..12506163) NW_047799 olfactory receptor Olr1330 Olr1330 __SEG__ Chr8 {Rattus norvegicus} MRNCTLVTEFLLMGIPHTAGLERMLFVLFLAFYLLTLPGNLLILLAILTSTNLHTPMYFFLGNLSVLDIFFPSVSSPKMMRYLTGHSHTISYQGCASQLFYHFLGCAECF
426 >lcl|NP_001000477.1|Plus1complement(12525454..12526392) NW_047799 olfactory receptor Olr1332 Olr1332 __SEG__ Chr8 {Rattus norvegicus} MRNDTSVTEFILLGISNSEGLESMLFILFLVFYVFALLGNLLIFLTILASPNLHTPMYFFLGNLAVFDIFFPSVNSPKMMDSLVGQSRTISYQGCASQVFFYHTLGGTEC
427 >lcl|NP_001000478.1|Plus1complement(12558810..12559745) NW_047799 olfactory receptor Olr1334 Olr1334 __SEG__ Chr8 {Rattus norvegicus} MSNVTLVTTFFLSGIPHAPALDTMLFVTFLMIYFLTVLGNFLILMVIRVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLVSPGGGAISFHSCVAQLYCFHFLGSTE
428 >lcl|NP_001000479.1|Plus1complement(12564585..12565517) NW_047799 olfactory receptor Olr1335 Olr1335 __SEG__ Chr8 {Rattus norvegicus} MLNGSVVTTFFLTGLPHPPVLDTMLFGLFLVIYVLTVLGNLLILMVIREDSHLHTPMYYFLTNLSFIDMWFSTVTVPKLLMTLLIPGGGAISFHSCVAQFYSFHFLGSTE
430 >lcl|NP_001000481.1|Plus1complement(12639514..12640458) NW_047799 olfactory receptor Olr1339 Olr1339 __SEG__ Chr8 {Rattus norvegicus} MNPANHSQVATFVLLGLSQVWELRLLFFTVFSAVYLLTVAGNLLIVAIVTSDPRLHTTMYFLLGNLSFLDFCYSSITAPRMLVDLLSHNPTISFGACLTQLFFFHFIGGI
432 >lcl|NP_001000483.1|Plus1complement(7814438..7815373) NW_047817 olfactory receptor Olr1344 Olr1344 __SEG__ Chr9 {Rattus norvegicus} MRGENITKVSTFILLGFPTGPELQYLLFLLFLLAYLFVLVENLAIILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFAGCMTQLYFFISLVCT
434 >lcl|NP_001000485.1|Plus1complement(16550153..16551103) NW_047773 olfactory receptor Olr1096 Olr1096 __SEG__ Chr7 {Rattus norvegicus} MKHVNQSEFSNFILVSLFSRSGSPELLFSLVAAMFIIGLLGNTILLLLIQIDSKLHTPMYFLLSQLSLLDVCFPLITIPKMVSDFPKKKSFISFEGCAAQLFFLTMMGVA
435 >lcl|NP_001000486.1|Plus1complement(5103339..5104280) NW_047773 olfactory receptor Olr959 Olr959 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEILFILLGLTDDPQLQILIFLFMFFNYIFSLMGNLIIIFLTLLDLRLKTPMYFFLRNFSLLEIAFTTARIPRFLMSIITGDKTITYNACVAQLFFFVLLLITEF
436 >lcl|NP_001000487.1|Plus1complement(5158603..5159547) NW_047773 olfactory receptor Olr962 Olr962 __SEG__ Chr7 {Rattus norvegicus} MKNQSMELDFILLGLTDDPGLQIVVFLFLFLNYMASLLGNLVIVLLTLLDPCLKTPMYFFPRNFSFLEIMFTTVCIPRFLTTIVTGDKTISYNSCASQLFFYLLLGVTEF
438 >lcl|NP_001000490.1|Plus1complement(7533639..7534571) NW_048048 olfactory receptor Olr1766 Olr1766 __SEG__ ChrX {Rattus norvegicus} MTQISEIILLGFGDLHGLQFVLFGLFLAIYVTTLLGNIIILIVVSADCSLHTPMYFFLGHFSFLEIGYTTTIEPIMLRTLLSAHVPISFPACACQFYFFASLVATECFFL
439 >lcl|NP_001000491.1|Plus1complement(7657136..7658059) NW_048048 olfactory receptor Olr1767 Olr1767 __SEG__ ChrX {Rattus norvegicus} MENSSAGTKFILLGMTDNHQLAVLLFGLFFIIYFITVLGNLGLVVLIQVSHRLHTPMYFFLSNLSFLDVCFSSITTPKTLVNLLSQLQEVSFFACMAQMGLFIIFASAEC
440 >lcl|NP_001000492.1|Plus1complement(8135038..8135976) NW_048048 olfactory receptor Olr1751 Olr1751 __SEG__ ChrX {Rattus norvegicus} MHQGNRTAFAGFILLGLTVGSEQQLLLFTLFLCMYLVTMVGNSLIILAIISDTHLHSPMYFFLANLSFTDICFTTTTVPKMLADIQSQNPAISLAGCFTQMYFFMFLVDL
441 >lcl|NP_001000493.1|Plus1complement(4653762..4654700) NW_047333 olfactory receptor Olr1356 Olr1356 __SEG__ Chr10 {Rattus norvegicus} MEVGSNISSGSFILMGISNHPQLEIIFFVVILSSYLLTLVGNLTIILLSRLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLKNLWGPDKTISYGGCVTQLYVFLWLGAT
442 >lcl|NP_001000494.1|Plus1complement(5078407..5079348) NW_047333 olfactory receptor Olr1369 Olr1369 __SEG__ Chr10 {Rattus norvegicus} MSSTNESSISEFLLLGLSRQPQQQQHLFLLFLTMYLATVLGNLLIILAIGTESRLHTPMYFFLSNLSFVDVCFSSTIVPKVLAIYILGSQIISFSGCLTQLYFLCVFADM
443 >lcl|NP_001000496.1|Plus1complement(4520658..4521578) NW_047355 olfactory receptor Olr1533 Olr1533 __SEG__ Chr11 {Rattus norvegicus} MELNRTLVTEFVLRGITDLPELQVPLFLVFFLIYVTTMVGNLGLILLIWKYSHLHTPMYFFLGSLAFADACTSSSVTPRMLVNILDNGKMISLFECMAQYYVFGSSATTE
444 >lcl|NP_001000497.1|Plus1complement(2388620..2389549) NW_047773 olfactory receptor Olr878 Olr878 __SEG__ Chr7 {Rattus norvegicus} MNNKTLLTEFILLGLTDVPELQVAVFTFLFLAYIFSMIGNLTILILTLLDSHLHTPMYFFLRNFSFLEISFTNIFIPRVLVSITTGNKSISFAGCFAQYFFAIFLGATEF
449 >lcl|NP_001000503.1|Plus1complement(2626162..2627157) NW_047453 olfactory receptor Olr1637 Olr1637 __SEG__ Chr15 {Rattus norvegicus} MVPSGNQSDGTTEFVLAGFPNLNGTGVEVFSVFLFIYLLTLTGNMLIVGVVGADHRLQTPMYFFLGNLSCLEILITSVIIPKMLSNFLSRRHTISFAACITQFYFYFFLG
451 >lcl|NP_001000505.1|Plus1complement(23198856..23199812) NW_047563 olfactory receptor Olr318 Olr318 __SEG__ Chr1 {Rattus norvegicus} MEKGNQTGMVLFHFRPFSKLPEVQMLIFVLFLMMYLISIGGNMSIVLTIWINRCLHTPMYFFLANLASLEIFYSSTIAPLTLASILSTERTVVSLVGCGAQMFFFIFLGS
456 >lcl|NP_001000510.1|Plus1complement(1290419..1291348) NW_047596 olfactory receptor Olr1733 Olr1733 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPGFILLGLSRDSEKGHLLFSIFLALYLLGILGNLLLLLAICADVHLHTPMYFFLSQLSLMDLCFITTTAPKMLQTLWTGDGSISFSGCLIQFYFFAVFADMDNL
457 >lcl|NP_001000512.1|Plus1complement(13115720..13116673) NW_047657 olfactory receptor Olr601 Olr601 __SEG__ Chr3 {Rattus norvegicus} MDEVNCTSLAEFVLLGFSDVPELAIFLFLMFLLIYGVTVIANLGMTVLIQVSSRLHTPMYFFLSHLSFVDFCYASIIVPKMFTDIINKDKVISYRECLIQFYLFCTFAIT
458 >lcl|NP_001000513.1|Plus1complement(15175206..15176153) NW_047657 olfactory receptor Olr698 Olr698 __SEG__ Chr3 {Rattus norvegicus} MEKNNVTEFILLGLTQNPEGQKILFVTFLLIYIVTVMGNLLIMVTIIASQSLGSPMYFFLAYLSFIDTVYSTAIAPKMIIDLLYETKTISFRACMTQVFIDHLFAGAEVI
461 >lcl|NP_001000516.1|Plus1complement(13524147..13525088) NW_047798 olfactory receptor Olr1121 Olr1121 __SEG__ Chr8 {Rattus norvegicus} MEPQNQTSASEFILLGLSEKPEHEPVLFSLFLCMYVITVVGNLLIILAISSDSHLHTPMYFFLANLSLVDFCLATNTIPKMLVNIQIRNKSISYPCCLTQMYFFHFFGIM
462 >lcl|NP_001000517.1|Plus1complement(10948888..10949847) NW_047799 olfactory receptor Olr1280 Olr1280 __SEG__ Chr8 {Rattus norvegicus} MESLTAGNHCRVSEYFLAGLSAKPELQLPLFLLFIGVYVITVVGNLAMITLIACSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNVISYPGCMTQLYCFLIF
463 >lcl|NP_001000518.1|Plus1complement(11024454..11025506) NW_047799 olfactory receptor Olr1283 Olr1283 __SEG__ Chr8 {Rattus norvegicus} MEDMAAGNHCIVTEFFLDGLSKKSELQLPLFLLFTGIYLITVAGNLGMITLILLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLMSFLTEKNIISYPGCLAQLYFAVIF
464 >lcl|NP_001000519.1|Plus1complement(12056460..12057395) NW_047799 olfactory receptor Olr1307 Olr1307 __SEG__ Chr8 {Rattus norvegicus} MRNRSVVTQFILLGIPNTEGLETMLFVLFLSFYIFTLMGNLLILLAIISSSRLHTPMYFFLCKLSIFDIFFPSVSSPKMLFYLSGNSRAISYAGCVSQLFFYHFLGCTEC
467 >lcl|NP_001000522.1|Plus1complement(8294468..8295412) NW_047773 olfactory receptor Olr1069 Olr1069 __SEG__ Chr7 {Rattus norvegicus} MKSELKRNYTELTEFILLGFRASPKFQVFLFLVFLMIYMVTVVGNVSMITVIKMDSRLQTPMYFFLRNLSYLDLCYSTVIAPKTLANFLTSEKKISYNGCATQFFFFALF
468 >lcl|NP_001000523.1|Plus1complement(5409229..5410170) NW_047333 olfactory receptor Olr1381 Olr1381 __SEG__ Chr10 {Rattus norvegicus} MSSTNHSSVSVFLLLGLSRQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMYFFLSNLSFVDLCFSSTTVPKVLANHILGSQEISFSGCLTQMYFLSVFAYM
471 >lcl|NP_001000526.1|Plus1complement(31858879..31859805) NW_047334 olfactory receptor Olr1457 Olr1457 __SEG__ Chr10 {Rattus norvegicus} MSNHTTVTHFILRGFSDVPQLRLVVIPFFLLVYTFGLLGNFSIIMAVRRDSRLHSPMYFFLKNLSFLDMCYTSATIPKAVAISFTGSGVVSYLECVAQLYIIFTFACTEC
473 >lcl|NP_001000531.1|Plus1complement(4725082..4726008) NW_047355 olfactory receptor Olr1542 Olr1542 __SEG__ Chr11 {Rattus norvegicus} MAEDNYSLTTEFILVGFSDHPDLKILLFLVFTAIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMAQFYFLCLAETT
474 >lcl|NP_001000533.1|Plus1complement(6681370..6682302) NW_047399 olfactory receptor Olr1581 Olr1581 __SEG__ Chr13 {Rattus norvegicus} MKRANYTPVREFVFQGFSNLQEHWLTLFIVFSALYILTLTGNLIIVTIIRIDHHLHTPMYFFLSVLSTSETFYSLVIIPRMLGSLVGLSQSISLECCGIQLFFFLGFAIT
476 >lcl|NP_001000536.1|Plus1complement(3886900..3887838) NW_047492 olfactory receptor Olr1657 Olr1657 __SEG__ Chr17 {Rattus norvegicus} MEKENTSSFEGFILVGFSDRPHLELILFVVVLSFYLFTLLGNMTIILLSALDSRLHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGV
483 >lcl|NP_001000544.1|Plus1complement(4481882..4482826) NW_047562 olfactory receptor Olr142 Olr142 __SEG__ Chr1 {Rattus norvegicus} MLGLNGTPFQPATLQLTGIPGMHTGQAWVALIFCFLYFISIAGNLSILALVIREPPLHQPMYYFLSMLSLNDLGVSLSTLPTVLATFCFNYRHVGFDACLVQMFFIHTFS
484 >lcl|NP_001000545.1|Plus1complement(4521851..4522795) NW_047562 olfactory receptor Olr145 Olr145 __SEG__ Chr1 {Rattus norvegicus} MRGEAQNSSGLPPFILTGLPGLETSQHWLFLLLGVLYTVSIVGNALILFIIKEEESLHQPMYYFLSLLSVNDLGVSFSTLPTVLAVFCFHLREISFNSCMSQMFFIHLFS
487 >lcl|NP_001000549.1|Plus1complement(5491345..5492283) NW_047562 olfactory receptor Olr192 Olr192 __SEG__ Chr1 {Rattus norvegicus} MEAQSNISSILVPDFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRMEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDNKSIGFSACFLQMFVMNSF
488 >lcl|NP_001000550.1|Plus1complement(5690048..5691016) NW_047562 olfactory receptor Olr202 Olr202 __SEG__ Chr1 {Rattus norvegicus} MIHSNISIIHPAVFVLLGIPGLETYHIWLSIPLCLMYVTAVLGNSILIMVIITERNLHEPMYFFLSMLAITDILLSTTTVPKALAIFWFHAHNIAFDACVTQVFFVHTMF
489 >lcl|NP_001000551.1|Plus1complement(6723933..6724883) NW_047562 olfactory receptor Olr218 Olr218 __SEG__ Chr1 {Rattus norvegicus} MELWNTTLESGFILVGILNGSSSPELLCAIVTALYILALTSNGPLLLVITVDARLHVPMYFLLRQLSLIDLLFTSVVTPKAVMDFLLKENTISFGGCALQMALALMLGSA
491 >lcl|NP_001000553.1|Plus1complement(6851476..6852420) NW_047562 olfactory receptor Olr224 Olr224 __SEG__ Chr1 {Rattus norvegicus} MLDMNITLVSEFILVGFPTAPWLQVLLFFIFLVVYMLIIVENLVIIFTVWSTSSLHKPMYYFLSSMSFLEIWYVSVTVPKMLDGFLLQRRHISFTGCMTQLYFFISLACT
492 >lcl|NP_001000554.1|Plus1complement(8492869..8493807) NW_047563 olfactory receptor Olr286 Olr286 __SEG__ Chr1 {Rattus norvegicus} MSNRSNNTLVTEFILLGFPELRHLQGLLFGLFLIIYVVTVLENLVIVGTISASRQLHIPMYFFLANLSVLETLYTTVTVPKLLAGLLAGAKAISFSGCLTQLFLFLSLGS
495 >lcl|NP_001000557.1|Plus1complement(646784..647746) NW_047596 olfactory receptor Olr1693 Olr1693 __SEG__ Chr20 {Rattus norvegicus} MNVSFKTGFLLMGFSEERTLQILHAVLFLITYLLAVMGNLLIVTIITVDQRLHSPMYYFLKHLSLLDLCFISVTVPQSIANSLMDNGFISLGQCMLQVFFFIALASSEVA
499 >lcl|NP_001000561.1|Plus1complement(10748213..10749157) NW_047657 olfactory receptor Olr482 Olr482 __SEG__ Chr3 {Rattus norvegicus} MAQINCSQVTEFILVGLTDREELKMPLFGVFLFIYLFTTFGNLGLIVVIRTDARLHTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFNACAAQLGCFLAFMTA
500 >lcl|NP_001000562.1|Plus1complement(11514316..11515263) NW_047657 olfactory receptor Olr522 Olr522 __SEG__ Chr3 {Rattus norvegicus} MNAWNHTTETEFILMGLTGSKEVQLVLSVMFLLIYVLTVLGNIGMILIIRLDIQLHTPMYFFLTHLSCIDLCYSTIITPKTLQNLLTSIKNISFMGCFTQLFFFALLVAT
501 >lcl|NP_001000563.1|Plus1complement(11774796..11775761) NW_047657 olfactory receptor Olr532 Olr532 __SEG__ Chr3 {Rattus norvegicus} MSTWNYTKESDFILMGLTDSKELQLVLAVLFLLIYLVTVLGNTGMMLIIRLDARLHTPMYFFLTHLSFLDLCYSTVITPKTLQNLLTSNKIISFIGCFTQMYGFVLLAAA
502 >lcl|NP_001000564.1|Plus1complement(11805168..11806100) NW_047657 olfactory receptor Olr536 Olr536 __SEG__ Chr3 {Rattus norvegicus} MTENNFTKVTVFMLSGFSDHPELQVSLFLIFLFIYLFTVWGNIGLIMLIRIDSQLHTPMYFFLSNLAFIDIFYSSTVTPKALVDFQSTQKSISFVGCFVQMYFFVGLVCS
503 >lcl|NP_001000565.1|Plus1complement(11913332..11914270) NW_047657 olfactory receptor Olr541 Olr541 __SEG__ Chr3 {Rattus norvegicus} MDAGNHTDVKEFILLGLTENPNWQVPLFLLFSIIYLIILLGNCGMIFLIWLNTHLHTPMYFFLSNLSFCDICYSTVIAPKMLINILSEHKSSKLFSCVLQSFFFMVYATT
504 >lcl|NP_001000566.1|Plus1complement(11974324..11975262) NW_047657 olfactory receptor Olr542 Olr542 __SEG__ Chr3 {Rattus norvegicus} MEVWNHTGVKEFILVGLTENPNWQVPLFLLFCIIYFIILFGNWGMIFLIWLHAQLHTPMYFFLSNLSFCDICYSTIIAPKTIINLLSEHKSTRLFACILQSFFFAVYVTT
505 >lcl|NP_001000567.1|Plus1complement(12754201..12755139) NW_047657 olfactory receptor Olr577 Olr577 __SEG__ Chr3 {Rattus norvegicus} MTFENFTTFTDFVFLGLSSRQDVQQGLFAFFFLVYSLTVIANLGMVILIKLDSRLHTPMYYFLSNLSICDICYSSTVSPKMLADFLSKEKMIPYNLCAVQMYFFGAFADV
506 >lcl|NP_001000568.1|Plus1complement(12772740..12773672) NW_047657 olfactory receptor Olr578 Olr578 __SEG__ Chr3 {Rattus norvegicus} MDKGNCSSHTEFVLLGITNDPSMKMVLFTVFLLIYLIILVANIGMIVLIKLDHQLHTPMYFFLSHLSFSDLCYSTAVGPKMLLDLMIKQKYIPLVGCALQFFFTCVFVDA
