SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor T    

ID / Description / Sequence
1 >lcl|NP_001000001.1|Plus121564139..21565074 NW_047334 olfactory receptor Olr1387 Olr1387 __SEG__ Chr10 {Rattus norvegicus} MGSFNASLDKGFILVGFSDWPELELIFFIYILIFYSVTLFGNTAIIALSRMDLRLHTPMYFFLSHLSFLDLSCTTSTVPQLLINLHGLDRTISYGGCVAQLFISLALGST
ESVLLVVMAFDRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEMPVFLKLACEDTEGTEAKMFVARVVIVAVPAMLILGSYAQI
ARAVLRVKSVAARRKAAGTCGSHLLVVSLFYGSATYTYLQPKDSYSESKGKFVALFYTIITPMLNPLIYTLRNKDVKGALWKVLGRAAAMG*
2 >lcl|NP_001000002.1|Plus121764511..21765446 NW_047334 olfactory receptor Olr1398 Olr1398 __SEG__ Chr10 {Rattus norvegicus} MGSFNTTLEGGFILMGFSDWPQLEYVLFVFISVFYFLTIFGNSTIITVSQMDRRLQTPMYFFLNNLSFLDLCYTTSIVPQLLVNISGIDKTMSYAGCMAQLFIAFLLGGT
ECVLLVVMAFDRYVAVCRPLHYTSIMHPLLCHTLAISSWVGGLVNSLTQTSLIMTIPLCGHHLNHFFCEMLVLLKLACEDTGGTEANLFVAGAIILVCPVALILGTYAHI
AHAVLKIKSRAGRRKALGTCGSHLTVVSLFYGSAMYTYLQPVHMYSGSEGKFAALFYTIVTPMLNPLIYTLRNKDVKGALCKVLGRDTNTR*
3 >lcl|NP_001000003.1|Plus121821784..21822719 NW_047334 olfactory receptor Olr1401 Olr1401 __SEG__ Chr10 {Rattus norvegicus} MEYLNTSSEKGFILVGFSDWPHLEPIFFALISIFYSLTLFGNTVIIILSRLDLRLHTPMYYFLCHLSFLDLCYTTSTVPQLLVNLSGLDRTISFGRCVAQLCIVLSLGGT
ECVLLVTMAIDRYAAVCRPLHYTTIMHPVLCRALVVFSWVGGLVNSLIQTSLVMAMPLCGHQLNHFFCELPVLLKMACEDTGGTEANLFVARVIILVCPLVLILGSYAHI
ARAVLNIKSMAGRRKAFGTCASHLIVVAMFYGSAVSTYLQPVHRYSEKEGKFLALFYTIITPMLNPLIYTLRNKDVKGALWKVLGRGTDSA*
4 >lcl|NP_001000004.1|Plus123432484..23433425 NW_047334 olfactory receptor Olr1409 Olr1409 __SEG__ Chr10 {Rattus norvegicus} MSKWGENETRASGFLLLGITNDPQQQQILFWAFLCMYLVTVAGNTLIFLAISSDPRLHTPMYFFLANLSFVDVCFTTNLIPRLLASHVSGTEIISYAHCLTQMYFLISFA
NVDTFLLAAMALDRFVAICYPLQYHTIITPQLCVGLAAVVWICSGLISLVHTLLMNRLTFCSSIPEISHFYCDAYLLMKLACSDTRINQLVFLGAVVLFVAPCILIVFSY
VRIAMAVFQIPSAKGRHKAFSTCSSHLTVVILFYGTVLGIYIRPPDSFSTQDTVATIMYTVVTPMLNPFIYSLRNKDMKQTVTRLFNRGSQSS*
5 >lcl|NP_001000005.1|Plus123401124..23402047 NW_047334 olfactory receptor Olr1407 Olr1407 __SEG__ Chr10 {Rattus norvegicus} MDGDNQTTVTEFILLGLTEQSEKEEIVFGMFLWMYLVTISGNLLIILAISCDPHLHTPMYFFLANLSSVDISAPSVIVPKALVNHMLGSKSISYMGCMIQIYFFITFSNM
DGFLLSVMAYDRYVAICHPLHYTMMMRPRLCVLLVAVSWVITNLHALLHTLLMVRLTFCSHNAVHHFFCDPYPIMKLSCSDTFINDLMVFTIGGLVFLTPFTCIIVSYAY
IFSKVLKLKSAHGIRKSLSTCGSHLTVVSLFYGAILGIYMHPSSTYTVQDTVATVIFTVVTPMVNPFIYSLRNRDIKGALRKIILRP*