507 >lcl|NP_001000569.1|Plus1complement(14991130..14992065) NW_047657 olfactory receptor Olr690 Olr690 __SEG__ Chr3 {Rattus norvegicus} MQNQSFITEFVFLGLSQNPNVQKLIFIICLLVYIATIGGNMMIVVTVVSSPTLLGSPMYFFLAFLSLLDASFSSAMTPKMIVDSLYERKTISFEGCMIQLFAEHFFGGAE
508 >lcl|NP_001000570.1|Plus1complement(15339454..15340374) NW_047657 olfactory receptor Olr705 Olr705 __SEG__ Chr3 {Rattus norvegicus} MGQGYNVTEFIFVGLTQDPAGQKALFALFSLTYIVTMLGNLLIAGTVIASPSLKSPMYFFLACLSVLDALYCNSISPNLIIDLLYNKKTISFKSCMLQLFVEHLFGGVEV
509 >lcl|NP_001000571.1|Plus1complement(15454997..15455941) NW_047657 olfactory receptor Olr710 Olr710 __SEG__ Chr3 {Rattus norvegicus} MGENNNVTEFVLLGLTQDPTGQKALFVMFLLMYIVTIVGNLLIVGTVIASPSLNSPMYFFLAFLSLMDAVYSTAILPKLLKDLVCDKKTISFTACLVQLFVEHLFGGAEV
511 >lcl|NP_001000573.1|Plus1complement(15747998..15748918) NW_047657 olfactory receptor Olr724 Olr724 __SEG__ Chr3 {Rattus norvegicus} MENRRNVTEFILIGLTQNPQMQKVVFVTFLILYMITISGNLLIVVTVINSQALSSPMYFFLSHLSLIDTIYTSSSAPKLIVDSLQENKVISFNGCMAQVYAEHIFGATEI
512 >lcl|NP_001000574.1|Plus1complement(15845902..15846828) NW_047657 olfactory receptor Olr729 Olr729 __SEG__ Chr3 {Rattus norvegicus} MEIPHNITEFFMLGLSQRPEIQRILFVVFLVIYAVTVFGNMLIVVTITFSSSLASPMYFFLSNLSFIDTCYSSSLAPKLIADSLYEGTTLSYEGCMAQLFGAHFLGGVEI
513 >lcl|NP_001000575.1|Plus1complement(16081023..16081949) NW_047657 olfactory receptor Olr741 Olr741 __SEG__ Chr3 {Rattus norvegicus} MARANNVTELIITGLFQDPNVQKVCFVLFLPVYMATVLGNGLIVAMVSVSKSLHSPMYIFLSSLSLVEIFYSSTVVPKFITDLLAKVKTISLNGCLAQIFFFHFLGVAEI
514 >lcl|NP_001000576.1|Plus1complement(16093045..16093962) NW_047657 olfactory receptor Olr742 Olr742 __SEG__ Chr3 {Rattus norvegicus} MANENNVTELIFTGLFQDPEVQKVCFGLFLPVYVATLLGNSLIIVAVSASKTLHSPMYFFLSSLSLVEIFYSSTIAPKFITDLLAKIKTISLKGCLTQIFFFHFFGVVEV
515 >lcl|NP_001000577.1|Plus1complement(16124541..16125464) NW_047657 olfactory receptor Olr744 Olr744 __SEG__ Chr3 {Rattus norvegicus} MASINVTELIITGLFQDPEIQKVCFVLFLPVYLATVLGNGLIVVTISVSKTLHSPMYVFLSSLSLVEIFYSSTVVPKFITDLLAKVKTISLKGCLVQIFFFHFLGVAEIL
517 >lcl|NP_001000579.1|Plus1complement(38872759..38873697) NW_047657 olfactory receptor Olr777 Olr777 __SEG__ Chr3 {Rattus norvegicus} MDRKNHTVVSEFVFLGLTHSWEIQLFLLVVSSVLYILSMSGNILIVFSVTIDPHLHSPMYFLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGV
518 >lcl|NP_001000580.1|Plus1complement(39268629..39269567) NW_047657 olfactory receptor Olr791 Olr791 __SEG__ Chr3 {Rattus norvegicus} MGGANLSVVSEFVFLGLTNSWDIQLLLFMFSSMFYVASMMGNSLIIFTVASDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFKKHKVISFRGCVVQIFSIHVIGGV
520 >lcl|NP_001000582.1|Plus1complement(13770127..13771068) NW_047713 olfactory receptor Olr854 Olr854 __SEG__ Chr5 {Rattus norvegicus} MPGENVTVWSLFFLEGFSRYPRLEIVLFVFSLVMYLVTILGNSTLILITVLDSHLQTPMYLFLGNLSFMDICYTSASIPTLLVNLLSSKKTIIFSGCAVQMYLSLSMGST
524 >lcl|NP_001000586.1|Plus1complement(2466238..2467176) NW_047773 olfactory receptor Olr879 Olr879 __SEG__ Chr7 {Rattus norvegicus} MKNYTSITTFILVGLTDDANLQILLFIFLLLTYLLSVVGNLTIITLTLVDSHLKTPMYFFLRNFSILEVSFTTVCIPRFLYTMASGDNTITYNACATQLFFVIILGVTEF
525 >lcl|NP_001000587.1|Plus1complement(3938001..3938954) NW_047773 olfactory receptor Olr916 Olr916 __SEG__ Chr7 {Rattus norvegicus} MKNNTITTFILLGLTDDPQLQIPIFMFLFFAYTLSIAGNLTIIALTILDSHLKMPMYFFLQNFSILEISFTSACIPRYLYNIATGDRSITYDICVIQVFFTDVFGVTEFF
526 >lcl|NP_001000588.1|Plus1complement(4240522..4241484) NW_047773 olfactory receptor Olr927 Olr927 __SEG__ Chr7 {Rattus norvegicus} MSNSGLRKNGSLSFCSEFTLVAFSSLAELQPVLILVFLVTYLFTVGGNLTIICVIWVTRSLHTPMYYFLANLSFLEMCYISSVVPQMLVHLLVQIKTISVRGCAVQMYVF
528 >lcl|NP_001000590.1|Plus1complement(5977781..5978740) NW_047773 olfactory receptor Olr987 Olr987 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQVLIYLFLFFNYILRMMGNLVIIFLTLMDPHLKTPMYFFLRNFSFLEIAFTTACIPRFLMSILTGDRTISYNSCAAQLYFFFLSLITEF
529 >lcl|NP_001000591.1|Plus1complement(8316801..8317760) NW_047773 olfactory receptor Olr1070 Olr1070 __SEG__ Chr7 {Rattus norvegicus} MGDRESSNHSDMTDFILVGFRVRSELHILLFLLFLLVYTMILLGNLGMMAIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIAPKAMSNFWTESKSISFAGCVAQIFLFALF
530 >lcl|NP_001000592.1|Plus1complement(12171066..12172019) NW_047773 olfactory receptor Olr1081 Olr1081 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFFLLGFTENPQLHFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFVDICFTSTTIPKMLVNIYTQSKSITYEDCISQMCVFLVFPE
532 >lcl|NP_001000594.1|Plus1complement(16014288..16015250) NW_047798 olfactory receptor Olr1193 Olr1193 __SEG__ Chr8 {Rattus norvegicus} MKPGNQTSTLEFLLLGFSQDPEHQPMLFGLFLFIFVVAVLGNLLIILAVSIDSHLHTPMYFFLSNLSFSDICFITTTIPKMLVNIQTQSKSITYAECIIQMYFFMVFGGM
534 >lcl|NP_001000596.1|Plus1complement(10456159..10457094) NW_047799 olfactory receptor Olr1257 Olr1257 __SEG__ Chr8 {Rattus norvegicus} MADSNRSTVTEFILAGLTDKPELQLPLFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMYFFLSSLSFIDLCYSTVITPKMLVNFVAKKNIISYQECMTQLYFFLAFVIS
535 >lcl|NP_001000597.1|Plus1complement(11285089..11286024) NW_047799 olfactory receptor Olr1294 Olr1294 __SEG__ Chr8 {Rattus norvegicus} MAAANHCTLTEFFLAGLSEKQEVQLPLFLLFVAIYLIMVAGNLGMIALIWLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKLLVSFLTENNQISYPGCMSQLYFFIAFGTA
536 >lcl|NP_001000598.1|Plus1complement(11299985..11300929) NW_047799 olfactory receptor Olr1295 Olr1295 __SEG__ Chr8 {Rattus norvegicus} MQDMATGNHCTVTEFFLAGLSEKQEFHLPLFLLFIVIYLITVAGNLGMITLIGLSSNLHTPMYYFLSSLSFTDFCQSTVVTPKMLVSFVTEKNIISYPGCLAQLYFFIIF
540 >lcl|NP_001000602.1|Plus1complement(39090378..39091316) NW_047657 olfactory receptor Olr788 Olr788 __SEG__ Chr3 {Rattus norvegicus} MGGANLSVVSEFVFLGLTNSWDIQLLLFMFSSMFYVASMMGNSLIIFTVASDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFKKHKVISFRGCVIQIFSIHVIGGV
541 >lcl|NP_001000603.1|Plus1complement(39007336..39008298) NW_047657 olfactory receptor Olr785 Olr785 __SEG__ Chr3 {Rattus norvegicus} MGSVNQSVVSEFVFLGLTNSWDIQLFLFVFSSIFYVASMMGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGISSVTSPKMICDLFRKHKVISFRGCVTQIFFIHVIGGV
542 >lcl|NP_001000604.1|Plus1complement(39000319..39001257) NW_047657 olfactory receptor Olr784 Olr784 __SEG__ Chr3 {Rattus norvegicus} MDKANHSVVSEFVFLGLSNKWGIQLILFLFSSMFYMASLMGNLLIVFSVTADSNLHSPMYFLLANLSFLDLGVCSIAAPKMIYDLFRKHKVISFGGCITQIFFIHAIGGT
543 >lcl|NP_001000605.1|Plus1complement(38954165..38955103) NW_047657 olfactory receptor Olr782 Olr782 __SEG__ Chr3 {Rattus norvegicus} MYGMNRSAVSEFIFLGITNIWEVQGLLFFFTLLFYFASMIGNLVIVLTVSLDPHLNSPLYFLLANLSVIDMMFCSITAPKMICDIFKKHKTISFWGCITQIFFSHAVGGT
544 >lcl|NP_001000606.1|Plus1complement(38923271..38924209) NW_047657 olfactory receptor Olr780 Olr780 __SEG__ Chr3 {Rattus norvegicus} MEGVNQSVVSEFVFLGLTNSWSIQLLLFVFSSMFYVASMMGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGVSSVSSPKMIYDLFRKHKVISFTGCVTQIFFIHVIGGV
545 >lcl|NP_001000607.1|Plus1complement(38894176..38895102) NW_047657 olfactory receptor Olr778 Olr778 __SEG__ Chr3 {Rattus norvegicus} MFGANHSAVSEFVLLGLSNSWEAQIFLFFFSCLFYVSSLTGNFIIVVTVTSDPYLHSPMYFLLANLSVIDLIFCSIAAPKMICDLFRKQKVISFGGCISQVFFSHAVGGT
546 >lcl|NP_001000608.1|Plus1complement(38848761..38849699) NW_047657 olfactory receptor Olr776 Olr776 __SEG__ Chr3 {Rattus norvegicus} MDRKNYTVVSEIVFLGLTHSWEIQLLLLVFSSVLYILSMTGNILIVFSVTIDPHLHSPMYFLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGV
549 >lcl|NP_001000611.1|Plus1complement(38552620..38553558) NW_047657 olfactory receptor Olr767 Olr767 __SEG__ Chr3 {Rattus norvegicus} MDGGNRSVVSEFILWGLTNSKNIQVFLFVIFLMLYMFILSGNIVILILVTTDPHLHSPMYFLLANLSFIDMWLSSNITPKMITDFLRENKTISFAGCMSQVFFTHCIAGG
553 >lcl|NP_001000616.1|Plus1complement(16013488..16014414) NW_047657 olfactory receptor Olr737 Olr737 __SEG__ Chr3 {Rattus norvegicus} MANVNVTELIITGLFQDLEVQKVCFVLFLPVYLATVLGNGLIVVTVNISKSLYSPMYFFLSYLSLVEILYSSTVVPKFITDLLHKIKTISLKGCLAQIFFFHFFGVTEIL
554 >lcl|NP_001000617.1|Plus1complement(15943333..15944262) NW_047657 olfactory receptor Olr734 Olr734 __SEG__ Chr3 {Rattus norvegicus} MADLFNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVTVAVSRNLGSPMYFFLSSLSFVEICYSSTTAPKLILDLLAEMKSISVWGCMTQLFFLHYFGGIEI
555 >lcl|NP_001000618.1|Plus1complement(15934305..15935234) NW_047657 olfactory receptor Olr733 Olr733 __SEG__ Chr3 {Rattus norvegicus} MADLFNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVTVAVSRNLGSPMYFFLSSLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFLHYFGGIEI
558 >lcl|NP_001000621.1|Plus1complement(15592172..15593122) NW_047657 olfactory receptor Olr717 Olr717 __SEG__ Chr3 {Rattus norvegicus} MGQNNSVSEFILLGLTEDPAGQKTLFVVFLLIYIGTMVGNLLIVWTVIASPSLDSPMYFFLAYLSLIDALYSSTILPKLLIDLLCDKKTISLTACLVQLFVEHLFGGVEI
559 >lcl|NP_001000622.1|Plus1complement(15573186..15574139) NW_047657 olfactory receptor Olr716 Olr716 __SEG__ Chr3 {Rattus norvegicus} MGQSNNVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFFLASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDI
560 >lcl|NP_001000623.1|Plus1complement(15548035..15548958) NW_047657 olfactory receptor Olr715 Olr715 __SEG__ Chr3 {Rattus norvegicus} MGQKNNVTEFILLGLTQDPAGQKALFFMFFLIYIVTMVGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEV
561 >lcl|NP_001000624.1|Plus1complement(15484235..15485188) NW_047657 olfactory receptor Olr712 Olr712 __SEG__ Chr3 {Rattus norvegicus} MGQSNNVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFFLASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDI
562 >lcl|NP_001000625.1|Plus1complement(15465392..15466336) NW_047657 olfactory receptor Olr711 Olr711 __SEG__ Chr3 {Rattus norvegicus} MEETNNVTEFILLGLTQDPAGQKVLFVMFLLIYIVTIGGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKAISVKACLVQLFVEHLFGGSEV
563 >lcl|NP_001000626.1|Plus1complement(15301341..15302264) NW_047657 olfactory receptor Olr704 Olr704 __SEG__ Chr3 {Rattus norvegicus} MGQRSNVTEFVLLGLTQDPAGQKALFVMFLLIYIVTIVGNLLIVGTVIASPSLGTPMYFFLAYLSLLDAVYSTSISPKLMIDLLCNRKTISFSACMTQLFLEHLLGGAEV
564 >lcl|NP_001000627.1|Plus1complement(15213049..15213966) NW_047657 olfactory receptor Olr701 Olr701 __SEG__ Chr3 {Rattus norvegicus} MEQRNNVTEFVLLGLTQSPEGQKILFVVFLVIYVVTMAGNLLIVVTVVVSPSLDAPMYFFLGYLSFMDAVYSTTVTPNMIIDLLYEKKTISFKACMSQLFIGHLFGGAEI
565 >lcl|NP_001000628.1|Plus1complement(15081625..15082560) NW_047657 olfactory receptor Olr695 Olr695 __SEG__ Chr3 {Rattus norvegicus} MLNQSFVMEFVFLGLSQNPNLQKLIFIICLIVYIATIGSNMMIVVTIVYSPTLLGCPMYFFLAFLSLLDASFSSAMTPKMIVDSLYKRKTISFEGCMIQLFVEHFFGGAE
566 >lcl|NP_001000629.1|Plus1complement(15031441..15032358) NW_047657 olfactory receptor Olr693 Olr693 __SEG__ Chr3 {Rattus norvegicus} MENAKNVTDFILLSISKIPELRTIFSALFLIMYVVTILGNLLIVVTVMKSSNLRSPMYFFLISLSFLDVIYSSITAPKLIIDSLSENTTISLEGCMTQLFAEHFFGGVEI
568 >lcl|NP_001000631.1|Plus1complement(14852134..14853069) NW_047657 olfactory receptor Olr681 Olr681 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVNEFILLGLSQNPKVEKILFVVFLLVYIATIVGNIIILVTIIYNPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCITQLFTSHFFAGVE
569 >lcl|NP_001000632.1|Plus1complement(14750413..14751348) NW_047657 olfactory receptor Olr675 Olr675 __SEG__ Chr3 {Rattus norvegicus} MQNHSFVTEFILLGLSQNLNVEKMLLCLLLFIYFATIAGNMVIVVTIMYSPALLGSPMYFFLIFLSLLDACTSSSVIPKIIIDCFSERKTISFECCMIQLFAVHFFTGAE
570 >lcl|NP_001000633.1|Plus1complement(14605119..14606054) NW_047657 olfactory receptor Olr670 Olr670 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNPKVEKILFIIFLLLYLATIGGNMTIVVTIVWNPALLGSPMYFFLAFLSLLDACVSSIVTPKMIIDLFYKRKSISFECCMTQVFSVHFFSAVE
571 >lcl|NP_001000634.1|Plus1complement(14514094..14515029) NW_047657 olfactory receptor Olr665 Olr665 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFLLLGLSQNPKVQKIVFVVFFFVYIGTFGSNMTIVVTIINSRALLGSPMYFFLAFLSFLDACISSVITPKITVDLLYERRTISFDGCMAQVFAVHFFTGVE
573 >lcl|NP_001000636.1|Plus1complement(14190195..14191124) NW_047657 olfactory receptor Olr654 Olr654 __SEG__ Chr3 {Rattus norvegicus} MENHKNVTEFIFMGLWENRQIELLFFVLFLLCYLAVLMGNSVILVTITCSHLIEQPMYYFLCHLSLMDLCYTSTVIPRLIRDLAATRKNISYNECMTQLFTGHLLAGVEI
575 >lcl|NP_001000638.1|Plus1complement(14147402..14148331) NW_047657 olfactory receptor Olr652 Olr652 __SEG__ Chr3 {Rattus norvegicus} MENHKNVTEFIFMGLWENRQIELLFFLLFLLCYLAVLMGNSVILVTISCSHLIEQPMYYFLCHLSLMDLCYTSTLIPRLIRDLAATRKNISYNECMTQLFTAHLLAGVEI
576 >lcl|NP_001000639.1|Plus1complement(14115920..14116846) NW_047657 olfactory receptor Olr650 Olr650 __SEG__ Chr3 {Rattus norvegicus} MQLNINITEFILLGLTQDPSRKNIVFAIFVFFYMGTLLGNLLIIVTIKTSQALGSPMYFFLFYLSLSDTCFSTTVAPRTIVDSLLKEASISFNECIIQVFSIHLFGSLEI
580 >lcl|NP_001000643.1|Plus1complement(13939724..13940632) NW_047657 olfactory receptor Olr641 Olr641 __SEG__ Chr3 {Rattus norvegicus} MGNQNNVTEFILLGLTENQDLRKLFSAVLLIMYVVMLLGNMLIVATMITSQRLRLPMYFFLTSLSVVDITFSSVIAPKLILDSLSENTTISFEGCMAQLFAEHFFGGVGI
585 >lcl|NP_001000652.1|Plus1complement(13529112..13530023) NW_047657 olfactory receptor Olr621 Olr621 __SEG__ Chr3 {Rattus norvegicus} MHNNTVTEFILFGLTQDPDKQKAIFGVFLILYIMTLLGNFLIVITIKMSHTLGSPMYFFLFYLSFADACFSTTTAPRLIFDSLTQKKIITYNECMTQVYALHFFGCMEIF
586 >lcl|NP_001000654.1|Plus1complement(13374834..13375766) NW_047657 olfactory receptor Olr613 Olr613 __SEG__ Chr3 {Rattus norvegicus} MDRGNCSSVNKFIFSGITNNHDTKVALFITFLLVYLIALLANLGMIILIRADAQLHTPMYFFLTNLSFCDFCYCTAIGPKMLVDLLADDKSIPFVGCALQFLTFCVFADS
587 >lcl|NP_001000655.1|Plus1complement(13306439..13307419) NW_047657 olfactory receptor Olr608 Olr608 __SEG__ Chr3 {Rattus norvegicus} MNSVVPSTRSQWWNEGNQSMVSSFILLAFSEFPNLQLPLFLVFLIMYTVTVLENLGMIFVIRINPKLHTPMYFFLSHLSFVDFCYTSVIAPKLLDLLLVEDKSISFEGCM
588 >lcl|NP_001000656.1|Plus1complement(13165905..13166861) NW_047657 olfactory receptor Olr604 Olr604 __SEG__ Chr3 {Rattus norvegicus} MLLSGRNNSEMIFTLLGFSDYPELKVPLFLVFLIIYSIIVVGNIGMILVIRINPKLHTPMYFFLSHLSFVDFCYSSIITPKMLVNLVAKDRTISFRECIVQYFLFCIFVV
591 >lcl|NP_001000659.1|Plus1complement(12950248..12951183) NW_047657 olfactory receptor Olr587 Olr587 __SEG__ Chr3 {Rattus norvegicus} MDKGNCSSLHEFLLLGITNNPDMKVLIFTVFLAIYLSILITNIGMIILIKMDPQLQTPMYFFLSHLSFSDLCYSSAVGPKMLIDIFSKYKTIPFVGCALQFFFVCIFIDV
593 >lcl|NP_001000661.1|Plus1complement(12903756..12904694) NW_047657 olfactory receptor Olr584 Olr584 __SEG__ Chr3 {Rattus norvegicus} MDNGNCSSLTEFLLLGITNNPEVKVFLFIMFLVVYLTNLLTNVGMIILIRMDTQLHTPMYFFLSHLSFSDLCYSTAVGPKMLVDLLSKNRRSIPFLGCAMQFFTFCIFID
600 >lcl|NP_001000670.1|Plus1complement(12209225..12210163) NW_047657 olfactory receptor Olr551 Olr551 __SEG__ Chr3 {Rattus norvegicus} MDSGNHTDVKEFILLGLTDNPSWQVPLFLLFSIIYFIIFVGNWGMIFLIWLNTHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSEHKSTRVFACILQSFFFAVYVTV
601 >lcl|NP_001000671.1|Plus1complement(11815106..11816044) NW_047657 olfactory receptor Olr537 Olr537 __SEG__ Chr3 {Rattus norvegicus} MADRNLTVITEFILLGLTEDPLLNTVLSVLFLLIYVITVAGNFWIIVIILATAQLHSPKYFFLSHLAFLDFSYSSVFLPKMLINYLVGQNSISYQGCLLQYSCVNMFLTA
602 >lcl|NP_001000672.1|Plus1complement(11798225..11799166) NW_047657 olfactory receptor Olr535 Olr535 __SEG__ Chr3 {Rattus norvegicus} MNRLNITKEYDFILMGLTDSKEIQLVLSVLFLLIYLVTLMGNTGMMLIICLDARLHTPMYFFLTHLSFLDLCYSTVITPKTFENLFTSIKNISFIGCFIQLYFFVLFGGA
603 >lcl|NP_001000673.1|Plus1complement(11782151..11783086) NW_047657 olfactory receptor Olr533 Olr533 __SEG__ Chr3 {Rattus norvegicus} MENVTYVSLFILRGLTGNTELQIILFFLFLMIYLFTLMGNIGLIAVVIGNPQLHNPMYYFLGVLSFIDTCFSTIITPKMLIDFMSKKKVISFLGCTAQMFLAVSCGTTEC
604 >lcl|NP_001000674.1|Plus1complement(11708473..11709417) NW_047657 olfactory receptor Olr529 Olr529 __SEG__ Chr3 {Rattus norvegicus} MNTWNYTNKLDFILMGLTDSKEVQLVLSVLFLLIYMLTVLGNVGMILIIRLDVQLHTPMYFFLTHLSFLDLTYSTVITPKTLENLMTSTKNISFVGCFTQMYFFVLLAAT
605 >lcl|NP_001000675.1|Plus1complement(11653666..11654613) NW_047657 olfactory receptor Olr527 Olr527 __SEG__ Chr3 {Rattus norvegicus} MYTWNQTNKPDFILMGLTDNKEIQLVLSVLFLLIYLATVLGNTGMILIIRLDIQLHTPMYFFLTHLSFLDLSYSTAITPKTLESLLTANNTISYTDCFTQLYIFILLAAT
607 >lcl|NP_001000677.1|Plus1complement(11109681..11110622) NW_047657 olfactory receptor Olr508 Olr508 __SEG__ Chr3 {Rattus norvegicus} MDKHNITVVTEFILMGITKNPDLQAPLFGLFLIIYLTSVTGNLGIIILTNVDSKLQTPMYFFLRHLAFTDFVYSTTVGPKMLVNFVVDQNAISYYLCATQLAFFLLFIGS
608 >lcl|NP_001000678.1|Plus1complement(11071347..11072288) NW_047657 olfactory receptor Olr507 Olr507 __SEG__ Chr3 {Rattus norvegicus} MESQNLTPVTEFILRGITDRPELQAPLFGLFLIIYLISLVGNLGMIILTIAESRLQTPMYFFLRHLAITDLGYSTAIGPKMLANFVVSKNTISFHLCATQLAFFLLFIAC
609 >lcl|NP_001000679.1|Plus1complement(11049858..11050799) NW_047657 olfactory receptor Olr505 Olr505 __SEG__ Chr3 {Rattus norvegicus} MENHNLTVVSEFILMGITDRPELQIPLFALFLIIYLISLVGNLGMIILTMVESRLQTPMYFFLRHLATTDLGYSTAVGPKMLRSFFVDQNTISLYFCAVQFAFFSMFIIS
610 >lcl|NP_001000680.1|Plus1complement(11004556..11005509) NW_047657 olfactory receptor Olr500 Olr500 __SEG__ Chr3 {Rattus norvegicus} MTISNGEIQSQTLTEFILMGITYHAELQVPLFGLFLIIYLTSLVGNLGMIILTMMDCRLQTPMYFFLRHLATTDLGYSTAVGPKMLSNFLVDQNTISFQDCAIQSAFFSM
611 >lcl|NP_001000681.1|Plus1complement(10941355..10942296) NW_047657 olfactory receptor Olr496 Olr496 __SEG__ Chr3 {Rattus norvegicus} MENHTFEMVTEFILLGITDRSELQAPLFGLFLSIYLTSLIGNLGMIILTIVDSRLHTPMYFFVRHLATTDLGYTTAVGPKMLQNFLVDQNTISFYLCAIQLTFFSMFIAC
612 >lcl|NP_001000682.1|Plus1complement(10814238..10815197) NW_047657 olfactory receptor Olr486 Olr486 __SEG__ Chr3 {Rattus norvegicus} MGKHNVTVVTEFVLMGITDQPELQAPLFGLFLIIYLISLMGNLGMIILTTVDSRLQTPMYFFLKHLAITDLGYSTSVGPKMLVNFVVNQNTISFKLCATQLSFFLVFIVS
613 >lcl|NP_001000683.1|Plus1complement(10764978..10765937) NW_047657 olfactory receptor Olr483 Olr483 __SEG__ Chr3 {Rattus norvegicus} MAQINCTQVTEFILMGLTDRKELKMPLFVVFLFIYLFTAIGNLGLILVIRTDARLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYRHNFISFNACAAQLGCFLTFMVS
614 >lcl|NP_001000684.1|Plus1complement(10739100..10740044) NW_047657 olfactory receptor Olr481 Olr481 __SEG__ Chr3 {Rattus norvegicus} MAKGNHSSVTEFILLGLTEDPELQIILFVILLIIYLFSVMSNLGLVVLIQISPQLQSPMYFFLSHLAFVDFCYTSCVTPNALVNFLREIKSISFYGCAAQVCFFTTFSVC
615 >lcl|NP_001000685.1|Plus1complement(10730035..10730976) NW_047657 olfactory receptor Olr480 Olr480 __SEG__ Chr3 {Rattus norvegicus} MVKSNHSAVSEFVLVGLTDDPKLQVSLFGVFLVIYLTSVVGNIGLIVLIQVSPQLHTPMYFFLTHLAFIDFCFTSSVTPNTLLNFLREVKSITFYACATQLCCFVTFVVC
618 >lcl|NP_001000688.1|Plus1complement(9979085..9980014) NW_047657 olfactory receptor Olr436 Olr436 __SEG__ Chr3 {Rattus norvegicus} MEQSNGTRVTEFILLGFAGQHKSWHILFIIFLMIYVATLMGNIGMILLIKFDSSLHTPMYFFLQHLAFVDLCYTSAITPKMLKNFIETKASISYIGCMLQLLAYGTFATI
626 >lcl|NP_001000697.1|Plus1complement(8221995..8222942) NW_047773 olfactory receptor Olr1067 Olr1067 __SEG__ Chr7 {Rattus norvegicus} MKLQQSSNDTELTDFILLGFWTSSEARVPLFLLFLLIYLVIVLGNISMLTVIKIDSRLHTPMYFFLQNLSFLDLCYSTVIAPKTLATFLSKEKKISYNECATQFFFFALF
627 >lcl|NP_001000698.1|Plus1complement(7997688..7998644) NW_047773 olfactory receptor Olr1060 Olr1060 __SEG__ Chr7 {Rattus norvegicus} MKNQSEEIVFILLGLTGDPQLQILIFLFLFFNYILSLMGNLVIIFLTLLDPHLKTPMYFFLRNFSFLEIAFTTVCIPRFLMSILLGEKMILYNACVAQLFFFFLLGATEF
630 >lcl|NP_001000702.1|Plus1complement(5825103..5826038) NW_047773 olfactory receptor Olr982 Olr982 __SEG__ Chr7 {Rattus norvegicus} MKNRTSVTEFILLGLTKDPKLNIVIFIFLFLTYILSITGNLTIITLTLVDSHLKTPMYFFLRNFSFLEIAFTTVSIPRFLVSIVTGDMTISFNSCLAQEFFFILLGATEF
633 >lcl|NP_001000705.1|Plus1complement(4112930..4113874) NW_047773 olfactory receptor Olr922 Olr922 __SEG__ Chr7 {Rattus norvegicus} MKNQSMEFHFILLGLTDDPRLQIVVFLFLFLNYMMSLVGNLVIVFLTLLDPRLKTPMYFFLRNFSLLEIMFTTVCIPRFLTTIVTGDKTISYNNCASQLFFILLLGVTEF
634 >lcl|NP_001000706.1|Plus1complement(3631972..3632910) NW_047773 olfactory receptor Olr906 Olr906 __SEG__ Chr7 {Rattus norvegicus} MKNHSMINEFVLLGISDTPEVQVVIFIFLFIAYILSVTGNLTIITLTLLDSQLKTPMYFFLRNFSFLEIIFTSVSIPRFLEAIITKVKTISYNNCLTQLFFFISMGVSEF
635 >lcl|NP_001000707.1|Plus1complement(2336760..2337698) NW_047773 olfactory receptor Olr877 Olr877 __SEG__ Chr7 {Rattus norvegicus} MLAVKNQTSTEFILLGLTDSPDLQICVFLFLLLTYILSVLGNLTIIVLTLLDSHLQTPMYFFLRNFSFLEISFTSTFTPRMLFSISTGIKTISFAGCFTQYFFAIFFGAT
637 >lcl|NP_001000710.1|Plus1complement(12227724..12228656) NW_047773 olfactory receptor Olr1083 Olr1083 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFFLLGFSENPHLQFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLVNLSFVDICFTSTTIPKMLVNIHTQSKTITYVHCISQMCVFLVFAE
638 >lcl|NP_001000711.1|Plus1complement(12127746..12128678) NW_047773 olfactory receptor Olr1079 Olr1079 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFFLLGFSENPHLQFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFADICFTSTTIPKMLVNIHTQSNTITYEDCISQMFVLLVFGE
639 >lcl|NP_001000712.1|Plus1complement(12063524..12064480) NW_047773 olfactory receptor Olr1076 Olr1076 __SEG__ Chr7 {Rattus norvegicus} MEPGNDTQLSEFFLLGFSEKQPEIQPLIFGLFLSMYLVTVTGNLLIIMAIIVDAHLHTPMYIFLSNLSFVDICFTSITVPQMLVNIHTQSKVIIYANCITQVYFLLLFSV
641 >lcl|NP_001000726.1|Plus1complement(4961959..4962888) NW_047355 olfactory receptor Olr1555 Olr1555 __SEG__ Chr11 {Rattus norvegicus} MEKKNETLWSEFILTGLTCQPQWKTPLFLMFLVIYLMTIVGNLGLITLIWNDPHLHIPMYLFLSNLAFVDTWLSSTVTPKMLFNLLDKGKVISIAECMTQFFSFAISVTT
645 >lcl|NP_001000730.1|Plus1complement(8742012..8742956) NW_047562 olfactory receptor Olr278 Olr278 __SEG__ Chr1 {Rattus norvegicus} MAFLENGNYTALTEFILLGLTNDPVLRVILFIIILCIYLVTVSGNFSTILLIRVSSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVERNTISYLGCGIQLGSAVFF
649 >lcl|NP_001000735.1|Plus1complement(6636361..6637287) NW_047562 olfactory receptor Olr213 Olr213 __SEG__ Chr1 {Rattus norvegicus} MGGRNQTYVVEFILLGLSENPKVQILLFCIFLVIYFLSVFGNLLIIILIHIDSRLHTPMYFFLKNLSFADLCFSTSIVPQMLVHFLSKKKTISFIGCSIQIVVFLLAGCT
650 >lcl|NP_001000736.1|Plus1complement(6557350..6558300) NW_047562 olfactory receptor Olr209 Olr209 __SEG__ Chr1 {Rattus norvegicus} MEWWNSTLGGSFILVGILDDSGSPEMLCAVITALYMLALASNGLLLLVINMDRQLHIPMYHLLGQLSLIDFFLTSIIIPKAVMDFLLKDNTISLEGCALQMFLALTLGGA
653 >lcl|NP_001000739.1|Plus1complement(4641796..4642728) NW_047562 olfactory receptor Olr150 Olr150 __SEG__ Chr1 {Rattus norvegicus} MYNMSSYSTGPFTLSGIPGLEQYHVWISIPFCFIYLVAILGNSILLYLIAVERSLHSPMFFFLSMLAMTDLILSTTCVPKTLSIFWFGPQEISFPGCLTQLFFLHYSFVL
654 >lcl|NP_001000740.1|Plus1complement(4116063..4117022) NW_047562 olfactory receptor Olr125 Olr125 __SEG__ Chr1 {Rattus norvegicus} MATSNSSTIVSSTFYLTGIPGYEEFHHWISIPFCFLYLIGITGNCMILHIVRTDPRLHEPMYYFLAMLSLTDMAMSLPTMISLFRVLWSISREIQFNICVVQMFLIHTFS
666 >lcl|NP_001000753.1|Plus1complement(7827725..7828663) NW_047817 olfactory receptor Olr1345 Olr1345 __SEG__ Chr9 {Rattus norvegicus} MRGENITKVSTFILLGFPTAPRLQYLLFLLFLLIYLFVLVENLAIILTVWSSASLHRPMYYFLGIMSTLEIWYVCDIIPKMLDGFLLQRKHISFIGCMTQLYFFSSLVCT
668 >lcl|NP_001000755.1|Plus1complement(24892418..24893332) NW_047563 olfactory receptor Olr360 Olr360 __SEG__ Chr1 {Rattus norvegicus} MENRTWFILAGLTDNQRLQLPLLITFFLIYTITFVGNLGLILLILLDSRLHSPMYIFLSNLSLVDFCYSSTVTPKVIAGILTGDKIMSYNACASQMFFFANFANVENYLL
669 >lcl|NP_001000756.1|Plus1complement(24860030..24860962) NW_047563 olfactory receptor Olr358 Olr358 __SEG__ Chr1 {Rattus norvegicus} MENNTKVTEFLLLGLTIDPGLQLPLFMLFLLIYTITLVGNVGMILMIFLDSCLHTPMYFFLGNLSLVDFCYSSAVTPTVMTGLLIGNNVISYNDCAAQMFFFVAFATVEN
673 >lcl|NP_001000760.1|Plus1complement(23746648..23747595) NW_047563 olfactory receptor Olr331 Olr331 __SEG__ Chr1 {Rattus norvegicus} MEAIIKGKNITEITQFILLGFSDFHQITALLFVIFLTLYITALTWNLSLIVLIRMDSYLHTPMYFFLSNLSFIDLCYITSTVPKMLSNFFQEMQTISFVGCIVQYFIFST
675 >lcl|NP_001000762.1|Plus1complement(23447605..23448540) NW_047563 olfactory receptor Olr322 Olr322 __SEG__ Chr1 {Rattus norvegicus} MENYTRVKELIFLGLTQSHEVSMVLFLFLLLVYVTTLLGNLLIMVTVTYESRLHTPMYFLLRNLSIADICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDV
688 >lcl|NP_001000777.1|Plus1complement(31414453..31415370) NW_047334 olfactory receptor Olr1435 Olr1435 __SEG__ Chr10 {Rattus norvegicus} METGNHSSGTDFTLVGLFQCGHTDTFLFTIIVLLFAVALIGNITLVHIIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCAIQTFLFLTLGGS
690 >lcl|NP_001000779.1|Plus1complement(31209457..31210395) NW_047334 olfactory receptor Olr1424 Olr1424 __SEG__ Chr10 {Rattus norvegicus} MNNYTGKSDFDLVGLFSQSKHPTLLAGVIFVVFLMALSGNALLILLILFDTHLHTPMYFFISQLSLRDMMYISVTVPKMLMDQILGNHRISAAACGMQMFLYLTLVGSEF