6 >lcl|NP_001000006.1|Plus1complement(31174195..31175157) NW_047334 olfactory receptor Olr1423 Olr1423 __SEG__ Chr10 {Rattus norvegicus} MDLTSWINNYTGQSDFTLVGFFSQCKYPALLAVVIFVVFLIALSGNALLILLILSDTHLHTPMYFFISQLSLMDIMYISVTVPKMLMDQVLGSHRISAAACGMQMFLYLT
LAGSECLLLAAMSYDRYVAICHPLRYHVLMNYRVCLLLLSLCWLLGFLDGFMFTPVTMTFPFCGSREIHHFFCEVPAVTKLSCSDTWLYETLMYVCCVLMLLIPVTVISG
SYSSIFLTVLRMNSAEGRKKALATCSSHMTVVILFYGAAVYTYMLPNSFHTPEKNMVVSVFYTILTPLLNPLIYSFRNKNVTEAMRKWLGVSTLFQEIVK*
7 >lcl|NP_001000007.1|Plus1complement(31146645..31147589) NW_047334 olfactory receptor Olr1422 Olr1422 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQSGFALVGFLSQSKHPALLAGVIFVVFLMALSGNALLILLILSDTHLHTPMYLFISQLSLMDMMYISVTVPNMLMDQVLGNHRISAAACGMQMFLYLTLAGSEF
LLLAAMSYDRYVAICHPLRYHVLMNHRVCLLLISSCWLLGSLDGFMFTPVTMTFPFCGSREIYHFFCEVLAVTKLSCTDTWLYETFMYVCCVLMLLIPVTVISGSYSSIL
LTVLRMNSAEGRKKALATCSSHMTVVILFYGTAIYNYMLPASLHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMRKWLGVSSLFQEIVK*
8 >lcl|NP_001000008.1|Plus1complement(31077648..31078592) NW_047334 olfactory receptor Olr1418 Olr1418 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQSGFTLVGFLSQSKHPALLAVVIFMVFLMALSGNALLILLILSDTHLHTPMYFFISQLSLMDMMCISVTVPKMLMNQMLENYRISAAACGMQMFLYLTLAGSEF
LLLAAMSYDRYVAICHPLRYHVLMNHRVCILLVYSCWLLGSLDGFIFTPVTMTFPFCGSREIYHFYCEVLAVTKLSCSDTWLYETLMYVCCVIMLLIPVTVISGSYSSIL
LTVLRMNSTEGRKKALATCSSHMTVVIIFYGTAIYNYMLPASLHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMRKWFGMSTLFQQIVK*
9 >lcl|NP_001000009.1|Plus1complement(30971758..30972687) NW_047334 olfactory receptor Olr1416 Olr1416 __SEG__ Chr10 {Rattus norvegicus} MNNYTEQSGFTLVGFLSQSKDPALLSVVIFVVFLMALSGNILLILLILSDTHLHTPMYFFISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLTLAGSEF
LLLAAMSYDRYVAICHPLRYHVLMNHRVCLLLISSCWLLGSLDGFMFTPVTMTFPFCGSRKIYHFYCEVLTVTKLSCSDTWLYETFMYVCCVVMLLIPVTVISGSYSSIL
LTVLRMNSTEGRKKALATCSSHMTVVILFYGTAIYNYMLPASLHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMRKWLGLSPLF*
10 >lcl|NP_001000010.1|Plus1complement(31220806..31221753) NW_047334 olfactory receptor Olr1425 Olr1425 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQFSDFTLLGFFSQYKYPTLLAGVIFVVFLMALSGNAFLILLILFDTQLHTPMYFFISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLSLGGSE
FLLLAAMSYDRYVAICHPLRYPVLMNHRVCLLLLSVCWFLGSLDGFMLTPVTMTFPFCGSREIHHFFCEVPAVTKLSCSDTWLYETLMYVCCVLMILIPVTVISGSYSSI
LLTVLRMNSPEGRKKALATCSSHMTVVILFYGAAVYTYMLPTSFHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMKKLLGVSTLFQEIIK*
11 >lcl|NP_001000011.1|Plus131251214..31252161 NW_047334 olfactory receptor Olr1428 Olr1428 __SEG__ Chr10 {Rattus norvegicus} MNNYTGQFSDFTLLGFFSQSKHPTLLAGVIFVVFLMALSGNALLILLILFDTHLHTPMYFFISQLSLMDMMYISVTVPKMLMDQVLGNHRISAAACGMQMFLYLTLAGSE
FFLLASMSYDRYVAICHPLRYPVLMNYRVCLLLLSVCWLLGSLDGFMFTPFAMTFPFCGSREIHHFFCEVPAVTKLSCSDTWLYETFMYVCCVLMLLIPVTVISGSYSSI
LLTVLRMNSAEGRKKALATCSSHMTVVILFYGAAIYTYMLPASLHTSEKDMVVSVFYTILTPLLNPLIYSLRNKNVTEAMKKFLGMKPLLRETLK*
12 >lcl|NP_001000012.1|Plus1complement(31312705..31313676) NW_047334 olfactory receptor Olr1432 Olr1432 __SEG__ Chr10 {Rattus norvegicus} MEPQNLSKVTEFQLLGFRNLLEWQSLLFAIFLCFYLLTITGNMVIIAVVSEDPRLRAPMYTFLQHLSFLEIWYTSTTVPLLLSNLATWGHMLSFPACMTQLYFFVFFGAT
ECFLLAAMAYDRYLAICHPLHYSLLMSPDNCAALVTVSWVTGVGTGFLPSLLISKLDFCGPNRINHFFCDLPPLIQLSCSSVFVTEMAIFVLSIAVLCICFLLTLVSYIF
IVSSILRIPSTTGRMKTFSTCGSHLAVVTIYYGTMISMYVRPNAHLSPELNKVISVFYTVITPLLNPVIYSLRNKDFKEAVRKLVRTKCGVYRARGKGSVSIK*
13 >lcl|NP_001000013.1|Plus131402123..31403043 NW_047334 olfactory receptor Olr1434 Olr1434 __SEG__ Chr10 {Rattus norvegicus} METGNHSCGTDFTLVGLFQYGHMDTFLFTVITLLFAVALIGNITLVHLIRLDQTLHTPMYFLLSQLSVIDMMYISTAVPKMAANFLSDTKTISFLGCLIQVFVFLTLACC
EALLLGFMSFDRYIAIFQPLHYPVFMSRKICCSMVASAWSSSSINALVHTVYVFQLPFCGSRIVNHFFCEIPSLLPLVYEDTSQYEHLIVMSVLVLVLIPFLAILASYAR
VLVVVYQMGSEKGQSRAVSTCSSHLTVASLFYVTGLCTYTQPHSLHSPGRDKVVALLYSIITPVLNPFIYSLRNKEVMGALRRHMG*
14 >lcl|NP_001000014.1|Plus1complement(31441629..31442549) NW_047334 olfactory receptor Olr1436 Olr1436 __SEG__ Chr10 {Rattus norvegicus} MEKGNHSCGTDFTLVGLFQYGHTDTFLFTVIILLFAVALIGNITLVHLIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCVIQAFVFLTLGAS
EALLLGFMSYDRYIAICQPLHYPVLMSRKICCSMVAGAWSSSSINALVHTVYVFQLPFCGSRIVNHFFCEVPSLLPLVCEDTSQYEHTILLSGLVILLLPFLAILASYAR
VLVVVFRMGSGKGQSRAVSTCSSHLTVASLFYVTTLSTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKEVMGALRRHMG*
15 >lcl|NP_001000015.1|Plus131475153..31476073 NW_047334 olfactory receptor Olr1437 Olr1437 __SEG__ Chr10 {Rattus norvegicus} METGNHSCGTDFTLFGLFQYGHMDTFLFTVIALLFAVALIGNITLVHLIRLDRTLHTPMYFLLSQVSIIDMMYISTTVPKMAINFLSNTKTISFLGCLIQVFTFLTLAGC
EALLLGFMSYDRYIAICQPLRYSVLMSRKICCSMVAGAWSSSSINALVHTVYVFQLPFCGSRIVNHFFCDIPSLLSLVCEDTSQYEHLIVMSVLVLVLIPFLAILASYAR
VLVVVFQIGSGKGQSRAVSTCSSHLTVASLFYVTTFSTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKDVMGALRRQMG*
16 >lcl|NP_001000016.1|Plus131527475..31528395 NW_047334 olfactory receptor Olr1439 Olr1439 __SEG__ Chr10 {Rattus norvegicus} METGNHSCGTDFTLVGLFQYGHMDTFLFTVIALLFAAALIGNITLVHLIRLDRTLHTPMYFLLSQVSIIDMMYISTTVSKMAVNFLSDTKTISFLGCLIQVFMFLTLAGC