691 >lcl|NP_001000780.1|Plus1complement(31133165..31134127) NW_047334 olfactory receptor Olr1421 Olr1421 __SEG__ Chr10 {Rattus norvegicus} MGIITCVNNYTGLSDFTLVGFLSQSKDPVLLAVLIFVVFLMALSGNALLILLILSDTHLHTPMYFFIGQLSLMDMMYISVTVPKMLMDQVLGSHKISAAACGMQMFLYLT
692 >lcl|NP_001000781.1|Plus1complement(30955280..30956287) NW_047334 olfactory receptor Olr1415 Olr1415 __SEG__ Chr10 {Rattus norvegicus} MDRKNKTTASFILLGLFPSCRYPNLLISVILLIYALASAGNSLLILLIWLDPRLHTPMYFLLSQLSLIDLAYISCTVPKAATNYFTGRRNISFFACATQMFSFLTLGLAE
693 >lcl|NP_001000782.1|Plus1complement(30937140..30938093) NW_047334 olfactory receptor Olr1414 Olr1414 __SEG__ Chr10 {Rattus norvegicus} MLEVQDISRGNGTSTDFILLGLFPELRYLGILIISILLIYLIAFTGNAVLVLLIWADSRLHTPMYILLSHLSLIDLALISTTVPKMVINFFSRKKSISKVACGTQIFFFF
700 >lcl|NP_001000789.1|Plus1complement(12627996..12628943) NW_047799 olfactory receptor Olr1338 Olr1338 __SEG__ Chr8 {Rattus norvegicus} MTQGVVSENNSSVKEFILLGLTQQPELQLPLFFLFLGIYVVSMVGNLGLIVLIVLNPHLHTPMYYFLFNLSFTDLCYSSVITPKMLVGFVKQNIISHAECMTQLFFFAFF
701 >lcl|NP_001000790.1|Plus1complement(12512947..12513885) NW_047799 olfactory receptor Olr1331 Olr1331 __SEG__ Chr8 {Rattus norvegicus} MRNDTSVTEFILLGISNSEGLESMLFILFLVFYVFALLGNLLIFLTILASPNLHTPMYFFLGNLAVFDIFFPSVNSLKMMDYLVGQSRTISYQGCASQIFFYHTLGCTEC
707 >lcl|NP_001000796.1|Plus1complement(11957566..11958492) NW_047799 olfactory receptor Olr1303 Olr1303 __SEG__ Chr8 {Rattus norvegicus} MAEGNYSIVSEFVFLGLTEKPELQLPLFLLFLVIYIVTLLGNLGMVMLILFSPHLHIPMYFFLSNLSFIDLCQSSVIIPKMLEKFIIVKSVISFAECMAQFYLFDVFAVS
708 >lcl|NP_001000797.1|Plus1complement(11204044..11205003) NW_047799 olfactory receptor Olr1291 Olr1291 __SEG__ Chr8 {Rattus norvegicus} MEDNMARNYCTVTEFFLAGLSQTPELQLPLFFLFTAIYLITVAGNLGMITLIVLSSHLHTPMYYFLSSLSFSDFCQSTVVIPKMLMSFLTEKNIISYPGCMTQLYFFITF
709 >lcl|NP_001000798.1|Plus1complement(11147462..11148406) NW_047799 olfactory receptor Olr1288 Olr1288 __SEG__ Chr8 {Rattus norvegicus} MEDIAAGNHCTVTEFFLAGLSEKPELQLPLFLFFTGIYLITVAGNLGMITLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVVPKMLVSFLTKKKLISYPACMVQLYFFLTF
710 >lcl|NP_001000799.1|Plus1complement(11077473..11078432) NW_047799 olfactory receptor Olr1286 Olr1286 __SEG__ Chr8 {Rattus norvegicus} MAAGNHCTVTQFFLAGLSEKPELQLPLFLLFVGIYLITVAGNLCMITLIGLSSHLHTPMYFFLSSLSFTDFCLSTVVTPKMLMSFVTEKNIISYPGCLAQLYFVIIFGSA
711 >lcl|NP_001000800.1|Plus1complement(10838430..10839365) NW_047799 olfactory receptor Olr1275 Olr1275 __SEG__ Chr8 {Rattus norvegicus} MEKGNRSTVTKFFLSGLTDQPELQLPLFLLFLGIYLLTVLGNLGTIILILLSSHLKTPMYFFLSSLSFIDLCQSTVITPKMLMIFLMAKNDISYTECIIQLYFFVIFVVS
712 >lcl|NP_001000801.1|Plus1complement(10819680..10820612) NW_047799 olfactory receptor Olr1274 Olr1274 __SEG__ Chr8 {Rattus norvegicus} MEKHNHSTVTKFFLSGLTDQPELQLPLFLLFLGIYLLTVLGNLGMIILILLSSHLKTPMYFFLSSLSFIDLCQSTVITPKMLVNFIVEENDISYPECMIQLYFFLLFAIS
716 >lcl|NP_001000805.1|Plus1complement(10401714..10402646) NW_047799 olfactory receptor Olr1253 Olr1253 __SEG__ Chr8 {Rattus norvegicus} MDSVNISLVTEFVLVGLTDQPHLQILLFFVFLAMYLVTVLGNLFLIILTVLNSHLHTPMYFFLFNLAFVDLCYSSVFTPQMLMNLITRKNTISYMECMTQLYFFCFFVIS
731 >lcl|NP_001000820.1|Plus1complement(8591923..8592852) NW_047799 olfactory receptor Olr1194 Olr1194 __SEG__ Chr8 {Rattus norvegicus} MAAENHSTVTEFILGGLTHRPELQLPLFLLFLGIYTVTMVGNLGMITLIGLNTQLHTPMYFFLSNLSLVDLCYSSVITPKMLINFVSQRNLISYVGCMSQLYFFLVFVIA
735 >lcl|NP_001000824.1|Plus1complement(2516412..2517404) NW_047653 olfactory receptor Olr421 Olr421 __SEG__ Chr3 {Rattus norvegicus} MATKNKTEVTEFVLLGLSNRPDMQPVIFGVILTMYLMSVLGNTLLVLVACSDPKLQTPMYFLLSQLSLIDISLTTITIPQMLVHTFSVDRSISYNRCMTQLFFFMAVGSM
736 >lcl|NP_001000825.1|Plus1complement(2470776..2471708) NW_047653 olfactory receptor Olr418 Olr418 __SEG__ Chr3 {Rattus norvegicus} MERDNKTNIVSEFILLGLSTRPEDQKPLFILFLTIYLITLAGNLLIILVIHSDPHLQTPMYFFLSFLSLTDICFTTTIVPKMLVNFLSEKKTISYAGCLTQMYFLYALGN
743 >lcl|NP_001000832.1|Plus1complement(3461848..3462804) NW_047453 olfactory receptor Olr1642 Olr1642 __SEG__ Chr15 {Rattus norvegicus} MKRNRNTSLDTVVTDFLLLGLAHPPNLRTFLFLVFFLIYILTQLGNLLILLTVWADPKLHARPMYILLGVLSFLDMWLSSVIVPQLILNFTPASKAIPFGGCVAQLYFFH
744 >lcl|NP_001000833.1|Plus1complement(3395587..3396528) NW_047453 olfactory receptor Olr1639 Olr1639 __SEG__ Chr15 {Rattus norvegicus} MERVNHTLLTEFVLTGVPRPPRLRTFLFVYFLLIYILTQLGNMLILITVCADTQLHARPMYVFLGARSVIDMGISTIIVPRLMMNFTPGIKPIPFGGCVAQLYFYHFLGS
745 >lcl|NP_001000834.1|Plus1complement(3051000..3051935) NW_047453 olfactory receptor Olr1638 Olr1638 __SEG__ Chr15 {Rattus norvegicus} MERTNLSQEMEFELLGLTSDPQLQKLLFVVFLIMYSITVLGNLVMFFLIHVSTTLHTPMYSLLKSLSFLDFCYSSTVVPQTLMNFLVQRKVISYFGCMAQMFFYAGFATS
746 >lcl|NP_001000835.1|Plus1complement(2213421..2214353) NW_047453 olfactory receptor Olr1633 Olr1633 __SEG__ Chr15 {Rattus norvegicus} MNLSTTHVTEFVLLGFPGSWKTQIFLFVLFLVFYVLTLLGNGAIICAVRCDSRLHTPMYFLLGNFAFLEIWYVSSTVPNMLANILSKTKAISFSGCFLQFYFFSSLGTTE
747 >lcl|NP_001000836.1|Plus1complement(2184093..2185067) NW_047453 olfactory receptor Olr1632 Olr1632 __SEG__ Chr15 {Rattus norvegicus} MSFFPRRYVDTMNTSATYVTEFILLGFPGSWKIQIFLFVLFLVFYVLTLLGNGAIICAVICDSRLHTPMYFFLGNFAFLEIWYVSSTTPNMLANILSKTKAISFSGCFLQ
748 >lcl|NP_001000837.1|Plus1complement(2169734..2170708) NW_047453 olfactory receptor Olr1631 Olr1631 __SEG__ Chr15 {Rattus norvegicus} MSFSPLRYVETMNTSATHVTEFVLLGFPGSWKIQIFLFVLFLVFYVLTLLGNGAIICAVICDSRLHTPMYFFLGNFAFLEIWYVSSTAPNMLANILSKTKAISFSGCFLQ
763 >lcl|NP_001000853.1|Plus1complement(3482547..3483485) NW_047690 olfactory receptor Olr803 Olr803 __SEG__ Chr4 {Rattus norvegicus} MGENMTWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYFFLCHLSVVDICYTSSGVPQMLAHFPMEKKTISFALCGTQHFFALALGGTE
767 >lcl|NP_001000857.1|Plus1complement(5363831..5364772) NW_047333 olfactory receptor Olr1380 Olr1380 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVTEFLLLGLSSQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMYFFLSNLSFVDLCFSSTTVPKVLANHILGSQIISFSGCLTQMYFLFMFVDM
768 >lcl|NP_001000858.1|Plus1complement(4954754..4955716) NW_047333 olfactory receptor Olr1364 Olr1364 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVSEFLLLGLSRQPQQQQLLFLLSLTMYLATVLGNLLIILAIIADSHLHTPMYFFLSNLSFVDVCFSSTTVPKVLANHILGSQVISFSGCLTQMYFLSVFADM
772 >lcl|NP_001000865.1|Plus1complement(15474545..15475483) NW_047798 olfactory receptor Olr1177 Olr1177 __SEG__ Chr8 {Rattus norvegicus} MIHNDVKNLTDVLEFHLMAISEDPDLQLFLFGLFLSVYLVTVLGNLLIILLIIFDSHLHTPMYFFLSNLSLIDIFFISTTIPKMIVGLKIHSRVISYAGCLTQMSLFLLF
775 >lcl|NP_001000869.1|Plus1complement(15035489..15036427) NW_047798 olfactory receptor Olr1163 Olr1163 __SEG__ Chr8 {Rattus norvegicus} MEAENHTAIVQFLLIGLSEDPKIQSILFGLFLSMFLVTMLGNFLIVLLTSCDSHLHTPMYFFLCNLSFVDICLTSTTIPKMLVNIYMHTMEISYTECLTQVYFFNNFLGM
778 >lcl|NP_001000872.1|Plus1complement(14779002..14779943) NW_047798 olfactory receptor Olr1158 Olr1158 __SEG__ Chr8 {Rattus norvegicus} MEPENITTTSKFILLGLSKENDIQPLLFALFLFIYLVCIVGNMLIILIISSDAHLHTPMYFFLSNLSFTDICFISTTVPKMLVNIQAQNISITYEGCLTQMYFFMCFSGL
780 >lcl|NP_001000874.1|Plus1complement(14438012..14438983) NW_047798 olfactory receptor Olr1149 Olr1149 __SEG__ Chr8 {Rattus norvegicus} MFHPLYQIYEQHEKRNQTAFPGFFLLGLTEDPKLQPVLVSLFFSIYLVTLLGNLLIIVISISDSHLHTPMYIFLSNLSLNDICLSTSTIPKMLVNIQENIQSITYKGCLT
782 >lcl|NP_001000876.1|Plus1complement(14168038..14168976) NW_047798 olfactory receptor 1144 Olr1144 __SEG__ Chr8 {Rattus norvegicus} MEKSNQTDFPVFLLLGLIEDTRLQPILVSVFFSIYLVTILGNLLIILISIYDSHLHTPMYLFLSNLSLNDICLSTSTIPKMLANIQENSQSITYKGCLTQMSFVLIFGGM
784 >lcl|NP_001000878.1|Plus1complement(13890951..13891889) NW_047798 olfactory receptor Olr1135 Olr1135 __SEG__ Chr8 {Rattus norvegicus} MDLKNQTAVSEFHLLGLTDNHKLLPLIFFMFLSMYLITVLGNLVIILAISSGSQLHTPMYLFLSILSINDICYSTVTIPKMLVNIQAHDDSISYIECLSQICFVSIFCGM
785 >lcl|NP_001000880.1|Plus1complement(13721264..13722202) NW_047798 olfactory receptor Olr1126 Olr1126 __SEG__ Chr8 {Rattus norvegicus} MGFINQTIPSDFLLLGLSRDPELQPVMFGLFLFIYLVTVIGNMFIILAINLDSHLHTPMYFFISNLSLTDICTSTTTIPKMLVNMQEQNLSITFAGCLTQACFAMLFVSL
787 >lcl|NP_001000882.1|Plus1complement(13566722..13567660) NW_047798 olfactory receptor Olr1122 Olr1122 __SEG__ Chr8 {Rattus norvegicus} MESKNQTDVSGFILMGITDDKALKPFIFSMFTSMYLLTILGNLLIILIVSTESNLQTPMYIFLSNLSFNDICLSTTIIPKTLVNIHAEEQSITYTGCLTQICFTLLFCSF
788 >lcl|NP_001000883.1|Plus1complement(12868410..12869375) NW_047798 olfactory receptor Olr1118 Olr1118 __SEG__ Chr8 {Rattus norvegicus} MQSRNHSTVLEFLLVGLTGDAQLQPLIFSLFLCIYLVTVLGNLLIILAVSSDLHLQTPMYFFLSSLSINDICLSTNTIPNMLINMITQNQSITYTGCLTQVWFVLVFTGL
789 >lcl|NP_001000884.1|Plus1complement(12846577..12847515) NW_047798 olfactory receptor Olr1117 Olr1117 __SEG__ Chr8 {Rattus norvegicus} MELKNQTAVSEFHLLGLTENHKLLPLIFIMFLSMYLITVLGNLIIILAISSGSQLHTPMYLFLSILSINDICYSTVTIPKMLVNIQAHDDSISYIECLSQICFVSIFGGM
790 >lcl|NP_001000885.1|Plus1complement(12785239..12786177) NW_047798 olfactory receptor Olr1115 Olr1115 __SEG__ Chr8 {Rattus norvegicus} MELKNQTAVSGFHLLGLTDNHKLLPFIFAMFLSMYLITILGNLLIIMTISSVSQLHTPMYLFLSILSINDICLSTVTIPKMLVNNQAQDKRISYIECLTQICFASIFGDM
793 >lcl|NP_001000888.1|Plus1complement(636663..637631) NW_047596 olfactory receptor Olr1692 Olr1692 __SEG__ Chr20 {Rattus norvegicus} MTARNITMSGFLLMGFSDNHDLQILQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMMQVFFFTALAWTE
794 >lcl|NP_001000889.1|Plus1complement(558685..559656) NW_047596 olfactory receptor Olr1689 Olr1689 __SEG__ Chr20 {Rattus norvegicus} MTARNITTMSGFLLKGFTDNHELQVLQALLFLVMYLLGSAGNFIIITITTLDPQLQSPMYYFLRHLSILDLSSLSVTVPQYVDSSLARSGYISYDQCMMQVFFFTAFAWT
795 >lcl|NP_001000890.1|Plus1complement(305479..306417) NW_047596 olfactory receptor Olr1682 Olr1682 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSILDPCLHSPMYFFLTNLSFLDICYTTSLVPQMLTNLGGSTKTISYMSCAVQLYFFHTMGVT
796 >lcl|NP_001000891.1|Plus1complement(274512..275555) NW_047596 olfactory receptor Olr1680 Olr1680 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELSLFIILLVTYPTAVIGNIAIILVSILDPCLHSPMYFFLTNLSFLDICYTTSLVPQMLTNLGGSTKAISYMRCAVQLYFYHTMGVA
797 >lcl|NP_001000892.1|Plus1complement(261423..262361) NW_047596 olfactory receptor Olr1679 Olr1679 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLSFADRPWLELPLFIFLLVTYPTAVIGNIAIILASILDPCLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLGGSTKAISYMRCAVQLYFYHTMGVA
798 >lcl|NP_001000893.1|Plus1complement(247819..248757) NW_047596 olfactory receptor Olr1678 Olr1678 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELSLFIILLVTYPTAVIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLRSSTKTISYMRCAVQLYFYHTMGIT
799 >lcl|NP_001000894.1|Plus1complement(212579..213517) NW_047596 olfactory receptor Olr1675 Olr1675 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDICYTTSLVPQILTNLGSSTKTISYMSCAVQLYFFHTMGVT
801 >lcl|NP_001000896.1|Plus1complement(1199859..1200788) NW_047596 olfactory receptor Olr1726 Olr1726 __SEG__ Chr20 {Rattus norvegicus} MNCTQAPGFILLGLSRDPEKWQLFFSIFLAFYLLGLSGNLLLLLAIGADVHLHTPMYFFLSQLSLVDLCFITTTVPKMLQTLWTGDGSISFSGCLTQFYFFAVFADMDNL
809 >lcl|NP_001000906.1|Plus1complement(3780730..3781689) NW_047784 olfactory receptor Olr1104 Olr1104 __SEG__ Chr7 {Rattus norvegicus} MGNVSAVSEFILLGLSADAQVQAVLFMVFLVIYVLTLTGNSMILLAISTDARLRSPMYFFLGHLSFLDLLYSSVSMPKMLENLVSERKTISVKGCLAQAFFVFAIGGTEA
812 >lcl|NP_001000911.1|Plus1complement(7320443..7321384) NW_047399 olfactory receptor Olr1597 Olr1597 __SEG__ Chr13 {Rattus norvegicus} MIQNNATCLHDFVFLGFSSFGELQLLLFVLFLSLYLVTITSNIFIIIVIRLDSHLHTPMYLFLSFLSFSETCYTLGIIPRMLSGLVMGGQVISFMGCATQMFFSASWACT
814 >lcl|NP_001000914.1|Plus1complement(10526547..10527497) NW_047627 olfactory receptor Olr392 Olr392 __SEG__ Chr2 {Rattus norvegicus} MMTLSWENQTVIVEFVLRGFSSILQLNISLFIMFCIFYILTISGNILIVLLVLCNHALHTPMYFFLVNLSFLEVCYTSNIVPKMLLIIIADLKTISVVGCLAQFYFFGSL
815 >lcl|NP_001000915.1|Plus1complement(39231150..39232088) NW_047657 olfactory receptor Olr790 Olr790 __SEG__ Chr3 {Rattus norvegicus} MEGKNYSVVSEFMFVGLTNSWKMEILLFVFASVFYMGSMMGNSLIIFTVASHPHLHSPMYFLLANLSFIDLGVSCVTCPKMIYDLFRKQKVISFNGCITQIFFIHVIGGV
817 >lcl|NP_001000917.1|Plus1complement(38910546..38911484) NW_047657 olfactory receptor Olr779 Olr779 __SEG__ Chr3 {Rattus norvegicus} MEGVNQSVVSEFVFLGLTNSWSIQLLLFVFSSMFYVASMMGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHKVISFTGCVTQIFFIHVIGGV
818 >lcl|NP_001000918.1|Plus1complement(38777426..38778364) NW_047657 olfactory receptor Olr774 Olr774 __SEG__ Chr3 {Rattus norvegicus} MDRKNYTVVSEFVFLGLTHSWEIQLLLLVVSSVLYILSMTGNILIVFSVTIDPHLHSPMYFLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGV
819 >lcl|NP_001000919.1|Plus1complement(38581158..38582096) NW_047657 olfactory receptor Olr768 Olr768 __SEG__ Chr3 {Rattus norvegicus} MDEANQTVVSEFILWGLSNSKSIQLFLFVILLMLYLLIMSGNIVILILITTDPHLLSPMYFLLANLSFVDMWLSSVTTPKMITDFLRENKTISFAGCMSQVFFAHCIAAG
821 >lcl|NP_001000922.1|Plus1complement(15972100..15973029) NW_047657 olfactory receptor Olr735 Olr735 __SEG__ Chr3 {Rattus norvegicus} MAAASNVTEIIFLGLSQSQHVQKVIFVMFLLMYTAIVLGNGLIVVTVMASKGLSSPMYFFLSYLSLVEVCYCSVTAPKLIFDSLLKRKVISLQGCITQIFFLHFFGGTEI
822 >lcl|NP_001000923.1|Plus1complement(15524731..15525684) NW_047657 olfactory receptor Olr714 Olr714 __SEG__ Chr3 {Rattus norvegicus} MGQSKIVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFFLASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDI
823 >lcl|NP_001000924.1|Plus1complement(14527076..14528011) NW_047657 olfactory receptor Olr666 Olr666 __SEG__ Chr3 {Rattus norvegicus} MHNQSFVNEFILLGFSQNPQIKKISFVIFLLVYIATLVGNMMIVVTIVYSPALLGSPMYFFLAFLSFLDACVSSVVTPKMIVDMVYERKSISFECCMTQVFAVHFLSAVE
824 >lcl|NP_001000925.1|Plus1complement(14375920..14376846) NW_047657 olfactory receptor Olr661 Olr661 __SEG__ Chr3 {Rattus norvegicus} MGYGNITEFILLGLFHDEDVKAICAVLFLLCYLAILCGNLIVLLTIKGSQLSEQPMYFFLSYLSFMDVCFTSTVAPKFIIGLLVQCNTISYNACIAQMFYAHFFGATEIF
825 >lcl|NP_001000926.1|Plus1complement(13355853..13356809) NW_047657 olfactory receptor Olr611 Olr611 __SEG__ Chr3 {Rattus norvegicus} MASEVTNQTSATTFILVGFSEYPQLQISLFLLFLAIYSVTLMGNLGILVVIKINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLQILIMEDRTISFTGCMIQFFFICTFV
828 >lcl|NP_001000930.1|Plus1complement(11420683..11421609) NW_047657 olfactory receptor Olr520 Olr520 __SEG__ Chr3 {Rattus norvegicus} MKNITEATSFVFKGLTDNKELQIILFFLFLAVYLFTLIGNIGLIFLVVGDPQLHNPMYCFLSALSSVDACYSSDITPNMLVGYMSNSKIISIHGCATQMFFAVTFGTTEC
829 >lcl|NP_001000931.1|Plus1complement(10985875..10986816) NW_047657 olfactory receptor Olr499 Olr499 __SEG__ Chr3 {Rattus norvegicus} MENHNRTVVTEFILMGITDHHGLQPSLFCLFLLIYLISLVGNLGMIVLTMVDSKLQTPMYFFLRHLATADLGYSTAVGPKMLTNFIVHQNRISFNLCATQLTFFLLFIAC
830 >lcl|NP_001000932.1|Plus1complement(10899657..10900595) NW_047657 olfactory receptor Olr491 Olr491 __SEG__ Chr3 {Rattus norvegicus} MEKRNFTVVTEFILMGITDRPELQAPLFGLFLIIYLISLMGNMGLIILTMVDSRLQTPMYFFLRHLAITDLGYSTAIGPKMLVNFIVNQNTITNHLCATQLTFFLVFIIC
831 >lcl|NP_001000933.1|Plus1complement(10887631..10888572) NW_047657 olfactory receptor Olr490 Olr490 __SEG__ Chr3 {Rattus norvegicus} MEQKNTTSLPGFILMGVTQSTELQLPLFGIFFIIYAVTVMGNLGMIILTKLDSRLQTPMYFFIRHLAFIDLGNSTVICPKMLVDFVMNEKNISFYACATQLSFFLLFIIS
836 >lcl|NP_001000940.1|Plus1complement(3294433..3295368) NW_047773 olfactory receptor Olr894 Olr894 __SEG__ Chr7 {Rattus norvegicus} MNHTEIVEFILLGLSDDPDLQIVIFLFLLITYILSVTGNLTIIVLTFVDSHLQTPMYFFLLNFAFLEVSFTSVCIPRFLGSIVTRNKTISYNNCAAQLFFFIFMGVCEFY
837 >lcl|NP_001000941.1|Plus1complement(12100017..12100946) NW_047773 olfactory receptor Olr1077 Olr1077 __SEG__ Chr7 {Rattus norvegicus} MEPRNNTRILEFILLGFSQDPNLQPVIYGLFLSMYLISVVGNLLIILTIISDANLHTPMYFFLSNLSFVDICFTSTTVPKMLVNIQTERKSISYAGCITQMYFFLTFVEL
838 >lcl|NP_001000945.1|Plus1complement(4581102..4582031) NW_047355 olfactory receptor Olr1535 Olr1535 __SEG__ Chr11 {Rattus norvegicus} MGIENATLLTEFVLTGLSHLPQWKIPLFLLFLVIYLITIVGNLGLITLIWNDPHLHIPMYLFLGSLAFVDTWLSSTVTPKMLLDFFTKSKLISFSECMIQFFSFGISATT
840 >lcl|NP_001000947.1|Plus1complement(8292377..8293348) NW_047562 olfactory receptor Olr255 Olr255 __SEG__ Chr1 {Rattus norvegicus} MAFLEGENYTAVTEFILLGLTDDPVLRVILFTIIICIYLVTVSGNLSTILLIRVSSQLQHPMYFFLSHLGSADLGYSSSVTPNMLVNFLIKQNTISYLGCSIQFGSAAFF
841 >lcl|NP_001000948.1|Plus1complement(5536772..5537722) NW_047562 olfactory receptor Olr194 Olr194 __SEG__ Chr1 {Rattus norvegicus} MALSNSSWRQPQPPFFLVGVPGLEESQHWIALPLGVLYLLALVGNVTISFIIWTDSSLHQPMYLFLAMLAAIDLVLASSTAPKALTVLLAHAHEIGYIVCLTQMFFIHAF
842 >lcl|NP_001000949.1|Plus1complement(5337820..5338758) NW_047562 olfactory receptor Olr179 Olr179 __SEG__ Chr1 {Rattus norvegicus} MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLIAVLGNVIILFVIYLEHSLHQPMFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFT
844 >lcl|NP_001000951.1|Plus1complement(3957118..3958062) NW_047562 olfactory receptor Olr114 Olr114 __SEG__ Chr1 {Rattus norvegicus} MSIFLMSNSSMSIFVLTGFPGLEVYFVLFAIPFSVIYAMVFLGNCMILHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWGFLQEISLDACIAQSYFIHGLS
845 >lcl|NP_001000952.1|Plus1complement(3883508..3884461) NW_047562 olfactory receptor Olr109 Olr109 __SEG__ Chr1 {Rattus norvegicus} MEITNSSWFQPPTLLLTGIPGLEDVQIWFCIPLCIMYLIALLGNCTILFVIKTTSILHEPQYIFLSMLAATDVGLSVSTLPTVMNVFLLNHRDIEFHSCLTQMFFIHTFS
852 >lcl|NP_001000959.1|Plus1complement(12001769..12002722) NW_047799 olfactory receptor Olr1305 Olr1305 __SEG__ Chr8 {Rattus norvegicus} MAEGNYSTVTEFVLIGLTEKPGLQLPLFFLFLGIYVVTVLGNLGMVMLILFSPHLHTPMYFFLSNLSLVDLCQSSVIMPKMLENFVMVKSVISYAECMAQFYLFDVFAVS
853 >lcl|NP_001000960.1|Plus1complement(11247133..11248044) NW_047799 olfactory receptor Olr1292 Olr1292 __SEG__ Chr8 {Rattus norvegicus} MEATAAGNHCTVTEFFLAGLSEKPELQLPLFLLFTGIYLITVAGILGMITLIGLSSHLHTPMYYFLSSLSFSDFCQSTVVIPKMLVNFVMEKNLITYPGCMTQLYFFTTF
854 >lcl|NP_001000961.1|Plus1complement(10928597..10929544) NW_047799 olfactory receptor Olr1279 Olr1279 __SEG__ Chr8 {Rattus norvegicus} MEEINQTSVAEFILTGLIDNTELQFPLFLIFLTVYLVTVVGNLGMIILILISSQLHTPMYYLLSSLSFIDCCQSTVIIPKMLLSFVTETNVILYPECITQFYFFCAFAVS
862 >lcl|NP_001000970.1|Plus1complement(2272787..2273773) NW_047453 olfactory receptor Olr1635 Olr1635 __SEG__ Chr15 {Rattus norvegicus} MLFSLLGYFLRYVDPMNLSTTHVTEFVLLGFPGSWKTQIFLFVLFLLFYVLTLLGNGAIICAVRCDSRLHTPMYFLLGNFAFLEIWYVSSTVPNMLANILSKTKAISFSG
863 >lcl|NP_001000971.1|Plus1complement(1994046..1994975) NW_047453 olfactory receptor Olr1625 Olr1625 __SEG__ Chr15 {Rattus norvegicus} MDYKNGSAVTEFILVGFSGDWQLQTFFFVTFTLIYGTTVVGNILIIVTVAATSTLHSPMYFLLGNLSFLDMCLSTVTTPKMITDLLAARKSISFQGCMAQMFFMHFFGGA
864 >lcl|NP_001000973.1|Plus1complement(1533063..1534043) NW_047453 olfactory receptor Olr1609 Olr1609 __SEG__ Chr15 {Rattus norvegicus} MERLNHSRVPEFVLLGLTDSPELQIFFFVAFSIFYLMTMLGNCLILFTVLSTSNLHSPMFFLLSNLSLIDICLSSFATPKMIMDFFAHHKTISFEGCISQIFLLHLFTGT
868 >lcl|NP_001000977.1|Plus1complement(3470890..3471831) NW_047690 olfactory receptor Olr802 Olr802 __SEG__ Chr4 {Rattus norvegicus} MKKDNATWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYFFLCHLSVVDICYTSSGVPQMLAHFLMEKKTISFALCGTQLFFALTLGGT
869 >lcl|NP_001000978.1|Plus1complement(5207476..5208417) NW_047333 olfactory receptor Olr1374 Olr1374 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSISEFLLLGLSRQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMYFFLSNLSFVDVCFSSTTVPKVLANYMLRSQAISFSGCLTQMYFIFKLTDM
870 >lcl|NP_001000979.1|Plus1complement(5091255..5092196) NW_047333 olfactory receptor Olr1370 Olr1370 __SEG__ Chr10 {Rattus norvegicus} MSSTNHSSVSVFLLLGLSSQPQQQQLLFLLFLTMYLATVLGNLIIILAISIDSHLHTPMYFFLSNLSFVDVCFSSSTVPKVLANHILGSQEISFSGCLTQMYFLSVFADM
871 >lcl|NP_001000980.1|Plus1complement(5036679..5037623) NW_047333 olfactory receptor Olr1366 Olr1366 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVSEFLLLGLSRQPQQQQQLLFLLFLTMYLATVLGNLLIILAISTDSHLHTPMYFFLSNLSFVDVCFSSTTVPKVLVNHILGSQVITFSGCLTQLYFFCVFAD
874 >lcl|NP_001000983.1|Plus1complement(15312293..15313288) NW_047798 olfactory receptor Olr1172 Olr1172 __SEG__ Chr8 {Rattus norvegicus} MEIENHTLITEFLILGLSDDPELQPILLGLFIFMYLVTVLGNLLIILAVSSDSHLHNPMYFLLSNLSFIDICFISTTIPKMLVNMKSQTKDISYIECVTQVFFFNTFAGM
877 >lcl|NP_001000986.1|Plus1complement(13828802..13829770) NW_047798 olfactory receptor Olr1132 Olr1132 __SEG__ Chr8 {Rattus norvegicus} MELKNQTAVSEFHLLGLTDNHKLLSLVLTMFLSMYLITILGNLLIIMTISSGSQLHNPMYLFLSLLSINDICYSTVIIPKILVNLQGQDNSISYIECLSQICFASVFGGM
879 >lcl|NP_001000988.1|Plus1complement(12939879..12940826) NW_047798 olfactory receptor Olr1119 Olr1119 __SEG__ Chr8 {Rattus norvegicus} MNLSNKSGISEFYLIGLTYGPDVESFIFSLFLCMYFVIIFGNFLIILAIISDSHLHTPMYFFIANLSFADICISTTIIPKILVNIQTQDKSISYGGCLSQVCFVLTFGGF
883 >lcl|NP_001000996.1|Plus1complement(38522304..38523242) NW_047657 olfactory receptor Olr766 Olr766 __SEG__ Chr3 {Rattus norvegicus} MDGENQTVVSEFILWGLAHSKNTQVFLFAIFMMLYLFIVSGNIVILILITTDSHLHSPMYFLLANLSFIDMWLSSNTTPKMITDFLRENKTISFAGCMCQVFFAHCIAAG
884 >lcl|NP_001000997.1|Plus1complement(14970734..14971669) NW_047657 olfactory receptor Olr689 Olr689 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNPNVENILCVVFLFIYLATIGGNMIIVVTIIYSPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCMTQLFAIHFFTGIE
889 >lcl|NP_001001002.1|Plus1complement(31048866..31049795) NW_047334 olfactory receptor Olr1417 Olr1417 __SEG__ Chr10 {Rattus norvegicus} MNNFTGQSGFTLVGFLSQSKHPALLAGVIFVVFLMALSGNTLLILLILSDTNLHTPMYFFISQLSLMDIMYISVTVPKMLIDQVLGNHRISAAACGVQMFLYLTLAGSEY
891 >lcl|NP_001001004.1|Plus1complement(3459511..3460452) NW_047690 olfactory receptor Olr801 Olr801 __SEG__ Chr4 {Rattus norvegicus} MKKDNATWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYFFLCHLSVVDICYTSSGAPQMLAHFLMEKKTISFALCGTQHFFALALGGT
892 >lcl|NP_001001005.1|Plus1complement(15267897..15268835) NW_047798 olfactory receptor Olr1171 Olr1171 __SEG__ Chr8 {Rattus norvegicus} MIHNPVENLTDVLEFHLVALSEDPDLQLFLFGLFLSVYLVTLLGNLLIILIIIFDSHLHIPMYYFLSNLSLVDIFLISTTIPKMIVGLKMHSRLISYAGCLTQMSLFLFF
893 >lcl|NP_001001006.1|Plus1complement(289690..290628) NW_047596 olfactory receptor Olr1681 Olr1681 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSTVDPSLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLGGSTKTISYLRCAVQLYFYHIMGGT
901 >lcl|NP_001001015.1|Plus1complement(2118146..2119081) NW_047453 olfactory receptor Olr1629 Olr1629 __SEG__ Chr15 {Rattus norvegicus} MAHSNESTVSEFVLLGLSKSWGLQLLLFTIFSVIYVTSVLGNVMIIVIIFADSHLNSPMYFLLGHLSFIDICQSNFATPKMLVDFFVELKTISFEGCMTQIFLLHSFVGS
904 >lcl|NP_001001018.1|Plus1complement(6483976..6484926) NW_047562 olfactory receptor Olr205 Olr205 __SEG__ Chr1 {Rattus norvegicus} MEFRNSTLGSGFILVGILDDSGSPELLCATVTALYMLAITSNGVLLLVITMDARLHVPMYLLLGQLSFIDLLLTSVITPKAVMDFLLKDNTISFEGCAFQMFLELALGSA
905 >lcl|NP_001001019.1|Plus1complement(24703068..24703991) NW_047563 olfactory receptor Olr349 Olr349 __SEG__ Chr1 {Rattus norvegicus} MENNTKVTEFLLLGLTNDPGLQLPLFMIFLLIYTITMIGNLGLILLIFLDFRLHTPMYFFLGNLSLVDFCYSSAVTPKVMTGLLIGNKVISYNDCAAQMFFFVAFASVEN
911 >lcl|NP_001001026.1|Plus1complement(4152314..4153261) NW_047562 olfactory receptor Olr127 Olr127 __SEG__ Chr1 {Rattus norvegicus} MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIPMYIFLAILAVTDIALSTCILPKMLGIFWFHMPQIFFDACLLQMELIHSFQ
912 >lcl|NP_001001027.1|Plus1complement(4286945..4287880) NW_047562 olfactory receptor Olr129 Olr129 __SEG__ Chr1 {Rattus norvegicus} MWSNNSDAPFLLTGFLGLEMIHHWISIPFFVIYFSIILGNGTLLFIIWNDHSLHEPMYYFLAVLASTDLGMTLTTMPTVLGVLVLNQREIAHGACLIQSYFIHSLAIVES
913 >lcl|NP_001001028.1|Plus1complement(5199547..5200503) NW_047562 olfactory receptor Olr174 Olr174 __SEG__ Chr1 {Rattus norvegicus} MSGANSSSVTTEYFILNGVPGLEDAHVWISLPFCFMYMIAVMGNCGLIYLIGHEEALHRPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNFKKIGFNSCLAQMFFVHMLT
914 >lcl|NP_001001029.1|Plus1complement(5227844..5228809) NW_047562 olfactory receptor Olr175 Olr175 __SEG__ Chr1 {Rattus norvegicus} MSGANSSSLTPEFFILNGIPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIVHEEALHRPMYYFLTLLSFTDITLCTTTVPNMLCIFWFNLKKIGFKACLAQMFFVHTFT