EALLLGFMSYDRYIAICQPLRYSVLMSRKICCSMVAGAWSSSSINALVHTVYVFQLPFCGSRIINHFFCEIPSLLPLVCEDTSQYEHMIVMSVLVLVLIPFLAILASYAR
VLVVVIQMGSGKGQSRAVSTCSSHLTVASLFYVTGLYTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKDVIGALRRQMG*
17 >lcl|NP_001000017.1|Plus1complement(31540378..31541298) NW_047334 olfactory receptor Olr1440 Olr1440 __SEG__ Chr10 {Rattus norvegicus} METGNCSCGTDFTLVGLFQYGHMDTFLFTVIALLFAVALIGNITLVHLIRMDRTLHTPMYFLLSQLSIIDMIYISTTVPKMAANFLSDTKTISFLGCAIQTFVFVTLGGS
EALLLGFMSYDRYIAICQPLHYPVLMSRKICCSLVAGTWSSSSINALVHTVYVFQLPFCGSRIVNHFFCEIPSLLPLVCEDTSQYEHTVLLSGLVILLLPFLAILASYAR
VLVVVFRMASGKGQSRAVSTCSSHLTVASLFYATTLSTYTQPHSMHSPGRDKVVAVLYSIITPVLNPFIYSLRNKDVMGALRRHMG*
18 >lcl|NP_001000018.1|Plus131619052..31619972 NW_047334 olfactory receptor Olr1443 Olr1443 __SEG__ Chr10 {Rattus norvegicus} MEIGNHSCGTDFTLVGLFQYGHMDTFLFTVITLLFAVALIGNITLVHLISLDRILHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCAIQAFMFLTLGGS
EALMLGFMSYDRYIAICQPLHYPVLMSRKICCSIITSAWSSSSITALIHILYVFQLPFCGSRIVNHFFCEVPSLLPLVCEDTSQYEHAVLLSGLVILLLPFLAILASYAR
VLVVVFQMGSGKGQSRAVSSCSSHLTVASLFYITTLSTYTQPHTLHSPGRDKVVAVVYSIVTPVLNPFIYSLRNKEVMGVLKRQMG*
19 >lcl|NP_001000019.1|Plus131685428..31686348 NW_047334 olfactory receptor Olr1448 Olr1448 __SEG__ Chr10 {Rattus norvegicus} MGTGNHSCGTDFTLVGLFKYGHLDTILFTVIALLFAVALIGNITLVHLIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCAIQTFVFLTLGGS
EALLLGFMSYDRYIAICQPLHYPLLMSRNICCSMVAGAWSSSSINAFVHTVYVFQLPFCGSRIVNHFFCEVPSLLPLVCEDTSQYEHTVLLSGLVILLLPFLAILVSYAR
VLVVVFQMGSGKGQSRAVSTCSSHLTVASLFYVTGLCTYTQPHSLHSPGRDKVVAVLYSIVTPVLNPFIYSLRNKEVMGALRRQVG*
20 >lcl|NP_001000020.1|Plus131806876..31807868 NW_047334 olfactory receptor Olr1454 Olr1454 __SEG__ Chr10 {Rattus norvegicus} MDKGNATTGFILLGLFDHTRAHLFLFVLVLTVAFNSVVGNALLLLLIHQDRRLHTPMYFLLSQLSLMDMMLVSTIVPQMAAGYLTGKNSISAAGCGFQIFFFLTLGGGEC
FLLAAMSYDRYVAVCHPLRYPVLISWQLCLRLTLGSWLLGAADGAMQAAATMSFQFCSRHEIDHFFCEAPVLLHLACGNTSAFEFVMYICCVLMLLIPFSLILASYGLIL
TAVLRMRSTEARKKTFATCCSHLTVVGLFYGAAAFSYMRPASARSANHDKVVSAFYTIVTPMLNPLIYSLRNSEVKGSLRKCLARCSALRSKDTLVGLDLAGATKEKGIQ
*
21 >lcl|NP_001000021.1|Plus131883653..31884579 NW_047334 olfactory receptor Olr1458 Olr1458 __SEG__ Chr10 {Rattus norvegicus} MSNHTTVTHFILRGFSDVPQLRLVVIPFFLLVYTFGLLGNLSVIMAVRRDSRLHSPMYFFLKNLSFLDMCYTSATIPKAVAISFTGSGVVSYLECVAQLYIIFTFACTEC
FLLTAMAYDRCLAILRPLLYGTIMSQKYCYALVVTAWVSGAIYSAFHTFNTFSLPYCGPNLVEHFFCDMPPVMRLSCTDYHVTEEVGFAVSSCVVMSSFALTVVSYIGIV