915 >lcl|NP_001001030.1|Plus1complement(5381860..5382798) NW_047562 olfactory receptor Olr181 Olr181 __SEG__ Chr1 {Rattus norvegicus} MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLTAVLGNVILLFVVHLEHSLHQPMFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFT
918 >lcl|NP_001001035.1|Plus1complement(7006011..7006958) NW_047562 olfactory receptor Olr232 Olr232 __SEG__ Chr1 {Rattus norvegicus} MRQANQTQVTEFLLLGLSDDPHTQTLLFILFLGIYLVTVLGNLLLMFLVRADSRLHTPMYFFLCNLSFADLCFSTNIVPQALTHFLSRKKSISFRRCAAQLLLFLIFGCT
920 >lcl|NP_001001038.1|Plus1complement(8364155..8365099) NW_047562 olfactory receptor Olr257 Olr257 __SEG__ Chr1 {Rattus norvegicus} MACLEDGNHTVVTEFILLGLTDNLVLKVILFTIILCIYLVTMSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLANFLVTQNTISYIGCGIQLSLVDFF
923 >lcl|NP_001001041.1|Plus1complement(23782536..23783477) NW_047563 olfactory receptor Olr334 Olr334 __SEG__ Chr1 {Rattus norvegicus} MIKERNITEIVQFILLGFSDFPHIKVLLLVMFLTLYITTLTWNLSLIVLIRMDSYLHTPMYFFLSNLAFIDICYISSTVPKMLSNLFQENQTISFVGCIVQYFIFSTMGL
924 >lcl|NP_001001042.1|Plus1complement(24536891..24537811) NW_047563 olfactory receptor Olr341 Olr341 __SEG__ Chr1 {Rattus norvegicus} MKNRTEVTQFILLGLTNDSSLQLPLFITFLLIYTITLVGNLGMILLIVLDSRLHTPMYIFLGNLSLVDLCYSSAVTPTVMTELLGGDKIISYNGCAVQMFFFGAFATVEN
932 >lcl|NP_001001051.1|Plus1complement(11750608..11751552) NW_047657 olfactory receptor Olr531 Olr531 __SEG__ Chr3 {Rattus norvegicus} MKLPEIRAEDNATTVTQFLLLGFSDLPNLQGFLFGMFSIIYIIILIGNSFIIVITRIDPALQKPMYFFLANFSSLEICYVSVTLPRILFNIAAQDRHISVLRCATQMCFF
933 >lcl|NP_001001052.1|Plus1complement(12010698..12011636) NW_047657 olfactory receptor Olr544 Olr544 __SEG__ Chr3 {Rattus norvegicus} MQYTNYTKPTEFIFIGFTDYLPLRLMLFLVFLIVYILTLVGNMGLIILVNIDLSLQTPMYHFLSNLSFLDISYSTAIAPKMLVDFLASKKSISFYGCAIQMFFFACFADA
934 >lcl|NP_001001053.1|Plus1complement(12049086..12050051) NW_047657 olfactory receptor Olr545 Olr545 __SEG__ Chr3 {Rattus norvegicus} MNLQRANKFKITETNITIPIEFVLLGFSDIPKLHWLLFGIFLFIYTIILLGNGIIILITRVDPSLQTPMYFYISNFSFLEIYYVSVTLPRMLMDLFTLKGNISFLACATQ
935 >lcl|NP_001001054.1|Plus1complement(12066031..12066969) NW_047657 olfactory receptor Olr546 Olr546 __SEG__ Chr3 {Rattus norvegicus} MRLWNHTGVKEFILVGLTENLNWQVGLFFLFSIVYFIILVANWGMILLIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSEYKSSTFFGCVIQSFFFAVYITT
936 >lcl|NP_001001055.1|Plus1complement(12243115..12244053) NW_047657 olfactory receptor Olr552 Olr552 __SEG__ Chr3 {Rattus norvegicus} MEVWNSTGVKEFILIGLTENPNWQVPLFLLFCIIYFIILVGNCGMIFLIWLNVQLHTPMYFFLSNLSFCDICYSTIIAPKMIINFLSEHKSTRLFACILQSFFFAVYATT
938 >lcl|NP_001001058.1|Plus1complement(13707053..13708003) NW_047657 olfactory receptor Olr629 Olr629 __SEG__ Chr3 {Rattus norvegicus} MESTNNITEFILLGLCQNKKIKTLCFLLFLFCYIAILGGNMIILISITYSQLVQQPMYFFLNYLALSDLCYTSTVTPKFLSDLIIERNIISYPSCMLQLFTMHFFGGIEI
939 >lcl|NP_001001059.1|Plus1complement(13718925..13719863) NW_047657 olfactory receptor Olr630 Olr630 __SEG__ Chr3 {Rattus norvegicus} MGNFTVFILLGLSDNQNIEVLCFVLFLFCYIAIWMGNVLIMVSITCTQLMDQPMYFFLHYLSLCDLCYTSTVTPKLLTDLLAERKIISYNNCMTQLFLLHLLGAIEIFIL
940 >lcl|NP_001001060.1|Plus1complement(14386700..14387632) NW_047657 olfactory receptor Olr662 Olr662 __SEG__ Chr3 {Rattus norvegicus} MLLNNNVTEFILLGLTQDPFRKKVLFVVFLLFYMGTLLGNLLIIATIKTSQALGSPMYFFLFYLSLSDTCFSTTIAPRTIVDSLLKQASISFTECIIQVFTFHFFGCLEI
941 >lcl|NP_001001061.1|Plus1complement(14618615..14619550) NW_047657 olfactory receptor Olr671 Olr671 __SEG__ Chr3 {Rattus norvegicus} MQNQSSVTEFIILGLSQNPKVEKILFVVFLLVYLATVGGNMIIVVTIMYSPALLGCPMYFFLAFLSFQDACVSSTVTPKMIVDFLHEKKTISFGWCMTQLFSVHFFSGAE
942 >lcl|NP_001001062.1|Plus1complement(14806976..14807908) NW_047657 olfactory receptor Olr677 Olr677 __SEG__ Chr3 {Rattus norvegicus} MENHSIVNEFILLGLSQNPRIEKILFAVFLLVYLATVGGNIVIIATIIYSPALLGSPMYFFLIFLSLLDTCTSTVVTPKLILDFFYERKSISFKGCMTQLFAFHFFTGVE
943 >lcl|NP_001001063.1|Plus1complement(15132943..15133863) NW_047657 olfactory receptor Olr696 Olr696 __SEG__ Chr3 {Rattus norvegicus} MKGNRMNVTEFILMGLTQNPQLQRILLLMLLITYIVTVTGNLLIVGTIVCSQSLNSPMYFFLAFLSVIDACYSSSIIPKMLADLLSETKTISFHGCMMQLFVEHFLGASE
944 >lcl|NP_001001064.1|Plus1complement(15155808..15156731) NW_047657 olfactory receptor Olr697 Olr697 __SEG__ Chr3 {Rattus norvegicus} MEKNNVTEFILLGLTQNPEGQKILFVTFLLIYIVTVMGNLLIMVTIMASQSLGSPMYFFLAYLSFIDTVYSTAIAPKMIIDLLYETKTISFRACMTQVFIDHLFAGAEVI
945 >lcl|NP_001001065.1|Plus1complement(15403055..15403978) NW_047657 olfactory receptor Olr707 Olr707 __SEG__ Chr3 {Rattus norvegicus} MGENNNITEFILLGLTQDPDGRKALFVIFFLIYIVTMMGNLLIVVTVIASPSLGSPMYFFLASLSLLDALFSTAISPKLIADLLYDQKTISFRACMSQLFIEHLFGGVDI
946 >lcl|NP_001001066.1|Plus1complement(15435714..15436658) NW_047657 olfactory receptor Olr709 Olr709 __SEG__ Chr3 {Rattus norvegicus} MGERNNVTEFVLLGLTKDPAGQKVLFVMFLLIYIVTMVGNLLIVVTVIASPSLGSPMYFFLACLSFLDIVYSTSISPKLIFDLLCDEKSISFTACMSQLFIEHLFGGTEI
947 >lcl|NP_001001067.1|Plus1complement(15670150..15671079) NW_047657 olfactory receptor Olr720 Olr720 __SEG__ Chr3 {Rattus norvegicus} MEPKNNVTYFVLLGLSQNPKVQKGLFVLFLLSYILTMVGNMLIVMTVTISNSLGSPMYFFLASLSFVDIIYSSAISPKLISDLFFSQNTISFKFCMTQLFTEHFFGGSEV
948 >lcl|NP_001001068.1|Plus1complement(38196524..38197462) NW_047657 olfactory receptor Olr747 Olr747 __SEG__ Chr3 {Rattus norvegicus} MNESNYSEVSEFIFLGLSTYRPTQYFLFAFSIISYAITFLGNFSVVFIVIFDPHLHSPMYFLLANLSFVDFCFSTSTVPKLISDLYSDHSIISIQSCIFQMFVLHLLGGC
949 >lcl|NP_001001069.1|Plus1complement(38452284..38453222) NW_047657 olfactory receptor Olr760 Olr760 __SEG__ Chr3 {Rattus norvegicus} MEGGNQTVVSEFIFWGLSRSQRIEVLLFVVFLMLYLLIVSGNIVILVLITNDPHLHSPMYFLLANLSFIDMWLSSVTTPKMITDFLREHKTISFAGCMCQVFFAHCIAAG
952 >lcl|NP_001001074.1|Plus1complement(5905306..5906241) NW_047773 olfactory receptor Olr984 Olr984 __SEG__ Chr7 {Rattus norvegicus} MNHTEIAEFILLGLSDDPDLQIVIFLFLLITYILSVTGNLTIIVLTFIDSNLQTPMYFFLRNFAFLEVSFTSVCIPRFLGSIVTRNKTISYNNCAAQLFFFIFMGVCEFY
953 >lcl|NP_001001075.1|Plus1complement(7038716..7039654) NW_047773 olfactory receptor Olr1022 Olr1022 __SEG__ Chr7 {Rattus norvegicus} MKNYTIITEFVLLGISGNRKLQVVIFVFLLITYIVSIIGNLTIIMLTLLDSHLKTPMYYFLCNFSFLRNYFHQCFHSQILASIITQVKTISYNNCLAQLFFFIFMGVTEI
955 >lcl|NP_001001077.1|Plus1complement(8255727..8256674) NW_047773 olfactory receptor Olr1068 Olr1068 __SEG__ Chr7 {Rattus norvegicus} MKLQQSSNDTELTDFILLGFWTSSEARVPLFLLFLLIYLVIVLGNISMLTVIKIDSRLHTPMYFFLQNLSFLDLCYSTVIAPKTLATFLSKEKKISYNECATQFFFFALF
956 >lcl|NP_001001078.1|Plus1complement(3804876..3805793) NW_047784 olfactory receptor Olr1105 Olr1105 __SEG__ Chr7 {Rattus norvegicus} MRNHSAVREFVLVGLSTDPHIQPALFVLFLLVYLLTVVGNSLMLFVIAADSHLHTPMYFFLRQLSFLDLCHSSVTAPKMLENLLSEEKTILVESCLAQAFFVFATGGTEA
957 >lcl|NP_001001079.1|Plus1complement(13963316..13964245) NW_047798 olfactory receptor Olr1137 Olr1137 __SEG__ Chr8 {Rattus norvegicus} MELRNQTTILEFHLLGLTSDPELEMLIYGIFLSIYLITILGNIIIFLAICSDSHLHTPMYFFLSILSINDMCLSTSTIPKMLVNIQAQNNTINYIQCISQLCFVSIFSGM
958 >lcl|NP_001001080.1|Plus1complement(13976658..13977599) NW_047798 olfactory receptor Olr1138 Olr1138 __SEG__ Chr8 {Rattus norvegicus} MEFSNQSGISEFFLIGLTYAPDIQSFIFGLFLCIYFVTIFGNILIILAVILDYHLHTPMYFFIANLSFTDICICTTIIPKMLLNIKTQNQSITYTGCLSQVCFVLIFGGL
959 >lcl|NP_001001081.1|Plus1complement(8620439..8621368) NW_047799 olfactory receptor Olr1195 Olr1195 __SEG__ Chr8 {Rattus norvegicus} MAVENHSTVTEFILGGLTHRPELQLPLFLLFLGIYTVTMVGNLGMITLIGLNTQLHTPMYFFLSNLSLVDLCYSSVITPKMLINFVSQRNLISYVGCMSQLYFFLVFVIA
963 >lcl|NP_001001085.1|Plus1complement(10406454..10407386) NW_047799 olfactory receptor Olr1254 Olr1254 __SEG__ Chr8 {Rattus norvegicus} MDSVNISLVTEFILVGLTDQPYLQIPLFIVFLAMYLITALGNVSLIILTVLNSHLHTPMYFFLFNLSFVDLCYSSVFTPQMLMNFIKRKNTISYMECMVQLYFSCFFVIS
966 >lcl|NP_001001088.1|Plus1complement(7806171..7807109) NW_047817 olfactory receptor Olr1343 Olr1343 __SEG__ Chr9 {Rattus norvegicus} MRGENITKVSMFILLGFPTGPELQYLLFLLFLLAYLFVLVENLAIILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFAGCMTQLYFFSSLVCT
975 >lcl|NP_001001097.1|Plus1complement(32703856..32704812) NW_047334 olfactory receptor Olr1462 Olr1462 __SEG__ Chr10 {Rattus norvegicus} MRSANQSCFWDTPKDFILLGISDRPWLELPVFVVLLVFYILAVLGNISIILVSQLDPQLQSPMYVFLSHLSFLDLCYTTTTVPQMLFNMGSSRKTISYGGCTVQYAIFHW
987 >lcl|NP_001001110.1|Plus1complement(664414..665358) NW_047596 olfactory receptor Olr1694 Olr1694 __SEG__ Chr20 {Rattus norvegicus} MWIINQSSVDGFILLGFSDRPWLETPLFVIFLVAYIFALFGNISIILVSRLDPQLDSPMYFFVSNLSLLDLCYTTSTVPQMLVNLRGPEKTISYGGCVAQLYIFLALGST
988 >lcl|NP_001001111.1|Plus1complement(710764..711729) NW_047596 olfactory receptor Olr1697 Olr1697 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFTKFSEVPGECFLLFTLILLMFLVSLTGNALIALAIYTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISQVGCATQMFFF
989 >lcl|NP_001001112.1|Plus1complement(738121..739086) NW_047596 olfactory receptor Olr1699 Olr1699 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFAKFSEVPGECFLLFTLILLMFLVSVTGNTLIALAICTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEVREISQEGCATQMFFF
990 >lcl|NP_001001113.1|Plus1complement(747810..748775) NW_047596 olfactory receptor Olr1700 Olr1700 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFAKFSEVPGECFLLFTLILLMFLVSLTGNTLIALAVCTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISREGCATQMFFF
991 >lcl|NP_001001114.1|Plus1complement(757027..757983) NW_047596 olfactory receptor Olr1701 Olr1701 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFAKFSEVPGECFLLFTLILLMFLVSLTGNTLIALAICTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISREGCATQMFFF
993 >lcl|NP_001001116.1|Plus1complement(1142795..1143724) NW_047596 olfactory receptor Olr1720 Olr1720 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPDFILLGLSSDPEKWQLFFSIFLAFYLLGLSGNLLLLLAIGADVHLHIPMYFFLSQLSLVDLCFITTTAPKMLQTLWTGDGSISFSGCLTQVYFIAVFADMDNL
994 >lcl|NP_001001117.1|Plus1complement(1160966..1161895) NW_047596 olfactory receptor Olr1722 Olr1722 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPDFILLGLSSDPEKWQLFFSIFLAFYLLGLSGNLLLLLAIGADIHLHTPMYFFLSQLSLVDLCFITTTAPKILQTLWTGDGSISFSGCLTQFYFFALFADMDNL
1006 >lcl|NP_001001272.1|Plus1complement(4296532..4297455) NW_047562 olfactory receptor Olr130 Olr130 __SEG__ Chr1 {Rattus norvegicus} MWSNNSDAPFLLTGFLGLEMIHHWISIPFFVIYFSIILGNGTLLFIIWNDHSLHEPMYYFLAVLASTDLGMTLTTMPTVLGVLVLNQREIAHGACFIQSYFIHSLAIVES
1008 >lcl|NP_001001274.1|Plus1complement(4466150..4467100) NW_047562 olfactory receptor Olr141 Olr141 __SEG__ Chr1 {Rattus norvegicus} MGAENNESLDLLSVFLTGIPGLEAQHGWFSIPFFIMYMVAIVGNSLIMAAVQEDSALHEPMYLFLSMLAITEVGVSVSTLPTVMGILWFDAYRIDFDGCLAQMFFIHTFS
1010 >lcl|NP_001001276.1|Plus1complement(25424941..25425885) NW_047563 olfactory receptor Olr377 Olr377 __SEG__ Chr1 {Rattus norvegicus} MAGKNYTFVTQFFLTAFTEHPEWGLPLFLLFLSFYLSTLLGNTGMIILIQKNRRLQTPMYFFLSHLSFVDICYSSVIIPQMLAVLWEHGTTISQVRCAVQFFLFTFFASI
1011 >lcl|NP_001001277.1|Plus1complement(25462157..25463104) NW_047563 olfactory receptor Olr380 Olr380 __SEG__ Chr1 {Rattus norvegicus} MADNGTRLTEFILMGFQLQAELRLGLFFMFLSFYLITIVGNLGMIMLIQSDPQLHTPMYFFLSHLSFLDICYSSVIVPQLLETLGNNEVVFTYERCVTQFFFFTFYGSTE
1012 >lcl|NP_001001278.1|Plus1complement(25504957..25505901) NW_047563 olfactory receptor Olr382 Olr382 __SEG__ Chr1 {Rattus norvegicus} MDNKSLTTVTEFILTGFTDHPEWEIPLFLVFLCFYLITILGNLGMVILIQMDAQLQTPMYFFLSHLSVMDACYTSVITPQILAMLATEKTVISYGHCAAQFFFFTFCAST
1019 >lcl|NP_001001285.1|Plus1complement(4306770..4307693) NW_047562 olfactory receptor Olr131 Olr131 __SEG__ Chr1 {Rattus norvegicus} MWSNISAAPFLLTGFPGLEAAHHWISIPFFAIYISVLLGNGTLLYLIKDDHNLHEPMYYFLAMLAGTDLTVTLTTMPTVMAVLWVNHREIRHGACFLQAYVIHSLSIVES
1020 >lcl|NP_001001286.1|Plus1complement(25440414..25441376) NW_047563 olfactory receptor Olr378 Olr378 __SEG__ Chr1 {Rattus norvegicus} MAKNNLTTITRFVLVGFIDLPKWEAPLFLVFVSFYIITILGNLGMIILIQVDIQLHTPMYFFLSHLSLLDACYTSVITPQILATLAQNKMIISYGQCATQFFFFTICAAT
1024 >lcl|NP_001001352.1|Plus1complement(4610153..4611073) NW_047355 olfactory receptor Olr1537 Olr1537 __SEG__ Chr11 {Rattus norvegicus} MTGENQTVVAEFVLTGLTESPELQIPLFLIFFIIYLITMVGNLGLIALIWKDPHLHTPMYLLLGSLAFADACASSSVTPKMLVNILSKDHKILLVECFTQFYFFGSSATT
1025 >lcl|NP_001001353.1|Plus1complement(4600543..4601472) NW_047355 olfactory receptor Olr1536 Olr1536 __SEG__ Chr11 {Rattus norvegicus} MGTENATLLTEFVLTGLSHQPSWKISPFLLFLSIYLITIVGNLGLIILIWNDPCLQIPMYLFLGCLALVDTWLSTTVTPKMFLTFIDKSKLISLSECMIQFFSFVMCATM
1026 >lcl|NP_001001354.1|Plus1complement(3973798..3974733) NW_047773 olfactory receptor Olr917 Olr917 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTTFILLGLTDNQQLQVLIFIILFFTYSLSITGNLAIISLILVDPHLKTAMYYFLKNFAVLEISFTSASIPRYLYSIATGDKTITYNACVAQVFFTDLFGVTEFF
1027 >lcl|NP_001001355.1|Plus1complement(3582949..3583887) NW_047773 olfactory receptor Olr905 Olr905 __SEG__ Chr7 {Rattus norvegicus} MRNHSMVTEFLLLGISDTPEVQVVIFIFLLIAYMVSVTGNLTIITLTLLDSQLKTPMYFFLQNFSFLEIIFTSVSIPRFLESIITKVKTISYNNCLAQLYFFLSLGVSEF
1028 >lcl|NP_001001356.1|Plus1complement(4057496..4058428) NW_047773 olfactory receptor Olr920 Olr920 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTAFILLGLTNDPQLKALIFIFLFLTYVLSMTGNLTIIFLTFIDSHLKTAMYFFLQNFSFLEISFTTACIPRYLYNISTGDKTITYNNCIIQIFCTDLFGVTEFF
1030 >lcl|NP_001001358.1|Plus1complement(2642386..2643321) NW_047773 olfactory receptor Olr883 Olr883 __SEG__ Chr7 {Rattus norvegicus} MRNHTVITFILLGLTDDQQLQVLIFIILFFTYSLSITGNLAIISLVLVDPHLKTAMYYFLKNFAVLEISFTSASIPRYLYSIATGDKTITYNACVAQVFFTDLFGVTEFF
1034 >lcl|NP_001001362.1|Plus1complement(7959440..7960420) NW_047773 olfactory receptor Olr1059 Olr1059 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQIPIFLFLFFNYILSVMGNFIIILLTLLDPHLKTPMYFFLRNFSFLEIAFTTVCIPRFLISILSGDRTISYNACAAQLFFFFLLGATEF
1036 >lcl|NP_001001364.1|Plus1complement(7714860..7715795) NW_047773 olfactory receptor Olr1051 Olr1051 __SEG__ Chr7 {Rattus norvegicus} MRNRTLVTTFVLLGLTDDPQWQIVIFLFLFIAYVLSITGNLTIILLTLLDSHLKTPMYFFLQKFSFLEISLTSTCIPRFLVSIVTMNKTISVEACFTQLFAAFIFGIAQF
1038 >lcl|NP_001001366.1|Plus1complement(7205611..7206549) NW_047773 olfactory receptor Olr1029 Olr1029 __SEG__ Chr7 {Rattus norvegicus} MKNHTRVTFFIIAGLIDDPQWKAVLFIFLLLTYLLSITGNLTIITLTLVDTHLKTPMYFFLRNFSFLEISYTTTCIPKLLVIMATGDKTISYGNCFTQVFFAFLFGASEF
1039 >lcl|NP_001001367.1|Plus1complement(4457262..4458203) NW_047773 olfactory receptor Olr936 Olr936 __SEG__ Chr7 {Rattus norvegicus} MRNRTSVTYFILLGLTDDPELQVVIFFFLFLAYVLSITGNLTIITLTLLDSHMKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKYISYNACAAQLFFFIFLGSTEF
1040 >lcl|NP_001001368.1|Plus1complement(4656806..4657744) NW_047773 olfactory receptor Olr943 Olr943 __SEG__ Chr7 {Rattus norvegicus} MRNHSRITDFVLLGISDTPEVQILIFILLFIAYILSVTGNLTIIILTLLDSQLKTPMYFFLQNFSFLEIIFTSVSIPRFLESIITKVKTISYNNCLAQLYFFLSLGVSEF
1041 >lcl|NP_001001369.1|Plus1complement(4776529..4777467) NW_047773 olfactory receptor Olr947 Olr947 __SEG__ Chr7 {Rattus norvegicus} MPNKTAITEFILLGLTDDPELQILIFFFLLTTYLLSVSGNMTIITLTLSNILLKTPMYFFLRNFSFLEILFTTVCIPRFLISIATGNKAISYNACMAQVFFLIFLGATEF
1043 >lcl|NP_001001371.1|Plus1complement(6493634..6494572) NW_047773 olfactory receptor Olr1002 Olr1002 __SEG__ Chr7 {Rattus norvegicus} MKNHTRVTFFIIAGLTDDPQWKAVLFIFLLLTYLLSITGNLTIITLTLVDAHLKTPMYFFLRNFSFLEISYTTTCIPKLLVIMATGNKTISYGNCLTQVFFAFLFGASEF
1044 >lcl|NP_001001372.1|Plus1complement(6729663..6730586) NW_047562 olfactory receptor Olr219 Olr219 __SEG__ Chr1 {Rattus norvegicus} MGEENGTSVTEFIFLGLSQDPQTQVLLFFLFLLIYLLTVLGNLLIVVLIHSDPRLHTPMYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCT
1045 >lcl|NP_001001373.1|Plus1complement(416557..417510) NW_047596 olfactory receptor Olr1686 Olr1686 __SEG__ Chr20 {Rattus norvegicus} MTINKSSGGDFILVGFSDQPRLEKILFVVVLISYLLTLVGNTAIILVSCLDSALQTPMYYFLTNLSFVDICFSTSIVPQLLWNLHGPAKTITATGCAIQLYVSLALGSTE
1051 >lcl|NP_001001379.1|Plus1complement(13938226..13939182) NW_047773 olfactory receptor Olr1090 Olr1090 __SEG__ Chr7 {Rattus norvegicus} MAVTLGRNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLVTLLGNLLIMVTIWSEHSLHTPMYLFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
1052 >lcl|NP_001001380.1|Plus1complement(14059660..14060616) NW_047773 olfactory receptor Olr1092 Olr1092 __SEG__ Chr7 {Rattus norvegicus} MAVTLGLNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLVTLLGNLLIMATIWSEHSLHTPMYLFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
1054 >lcl|NP_001001382.1|Plus1complement(2843830..2844774) NW_047773 olfactory receptor Olr886 Olr886 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIQLQILLLLSYMLSLSGNLTIITLTLIDPRLKTPMYIFLKKFSFLEISLTTACIPRFLYSISSGDKSITYIACVSQLSFIDLFAVTEFFLLAI
1055 >lcl|NP_001001384.1|Plus1complement(15980780..15981709) NW_047657 olfactory receptor Olr736 Olr736 __SEG__ Chr3 {Rattus norvegicus} MAHLLNVTEFIFLGLSPNKEGQRVCFVLFLLLYMAIVLGNLLMVVTVAASRNLGSPMYFFLSFLSFVEICYSSTTAPKLIFDLLAEKKSISVWGCMTQLFFMHFFGGTEI
1056 >lcl|NP_001001385.1|Plus1complement(4080503..4081438) NW_047773 olfactory receptor Olr921 Olr921 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIRLQILLFMFLILSYMLSLSGNLTIITLTLIDPHLKTPIYIFLKNFSFLEISLTTACIPRFLYSISSGDKSITYIACASQLLFIDLFAVTEFF
1057 >lcl|NP_001001386.1|Plus1complement(4386212..4387147) NW_047773 olfactory receptor Olr932 Olr932 __SEG__ Chr7 {Rattus norvegicus} MRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYMLSITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFFIFLGSTEF
1059 >lcl|NP_001001388.1|Plus1complement(14175378..14176334) NW_047773 olfactory receptor Olr1093 Olr1093 __SEG__ Chr7 {Rattus norvegicus} MAVTLGLNHTFVSEFILIGFSTFPPLQLMFFLLFLLMYLVTLLGNLLIMATIWSEHSLHTPMYLFLSTLSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
1065 >lcl|NP_001001425.1|Plus1complement(1444984..1445925) NW_047596 olfactory receptor 1743 Olr1743 __SEG__ Chr20 {Rattus norvegicus} MEIVSTGNRTVSEFVLLGFHEIPGLHLLFFSVFIILYVSIITGNMLIAVVVVSSQRLHTPMYFFLVNLSFIEVVYTSTVVPKMLEGFVQEATISVAGCLLQFFVFGSLAT
1075 >lcl|NP_001002284.1|Plus17031717..7032778 NW_047558 MAS-related G protein-coupled receptor, member B5 Mrgprb5 __SEG__ Chr1 {Rattus norvegicus} MPDSPTESYGPDREYHVFISLFLCRNTSGKFLSVGPATPGWSINNTVVKENYYTEILSCIITFNTLNFLTATISVVGMAGNATVLRLLGFHMHRYAFSVYVFNLAGADFL
1076 >lcl|NP_001002285.1|Plus1complement(7291202..7292146) NW_047558 MAS-related G protein-coupled receptor, member X2-like Mrgprx2l __SEG__ Chr1 {Rattus norvegicus} MSSCGIMSCTMIFLSLIIAIVVLVGNAIVIWLLGFQMCRNAFSIYILNLAGADFLFIGFQIGYCFYIIFDIYTIPIKLPLFFIVMLNFAYLCGLSILSAVSIERCLCVMR
1079 >lcl|NP_001002291.1|Plus1complement(21075710..21076651) NW_047334 olfactory receptor Olr1384 Olr1384 __SEG__ Chr10 {Rattus norvegicus} MWLNQSFTDDFILLGIFSYSPTDLLLFSVVMLVFTVALCGNVLLILLIYTDPRLHTPMYFFLSQLSLMDLMLVCTNVPKMAFNFLSGKKSISFVGCGIQIGLFVSLVGSE
1080 >lcl|NP_001002853.1|Plus1complement(34957782..34958792) NW_047625 purinergic receptor P2Y, G-protein coupled, 13 P2ry13 __SEG__ Chr2 {Rattus norvegicus} MLGTVNTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFFTGVLLNTLALWVFIHIPSNSTFIIYLKNTLVADLIMTLMLPFKILSDSRLAPWQLRGFVCTFSSVVFYETM
1082 >lcl|NP_001003654.1|Plus17101116..7101628 NW_047535 partitioning defective 6 homolog alpha isoform 2 Pard6a __SEG__ Chr19 {Rattus norvegicus} MSVRVAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDNSDPV
1084 >lcl|NP_001005877.1|Plus1complement(2108451..2109443) NW_047557 free fatty acid receptor 2 Ffar2 __SEG__ Chr1 {Rattus norvegicus} MTPDWHSSLILTAYILIFLTGLPANLLALRAFVSRVRQPQPAPVHILLLNLTLADLLLLLLLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISIERYLG
1086 >lcl|NP_001006595.1|Plus1complement(4857114..4858013) NW_047562 olfactory receptor Olr156 Olr156 __SEG__ Chr1 {Rattus norvegicus} MTFTLMGVPGLESQHIWLSLPFTSMLLAILIGNGAILFLVITEPTLHTPMYLLLALLMVADLISTLALLPKVLCLFWFDDRVIAVYACFTQMFFIHGASVVQSALLVAMA
1089 >lcl|NP_001006598.1|Plus1complement(4939209..4940150) NW_047333 olfactory receptor Olr1362 Olr1362 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVTEFLLLGLSRQPQQQQFLFLLFLTMYLATVLGNVLIILAISTDSRLHTPMYFFLCSLSFVDVCFSSTTAPNVLANHILGSQKISFSGCLTQLYFLCIFGDM
1092 >lcl|NP_001008526.1|Plus1complement(31832359..31833702) NW_047762 BCL2-associated athanogene 5 Bag5 __SEG__ Chr6 {Rattus norvegicus} MDMGNQHPSISRLQEIQREVKSIEQQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQDTERLLKELEQNANHPHRIEIKNIFQEAQALVKEKTV
1093 >lcl|NP_001009172.1|Plus1complement(1726676..1728586) NW_047597 zinc finger and BTB domain containing 22 Zbtb22 __SEG__ Chr20 {Rattus norvegicus} MEPSPMSPSGATLPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
1095 >lcl|NP_001012045.1|Plus133363633..33365036 NW_047454 kelch repeat and BTB (POZ) domain containing 7 Kbtbd7 __SEG__ Chr15 {Rattus norvegicus} MQSREDAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQA
1101 >lcl|NP_001014121.1|Plus119676863..19677927 NW_047813 progestin and adipoQ receptor family member VIII Paqr8 __SEG__ Chr9 {Rattus norvegicus} MTTAILERLSTLSVSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTL
1108 >lcl|NP_001020096.1|Plus1complement(8614003..8615124) NW_048034 G protein-coupled receptor 34 Gpr34 __SEG__ ChrX {Rattus norvegicus} MTTTVDSWLCSSPGMHFITNDSDQVSQNFSGVSNVTSCPMDEKLLSTVLTTFYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQN
1109 >lcl|NP_001020214.1|Plus1complement(4861904..4863547) NW_047658 inositol 1,4,5-triphosphate receptor interacting protein-like 1 precursor Itpripl1 __SEG__ Chr3 {Rattus norvegicus} MAVISLLFLAVMYVVHHPLMVSDRMDLDTLARSRQLEKRMSEEMRQLEIEFEERSRAAEEKQKAENFWRGDTSNDQLVLGKKDMRWPFQASGQDGGPLGWMLGNLWNAGL
1110 >lcl|NP_001020306.1|Plus1complement(1326287..1326655) NW_047339 hypothetical protein LOC497995 LOC497995 __SEG__ Chr10 {Rattus norvegicus} MACCSTSFCGFPTCSTGGTCGSSCFQPSCCETSCFQPSCCETGYGIGGGIGYGLEGGSGAVNYRVRWCRPDCRVEGTSLPPCCVVSCIPPTCCQLHHAQASCCRPSYCGQ
1112 >lcl|NP_001028844.1|Plus1complement(33355059..33355913) NW_047658 bcl-2-like protein 1 isoform 1 Bcl2l1 __SEG__ Chr3 {Rattus norvegicus} MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTS
1113 >lcl|NP_001029182.1|Plus1complement(475039..477474) NW_047693 TLR4 interactor with leucine rich repeats precursor RGD1310827 __SEG__ Chr4 {Rattus norvegicus} MEGVGAVRFWLVVCGCLAFPPRAESVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQDVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLE
1114 >lcl|NP_001029253.1|Plus1556749..557786 NW_047725 progestin and adipoQ receptor family member VII Paqr7 __SEG__ Chr5 {Rattus norvegicus} MAMAVAQKFSHLLSSLWHVGQKPLQAEPVFTVDRAEVPRLFWKPYIYAGYRPLHQNWCFYFRTLFQQHNEAVNVWTHLLAALALLLRLIVLAGSVDFWEDPHALPLFIIV
1115 >lcl|NP_001032413.1|Plus1complement(26179410..26181368) NW_047689 leucine rich repeat containing 4 Lrrc4 __SEG__ Chr4 {Rattus norvegicus} MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNAI
1117 >lcl|NP_001032440.1|Plus118114070..18116220 NW_047695 leucine rich repeat neuronal 1 precursor Lrrn1 __SEG__ Chr4 {Rattus norvegicus} MARLSPGKAACWMVLGLLIPSLTESSILNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPGNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNI
1118 >lcl|NP_001034095.1|Plus111908261..11910030 NW_047560 ectoderm-neural cortex protein 2 Klhl25 __SEG__ Chr1 {Rattus norvegicus} MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
1121 >lcl|NP_001037746.1|Plus1complement(1760719..1761636) NW_047566 hypothetical protein LOC682010 MGC93861 __SEG__ Chr1 {Rattus norvegicus} MLWAQRKKRKATTETTEDKPAESHRPNDSWIKSHFSRLSEEKLPAYRRVSSCGYSPEGKHGEANTTLHVDTVTTKHGEGGVALHRDSFASKQKISGTSVSKEMQRESGKS
1122 >lcl|NP_001039308.1|Plus125738039..25739073 NW_047454 lysophosphatidic acid receptor 6 Lpar6 __SEG__ Chr15 {Rattus norvegicus} MVSANGSHCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCI
1124 >lcl|NP_001065245.1|Plus1complement(1252281..1253300) NW_047510 G protein-coupled receptor 17 Gpr17 __SEG__ Chr18 {Rattus norvegicus} MDGLETALPSLTDNASLAYSEQCGQETPLENMLFACFYLLDFILAFVGNALALWLFIWDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFL
1125 >lcl|NP_001073358.2|Plus1complement(29145933..29147288) NW_047562 selenophosphate synthetase 2 Sephs2 __SEG__ Chr1 {Rattus norvegicus} MAEAAAGASGEAMAALVAAEGSLGPAGWSAGRSFSNYRPFEPQTLGFSPSWRLTSFSGMKG*GCKVPQETLLKLLEGLTRPALQPPLTSGLVGGQEETVQEGGLTTRPGP