ATVLRIPSVDGRWKAFSTCSSHLTTVILFYGTGSFVYLRPASQYSPLLGRLASIFYSVVTPSLNPVVYCLKNKDMKFALQKLYCGRKY*
22 >lcl|NP_001000022.1|Plus131931578..31932504 NW_047334 olfactory receptor Olr1461 Olr1461 __SEG__ Chr10 {Rattus norvegicus} MSNHTTVTHFILRGFSDVPQLRLVVIPFFLITYTFGLLGNFSIIMAVRRDSRLHSPMYFFLKNLSFLDMCYTSATIPKAVAISFTGSGVISYLECVAQLYMFITLCGTEC
FLLTTMAYDRCLAILRPLLYGTIMSQKYCYALVVTAWVSGAIYSAYHTFNTFSLPYCGPNIVEHFFCDMPAIMRLSCTDYHVTEEVSFAVISCIIMSSFALTVVSYIGIV
ATVLRIPSVDGRWKAFSTCSSHLTTVILFYGTGSFVYLRPASHYSPLLGRLASIFYSVVTPSLNPVIYCLRNKDMKFALLKLYCGRKY*
23 >lcl|NP_001000023.1|Plus1complement(32720076..32721035) NW_047334 olfactory receptor Olr1463 Olr1463 __SEG__ Chr10 {Rattus norvegicus} MQVAVKRQNVSFPHTFVLVGFSDHPWLEMPLFGVLLVSYIFTMIGNSSIIILSLLEPRLQTPMYFFLDNLSMLDLCATCTIVPQLLVNLWGPEKTIASWSCITQSYLFHW
TSCTECALLAVMALDRYVAICCPLRYVLIMHLWACVWLAAVCWASGLANSLVQATLTLYLTLCAKNTLDHFFCEVPALIKLACSDTTMNDLSLALGAIPFGIVSPLTVLI
SYIFIARAVLKLPSAEGRRKALSTCSSHLLVVTMFFGPGMYTYLQPPGNSTQSKLLSFFYCVCTPLLNPLIYTLRNKDVKEAWKKVLGSQGKGTSLKGR*
24 >lcl|NP_001000045.1|Plus15233342..5234268 NW_047355 olfactory receptor Olr1564 Olr1564 __SEG__ Chr11 {Rattus norvegicus} MTEDNYSLTTEFILVGFSDHPDLKTLLFLVFSTIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLCVQMTTGAYIAGNLHSIIHIGFLFRLTFCRSNVIKHFFCDVIPLYRLSCADPYINELMILIFSGSVQTFSIIIVLISYFC
ILYTIFTMKSTEGRSKALSTCASHFLSVSIFYGSLLYTYIRPNSLNEGEEDIPVAIFYTLVIPLLNPFIYSLRNKEVINVIKKTVKKG*
25 >lcl|NP_001000046.1|Plus15201003..5201932 NW_047355 olfactory receptor Olr1563 Olr1563 __SEG__ Chr11 {Rattus norvegicus} MAEDNYSLTTEFILVGFSDHPDLKTLLFLVFSAIYLVTTVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVNRRISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLCVQMTTGAYIAGNIHSMIHIGFLFRLTVCRSHTIKHFFCDVLPLYRLSCADPYINELMILIFSGSVQTFTITIVLISYFC
ILYTIFTMKSKEGRSKALSTCASHFLSVSIFYGSLLYMYIRPSSVNEAYKDIPVAICYTLIIPLLNPFIYSLRNKEVINVMKRTIERQL*
26 >lcl|NP_001000047.1|Plus15143059..5143988 NW_047355 olfactory receptor Olr1562 Olr1562 __SEG__ Chr11 {Rattus norvegicus} MTEDNYSLTTEFILVGFSDHPGVKTLLFLVFSAIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLCECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLCVQMTTGAYIAGNIHSIIHIGFLFRLTFCRSHIIKHFFCDVLPLYRLSCVDPYINELMILIFSGSVQTFTITIVLISYFY
ILFTIFTMKSKEGRSKALSTCASHFLSVSIFYGSLLYMYIRPSSVNEAYKDIPVAIFYTLVIPLVNPFIYSLRNKEVINVLKRTMKRQL*
27 >lcl|NP_001000048.1|Plus15118080..5119009 NW_047355 olfactory receptor Olr1561 Olr1561 __SEG__ Chr11 {Rattus norvegicus} MTEDNYSLTKEFILVGFSDHPDLKTLLFLVFSAIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMAQFYFLCLAETT
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLCVQMTTGAYIAGNIHSIIHTGFLFRLTFCKSHVIRHFFCDILPLYRLSCVDPYINELMVLILSGSVQTFSIVIVLISYFC
ILYTIFTMKSTEGRSKALSTCASHFLSVSIFYGSLLYTYIRPSSVNEGDEDIPVAIFYTLVIPLLNPFIYSLRNKEVINVFKRTMKRQL*
28 >lcl|NP_001000049.1|Plus15072426..5073379 NW_047355 olfactory receptor Olr1559 Olr1559 __SEG__ Chr11 {Rattus norvegicus} MEKTNHSLTTEFILVGFSDHPDLKILLFLVFSVIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLSLQMSIGIFIASNLHSLIQVGCLLRLTFCKSNRIDHFFCDILPLYRLSCTDPFINELMIYIFSMPIQVFTITTILVSYFC
ILFTIFKMKSKDGRGKAFSTCASHFFSVSIFYTCLLMYIRPFEEGNKDIPVAVFYTVIIPLLNPFIYSLRNAEVVNAAKKVMKTYNIFKNASASIAH*
29 >lcl|NP_001000050.1|Plus1complement(4984936..4985865) NW_047355 olfactory receptor Olr1557 Olr1557 __SEG__ Chr11 {Rattus norvegicus} MEKKNETLWSEFILTGLTCQPQWKTPLFLMFLVIYLMTIVGNLGLITLIWNDPHLHIPMYLFLSNLAFVDTWLSSTVTPKMLFNLLDKGKVISIAECKTQFFSFAISVTT
ECFLLAAMAYDRYAAICNPLLYPVVMTNRLCIRLLALSFLGGFLHAVIHESFFSRLTFCNSNILYHIYCDAIPLLKISCTDPSLNYLMIFIFSGSIQVFTIMTILTSYTF
ILFTILKKKSDKGVRKAFSTCGAHFLSVSLYYGPLLFMYVHPASSEVDPQDMILSLFYTVIVPVLNPMIYSLRNKQVIDSLKKMLKITI*
30 >lcl|NP_001000051.1|Plus1complement(4927397..4928326) NW_047355 olfactory receptor Olr1553 Olr1553 __SEG__ Chr11 {Rattus norvegicus} MEKKNETLWSEFILTGLTCQPQWKTPLFLVFLVIYLMTIVGNLGLITLIWNDPRLHIPMYLFLSNLAFVDTWLSSTVTPKMLFNLLDKGKVISVAECMTQFFSFAISVTT
ECFLLAAMAYDRYAAICNPLLYPVVMTNRLCIRLLALSFVGGFLHAVIHESFLSRLTFCNSNILYHFYCDVIPLLKISCTDPSLNYLIIFIFSGSIQVFTIMTVLTSYTF
VLFTILKKKSDKGIRKAFSTCGAHLLSVSLYYGPLLFMYVHPASSEVDDQDMILSLFYTVIIPVLNPIIYSLRNKQVIDSAKKMLKISV*
31 >lcl|NP_001000052.1|Plus14854193..4855116 NW_047355 olfactory receptor Olr1549 Olr1549 __SEG__ Chr11 {Rattus norvegicus} MKNSTVWTEFVLTGLTESPELQGPLFLLFLVIYLITIVGNLGLIALIWSDSHLHIPMYFFLGHLAFVDACLSSTVTPKMLLNFLQMSKVISFSDCMTQFFFFAVFLTTEC
FLLAAMAYDRYVAICKPLLYPMIMTNRLCICLLVLCFVGGFLHASIHEGFLFLLTFCNSNIVHHFYCDIMPLLKISCTDSTLNFQLVFVFAGIVQIFTIVIVLVSYTLVL
FTILQRKSLQGIRKAFSTCGAHLLSVSLYYGPLLFMYVFPLSQEADDQDIIDSVLYAVIIPVLNPIIYSLRNKQVMDSLKKILQKKV*
32 >lcl|NP_001000055.1|Plus1complement(2511261..2512199) NW_047773 olfactory receptor Olr880 Olr880 __SEG__ Chr7 {Rattus norvegicus} MRNHTAITTFILLGLTDDPKLQVLIFLFLFLTYMLSVTGNLTIITLTLLGPHLKTPMYFFLRNFSFLEVSFTTVCIPRFLYMMATGDNTVTYNACAAQLFFIVLFGATEF
FLLAAMSYDRYVAICKPLHYTTIMNNRVCTVLVLSCWFAGLLIILPPLGLGLQLEFCDSNVIDHFGCDASPILQITCSDTVFIEKIVLAFAILTLIITLVCVVLSYTYII
KTILKFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEGVAINKVVSVLTTSVAPLLNPFIYTLRNKQVKEAFKDTVKRIVLLTKK*