1126 >lcl|NP_001073849.1|Plus1complement(42972446..42973507) NW_047760 transmembrane protein 30B Tmem30b __SEG__ Chr6 {Rattus norvegicus} MTWSASARGAQQPDNTAFTQQRLPAWQPLLSAGITLPLFFCAGLAFIGLGLGLFYSSNGIQELEYDYTGNPGTGNCSVCAAKGQDRAPPPSCQCSWSFTLPELFPGPVYL
1128 >lcl|NP_001094413.1|Plus15402475..5403371 NW_047393 G protein-coupled receptor 39 isoform 2 Gpr39 __SEG__ Chr13 {Rattus norvegicus} MASSSGSSNICSRVIDHSHVPEFEVATWIKITLTLVYLIVFVVGILGNSVTIRVTQVLQKKGYLQKEVTDHMISLACSDILVFLIGMPMEFYSIIWNPLTTPSYALSCKL
1129 >lcl|NP_001094466.1|Plus1complement(15540076..15540882) NW_047626 TRAF domain and POZ/BTB containing protein T1 RGD1559714 __SEG__ Chr2 {Rattus norvegicus} MSRDLEVKSCGYIHISVQNFCYEWAIRNFSFCMDGIRENITSPGFSLEASEEVQWCLTIYPNGVDEESTDYLSVYLGLLSCPKSPVWAKVQFWIINAQGEKYVITKISDV
1132 >lcl|NP_001099383.1|Plus1complement(3119684..3122173) NW_047369 extracellular leucine-rich repeat and fibronectin type III domain containing 1 Elfn1 __SEG__ Chr12 {Rattus norvegicus} MAGHGWGAPWVLVAAATLLHACGLAQGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNL
1133 >lcl|NP_001099527.1|Plus1complement(66969509..66972031) NW_047454 SLIT and NTRK-like family, member 6 Slitrk6 __SEG__ Chr15 {Rattus norvegicus} MKLRICLLYPSLLACLSLQSQSPMPPVRGSCDTLCTCEEKDGIMIINCEEKGINTLSQISVPPSRPFHLSLLNNGLTTLHTNDFSGLTNALSIHLGFNNIADIETGAFNG
1134 >lcl|NP_001099548.1|Plus1complement(2348518..2349339) NW_047470 testis-specific serine kinase 6 Tssk6 __SEG__ Chr16 {Rattus norvegicus} MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGS
1136 >lcl|NP_001099686.1|Plus1complement(1905639..1906706) NW_047555 formyl peptide receptor 1 Fpr1 __SEG__ Chr1 {Rattus norvegicus} MNTNMSAVNFMNMSGSTRSVSAGYIVLDIFSYLIFALTFVLGVLGNGLVIWVAGFRMKRTVTTISYLNLAIADFCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDIN
1137 >lcl|NP_001099703.1|Plus1complement(2993577..2994275) NW_047556 hypothetical protein LOC292706 RGD1311676 __SEG__ Chr1 {Rattus norvegicus} MGVSHSSREEWERESRTDLWWAHIQEAFMKKCDFSWDQIKQLHQRFRLLSGDQPTLRPENFDNVLDLEFNPIRSRIVRAFFDNRNLGKGTSGLAEEITFQDFLTIISYFR
1138 >lcl|NP_001099936.1|Plus1complement(14159247..14160374) NW_047627 protein arginine methyltransferase 6 Prmt6 __SEG__ Chr2 {Rattus norvegicus} MSLSKKRKLESGVGGAGGEGAEEENGGEQEAAPPRPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
1140 >lcl|NP_001100127.1|Plus1complement(1637859..1639871) NW_047712 zinc finger and BTB domain containing 5 Zbtb5 __SEG__ Chr5 {Rattus norvegicus} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
1141 >lcl|NP_001100193.1|Plus1complement(2593711..2595630) NW_047759 phosphoinositide-3-kinase, catalytic, gamma polypeptide Pik3cg __SEG__ Chr6 {Rattus norvegicus} MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIY
1142 >lcl|NP_001100220.1|Plus114997202..14999184 NW_047762 fibronectin leucine rich transmembrane protein 2 Flrt2 __SEG__ Chr6 {Rattus norvegicus} MGLQTAKWPSHGTFVLKFWLIMSLGLYSHVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
1144 >lcl|NP_001100342.1|Plus1complement(1494464..1495534) NW_047804 chemokine (C-C motif) receptor 1-like 1 Ccr1l1 __SEG__ Chr8 {Rattus norvegicus} MESPAVTESSYNTVAMNDFFSGFVCFSINVRAFGITVLTPLYSLVFVIGVIGNVLVVLVLIQRKRLRNMTSIYLFNLAVSDLVFLFTLPFWVDYIVKGDWVFGNAMCKFL
1150 >lcl|NP_001100753.1|Plus1complement(65069042..65071132) NW_047454 SLIT and NTRK-like family, member 1 Slitrk1 __SEG__ Chr15 {Rattus norvegicus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
1152 >lcl|NP_001100796.1|Plus1complement(2326100..2328001) NW_047476 kelch repeat and BTB (POZ) domain containing 11 Kbtbd11 __SEG__ Chr16 {Rattus norvegicus} MENSVAPFVLYPGTEPRTPGEDSLPLPAEEEGAASPAQTPCSLSASLCFSSGDDSPPQSRASAAEGSEASPPSLRSDLRVVETQWDVSSAASPESPQECARPEEPASPEE
1153 >lcl|NP_001101147.1|Plus1complement(34925689..34926753) NW_047625 G protein-coupled receptor 87 Gpr87 __SEG__ Chr2 {Rattus norvegicus} MNVSPFSGNELYSQASHTANSTIEGHGKNSTHHNEFDTIILPVLYLVIFVASILLNGLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILC
1154 >lcl|NP_001101153.1|Plus1complement(50061055..50063994) NW_047625 SLIT and NTRK-like family, member 3 Slitrk3 __SEG__ Chr2 {Rattus norvegicus} MKPTITEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGN
1155 >lcl|NP_001101185.2|Plus1complement(11955622..11956971) NW_047627 G protein-coupled receptor 61 Gpr61 __SEG__ Chr2 {Rattus norvegicus} MESSPIPQSSGNSSTLGRALQTPGPSTASGVPELGLRDVASESVALFFMLLLDLTAVAGNAAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHALF
1157 >lcl|NP_001101396.1|Plus1complement(26790058..26791878) NW_047711 hypothetical protein LOC313156 RGD1310773 __SEG__ Chr5 {Rattus norvegicus} MLHTAIPCWQPFLGLAMVLLFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSINPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
1159 >lcl|NP_001101519.1|Plus1complement(20476004..20477131) NW_047762 G protein-coupled receptor 68 Gpr68 __SEG__ Chr6 {Rattus norvegicus} MRSKAPSGPKMGNITTENSSLPCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTIADLFYICSLPFWLQYVLQHDNWSHGDLSCQVCGIL
1161 >lcl|NP_001102210.1|Plus121366405..21367385 NW_047773 cytoskeleton-associated protein 4 Ckap4 __SEG__ Chr7 {Rattus norvegicus} MKVASLEESKGDRSQDVKVLKEAVKEVQASMKSRERDIEALKSSLQTMESDVYTEVRELVSLKQEQQAFKQAADSERLALQALTEKLLQSEESSSRLPEDIRRLEEELQQ
1162 >lcl|NP_001102382.1|Plus1complement(2141328..2142287) NW_047557 free fatty acid receptor 3 Ffar3 __SEG__ Chr1 {Rattus norvegicus} MDTSFFPGNHWLFFSVDLLVFLVGLPLNVMALVVFVNKLRRRPVAVDLLLLNLTISDLLLLLFLPFRIVEAACGMKWILPFIFCPLSGFLFFTTIYLTSLFLMTVSIERF
1163 >lcl|NP_001102532.1|Plus1complement(3737307..3738308) NW_047369 G protein-coupled receptor 146 Gpr146 __SEG__ Chr12 {Rattus norvegicus} MWSCGPLNSTAWAEEPLCRNLRLGLWVLSLFYLGAGVPVGLGYNALLVLANLASKNSMTMPDVYFVNMAVAGLVLTALAPAYLLGPAHSRWALWSLSSEAHVTLLILFNV
1167 >lcl|NP_001102630.1|Plus1complement(18295351..18297375) NW_047563 fibronectin leucine rich transmembrane protein 1 Flrt1 __SEG__ Chr1 {Rattus norvegicus} MVVAHPAATATTTPAATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPSDIPDDATTLYLQNNQINNAGIPQDLKTKVKVQV
1168 >lcl|NP_001102632.1|Plus119996974..19998527 NW_047563 zinc finger and BTB domain containing 3 Zbtb3 __SEG__ Chr1 {Rattus norvegicus} MEFPEHSQQLLQSLREQRSQGFLCDCTVMVGSIQFLAHRAVLASCSPFFQLFYKERELDKRDLVCIHNEIVTAPAFGLLLDFMYAGQLALRGDTPLEDVLAAASYLHMND
1169 >lcl|NP_001102643.1|Plus1complement(3097672..3098955) NW_047615 G protein-coupled receptor 150 Gpr150 __SEG__ Chr2 {Rattus norvegicus} MEDPFSPSTLSPVSNLSLPIRQSWGLNLTSKQGTSVPGPQPPPRWPPSHRIHLVFLGIILAASVAGNTTVLCRLCGSSSRPWLGPKRRKMDFLLVQLAAADLYASGGTAL
1172 >lcl|NP_001102784.1|Plus1complement(7166441..7168453) NW_048032 zinc finger and BTB domain containing 33 Zbtb33 __SEG__ ChrX {Rattus norvegicus} MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRADLLDELIKSGQLLGV
1174 >lcl|NP_001102801.1|Plus17860661..7860939 NW_047626 dolichyl-phosphate mannosyltransferase polypeptide 3 Dpm3 __SEG__ Chr2 {Rattus norvegicus} MTKLTQWLWGLALLGSAWAALTMGALGLELPLPCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQILEARADLARKGLRF*
1175 >lcl|NP_001102825.1|Plus1complement(28850804..28851838) NW_047696 immunoglobulin (CD79A) binding protein 1b Igbp1b __SEG__ Chr4 {Rattus norvegicus} MAAFMDEQQKPKLRELLETGIELLEEVEATTQPTGSKQIQEKVRKALKLLEKASEMLSQLDLFSRNEDWEEIASADLKYLMLPALKGALTLKLVGTSNRLHLLQDARELF
1176 >lcl|NP_001102844.1|Plus14947570..4949141 NW_047694 leucine rich repeat transmembrane neuronal 1 LRRTM1 __SEG__ Chr4 {Rattus norvegicus} MDFLLLGLCLHWLLRRPSGVVLCLLGACFQMLPAAPSGCPGQCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQ
1182 >lcl|NP_001102979.1|Plus1complement(1427969..1429159) NW_047785 G protein-coupled receptor 84 Gpr84 __SEG__ Chr7 {Rattus norvegicus} MWNSSDDNFSCYHESVLGYRYFAVIWGMVVAATGTVGNVLTLLALAIRPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGAIFCRIFGLLLFTSNSVSILT
1183 >lcl|NP_001102980.1|Plus1complement(34847324..34848304) NW_047625 G protein-coupled receptor 171 Gpr171 __SEG__ Chr2 {Rattus norvegicus} MTNSSMFCPIYRDLEPFTYFFYLVYLIGIIGSCFATWAFIQKSTNHRCVSIYLINLLTADFLLTLALPVKIVVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSI
1184 >lcl|NP_001102994.1|Plus1complement(8710457..8712322) NW_047399 choroideremia-like (Rab escort protein 2) Chml __SEG__ Chr13 {Rattus norvegicus} MADKLPTEFDVVIIGTGLPESILAAACSRSGQRVLHVDSRSYYGGNWASFSFTGLLSWLKDYQQNHDSEGDVTGTWQDLIDETEEAIALCKKDETIQHTEVFCYASQDVE
1187 >lcl|NP_001103079.1|Plus110387301..10389070 NW_047773 leucine rich repeat and Ig domain containing 3 Lingo3 __SEG__ Chr7 {Rattus norvegicus} MTCWLHMLGLHLLLLPTAPLATGCPARCECSASTRTVACGRRRLTAVPEGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIAHVEPGAFANLPRLRVLRLRG
1188 >lcl|NP_001103124.1|Plus144343356..44345509 NW_047334 glycoprotein Ib (platelet), alpha polypeptide Gp1ba __SEG__ Chr10 {Rattus norvegicus} MALLILLFLLPSPLHSQPTCDVSKVTSLLEVNCEDKKLKKLPTDLPADTGILHLSKNQLGTFSTSYLVHFTHLTHLYLSRCELTSLQAHEKLLKLETLDLSHNHLQSLPS
1189 >lcl|NP_001103525.1|Plus1complement(19768309..19769037) NW_047657 hypothetical protein LOC499839 RGD1564664 __SEG__ Chr3 {Rattus norvegicus} MAFAVIRACSRVGRGGLYKRLGGLPRGTRRQRQRRQGASLSTTEQRSLAPRPPTGPPARYPSPAVPARASEARRHPAADLDPPPGEPQAVASRGTPEPRPPPESPGAQPP
1195 >lcl|NP_001119763.1|Plus1complement(19100521..19102470) NW_047658 fibronectin leucine rich transmembrane protein 3 precursor Flrt3 __SEG__ Chr3 {Rattus norvegicus} MISPAWSLFLIGTKIGLFFQVAPLSVMAKSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELH
1196 >lcl|NP_001119774.1|Plus133005324..33006586 NW_047762 zinc finger and BTB domain-containing protein 42 LOC691556 __SEG__ Chr6 {Rattus norvegicus} MEFPEHGVRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDQPASSRDTVRLNGDIVTVPAFSRLLDFMYEGRLDLHSLPVEDVLAAASYLHMYDI
1197 >lcl|NP_001120775.1|Plus1complement(19316217..19317824) NW_047562 inositol 1,4,5-triphosphate receptor interacting protein-like 2 Itpripl2 __SEG__ Chr1 {Rattus norvegicus} MSVRYTLNLRVFWPLVTGLCTALVCLYHALRSSEGARAEPPDGADSGFPLLKVAILLLLCYILLRCRHTIRQRLLPGSSRPCGHANFSARSLQEPGLSILLESYYEHEVR
1200 >lcl|NP_001128463.1|Plus1complement(648023..649402) NW_047597 zinc finger and BTB domain containing 12 Ng35 __SEG__ Chr20 {Rattus norvegicus} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
1201 >lcl|NP_001137222.1|Plus13342278..3342622 NW_047651 Notch-regulated ankyrin repeat protein Nrarp __SEG__ Chr3 {Rattus norvegicus} MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYA
1206 >lcl|NP_001162611.1|Plus1complement(2858278..2859309) NW_047555 formyl peptide receptor, related sequence 3 Fpr-rs3 __SEG__ Chr1 {Rattus norvegicus} MEANSSIPLNGSEVVFYDSTTSTVLWILSVVVLSITFVLGVLGNGLVIWVAGFRMAHTVTTICYLNLALGDFSFMATLPIHIISMVMKGKWLFGWFLCKFVHSIVHINLF
1207 >lcl|NP_001163899.1|Plus1complement(3651513..3653378) NW_047400 hypothetical protein LOC289334 LOC289334 __SEG__ Chr13 {Rattus norvegicus} MAGFHLFSPKPYGELGEPLAAGEQEFADQLGWHELSRNSWAQTAGAEIETEVPWVHPKCSPAGRSRRRGYIASPRESHSLTHVARRPSDRARKHRSGNLRLEEACGMGEA
1208 >lcl|NP_036624.2|Plus1complement(4209070..4210326) NW_047514 adrenergic, beta-2-, receptor, surface Adrb2 __SEG__ Chr18 {Rattus norvegicus} MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWT
1215 >lcl|NP_036932.1|Plus136818138..36819259 NW_047625 purinergic receptor P2Y, G-protein coupled, 1 P2ry1 __SEG__ Chr2 {Rattus norvegicus} MTEVPWSAVPNGTDAAFLAGLGSLWGNSTIASTAAVSSSFRCALIKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFY
1218 >lcl|NP_037014.2|Plus1complement(1564858..1565946) NW_047334 somatostatin receptor type 5 Sstr5 __SEG__ Chr10 {Rattus norvegicus} MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIYVVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVSYWPFGSFLCR
1219 >lcl|NP_037082.2|Plus1complement(395369..396580) NW_047617 proteinase-activated receptor 1 precursor F2r __SEG__ Chr2 {Rattus norvegicus} ESERMYATPYATPNPRSFFLRNPSEDTFEQFPLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTSPWLTLFIPSVYTFVFIVSLPLNILAIAVFVFRMK