33 >lcl|NP_001000056.1|Plus1complement(2562962..2563897) NW_047773 olfactory receptor Olr881 Olr881 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTTFILLGLTENPQIQSLLLIFLLFTYLLNITGNLTIILLTLMDPHLKTPMYFFLQNYSFLEILFTSTCIPRYLYNLATGDKIITYRACASQAFFTDLFGVTEFF
LLATMSYDRYVAICKPLHYTTIMNTACRRLLLCCWIAGVIIILPPFSLSQNLKFCDSNIIDSFLCDVSPFLKISCSDTWVIEQMVIGCAVLTFITTLFCVVLSYAYIIKT
ILRFPSSQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKDSVAINKGVIVLTTSIAPMLNPFIYTLRNKQVKQAFNDSIKKIALECRNG*
34 >lcl|NP_001000057.1|Plus13457136..3458080 NW_047773 olfactory receptor Olr901 Olr901 __SEG__ Chr7 {Rattus norvegicus} MKNQSMEFHFILLGLTDDPRLQIVVFLFLFLNYMMSLVGNLVIVFLTLLDPRLKTPMYFFLRNFSILEIMFTTVCIPRFLTTIVTGDKTISYNNCASQVFFILLLGVTEF
YLLAAMSYDRYVAICRPLHYPIIMNSRVCYQLVLSSWVTGFLVIFPPLAMGLELNFCDSWIIDHFMCETSPILQISCTDSHVLEMMSFVLAVVTLVVTLVLVSLSYSFII
KTIMNFPSAQQRTKAFSTCTSHMIVVSMSYGSCIFMYIKPSARERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFWDILQKTLSFSKHKV*
35 >lcl|NP_001000058.1|Plus1complement(3380484..3381443) NW_047773 olfactory receptor Olr898 Olr898 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFLFFNYILSMMGNLVIIFLTLMDPHLKTPMYFFLRNFSFLEIAFTTACIPRFLMSILTGDRTISYNSCAAQLFFFFLSLITEF
YLLAAMSYDRYVAICRPLHYPIIMNSKVCHLLVLSSWVTGFLVIFPPLLLGLKLDFCASKTIDHFLCDTSPVLQLSCTDTHFIELMAFALAVMTLIITLILVILSYTLII
ITILKFPSAQQRRKAFSTCSSHMVVVSITYGSCMFMYMKTSAKERVALNKGVAVLNTSVAPLLNPFIYTLRNQQVKDAFKQVLHRLCYSQNSELRFRLK*
36 >lcl|NP_001000059.1|Plus1complement(3322666..3323616) NW_047773 olfactory receptor Olr896 Olr896 __SEG__ Chr7 {Rattus norvegicus} MRNHTKTKEFILLGLSDDPKLQVLIFVFIFITYILSITGNLTIIILTLLDSQLQTPMYFFLRNFSILEASFTTVCIPRFLATIISEDKTISFNNCIAQLFFLILFGITEF
YLLAAMSYDRYIAICKPLHYLTIMSQKVCTMLVFACWLVSFLIIFPALMLLLQLDYCGSNIIDHYTCDYFPLLQLSCSNTKFLERIGFSCAVFTLMFTLVLIILSYICII
RTIVKIPSASQRSKAFSTCSSHMIVISISYGSCIFMYIKPSAADRASLTKGVAILNTSVAPMLNPFIYSLRNQQVKKAFLNIARKMVFFTSTSCGL*
37 >lcl|NP_001000060.1|Plus1complement(3231280..3232218) NW_047773 olfactory receptor Olr892 Olr892 __SEG__ Chr7 {Rattus norvegicus} MRNQSTITTFILLGLTDDPQLQVLLFIFLFLTYILSVTGNLVIIILTLVDPHLKTPMYFFLRNFSFLEVSFTTVCIPRFLYSISSGDNTITYNACASQIFFVILFGATEF
FLLAAMSYDRYVAICKPLHYMAIMNPRVCILLVITCWVSGLMIIIPPLGMGLQLDFCDSNAIDHFSCDAGPLLKISCSDTWVIEQMVILVAVFALIITLICVILSYTYII
RTILRFPSVQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFSDSVKRISLISKS*
38 >lcl|NP_001000061.1|Plus1complement(3160728..3161690) NW_047773 olfactory receptor Olr889 Olr889 __SEG__ Chr7 {Rattus norvegicus} MRNHTIITTFILLGFTDDPGLQVLFFVMLFLTYILSIMGNLTIVILTLMDSHLNTPMYFFLRNFSFLEISFTTVCIPRFLYSISTGVNTITYNACASQIFFVGLFGATEF
FLLSAMSYDRYVAICKPLHYMTIMDNKVCAILVLCCWASGLLIIIIPLGMVLQLEFCDSNTIDHFFCDVSPLFKISCTDTWFLEQTVIACAVLTFVITLIAVILSYVYII
RTILRYPSAHQRKKAFSTCSSHMIVVSIMYGSCIFIYVTPSAKEQVDINKGVSMLNTSVAPLLNPFIYTLRNKQVKQALNDTVKKMQISYTNKKMLNLSR*
39 >lcl|NP_001000062.1|Plus1complement(8465001..8465969) NW_047773 olfactory receptor Olr1072 Olr1072 __SEG__ Chr7 {Rattus norvegicus} MGEKERDNHSEVTDFIHHSEVTDFILVGIRVRPELHSVLFLLFLVVYGMVLLGNLSMIGIIVTDPRLNTPMYFFLGNLSVIDLSYSTVIVPKAMVNILSQKKTISFVGCV
AQLFLYALFMVTEAFVLAAMAYDRFIAICNPLLYSVRMSRSICVQLVTGSYLCGWVSSLLQISVTFSMSFCASRVIDHFYCDSNPIEKISCSNTFINKMVSLSLAVLIIL
PTIIVIVVSYMYIVSTVLKIHSSEGRKKAFSTCTSHLGVVSLLYGTVSFVYLTPPNNPELRKIASVCYILFTPMLNPLIYSLRNKDVKDAMKKVLCKKNILL*
40 >lcl|NP_001000063.1|Plus1complement(8424057..8424998) NW_047773 olfactory receptor Olr1071 Olr1071 __SEG__ Chr7 {Rattus norvegicus} MGDREINNHSDMTDFILVGFRVSHELHILLFLLFLLVYTMILLGNLGMMAIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIAPKAMSNFWTESKSISFAGCVAQLFLFALF
IVTEGFLLAAMAYDRFIAICNPLLYSVHMSTRLCTQLVAGSYFCGCISSVLQTSMTFTLSFCASRAVDHFYCDTRPIQRLSCNNLLVHKIVSFSLSSIIILPTIIVIIVS
YMYIVSTVLKIRSTEGRKKAFSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKMASLCYSLVTPMLNPLIYSLRNKDVKEALSKLLEKKKFIL*
41 >lcl|NP_001000064.1|Plus18088226..8089164 NW_047773 olfactory receptor Olr1063 Olr1063 __SEG__ Chr7 {Rattus norvegicus} MANHSSVTKFILLGLTNDANLQAVLFLFLLLTYILSVMGNSAIILLTLLDYRLQTPMYFFLRNFAFLEISFTSVFVPKMLINIGTGDKTISFAGCFTQYFFAILLGATEF
YLLAVMSYDRYVAICRPLHYTTVMNRKLCFQLVLSSWLSGFIVVVVPHAMTLQLPFCASNIINHYCCDYTILLHLSCSDTHFIEVIQFLLATVTLIFTLLLVVLSYTYII
KTILRIPCIQQRKKAFSTCSSHMIVVSLSYGSCIFMYINPSFKDAANFNKRVAVLNTSVAPLLNPFIYTLRNKQVKIAFKDMVRKAISFFKK*
42 >lcl|NP_001000065.1|Plus1complement(8016399..8017361) NW_047773 olfactory receptor Olr1061 Olr1061 __SEG__ Chr7 {Rattus norvegicus} MSNSGLRKNGSLSFCSEFTLVALSSLAELQPVLFLVFLVTYLFTVGGNLTIICVIWVTRSLHTPMYFFLANLSFLEMCYISSVVPQMLVHLLVQIKTISVRGCAVQMYIF
TILGLTECCLLATMAYDRFVAICHPLHYTLRMGPSACLKLAGASWMTGILVESAQTTWIFTLPFCGAGTIQHFFCDIMPVVKLACVDTSQNEIVIFIISLIFIMSPCLFI
LCSYVRIILTILKMPSAAGRHKAFSTCSSHILVVSLFYGTALFTYLQPKSLHTPDTDKATALMYTVVTPALNPVIYTLRNKEVKEAFHKATQRKLHRQKD*
43 >lcl|NP_001000066.1|Plus1complement(7923538..7924476) NW_047773 olfactory receptor Olr1058 Olr1058 __SEG__ Chr7 {Rattus norvegicus} MKNHTEVTVFILAGLTDDPRCKVVLFIFLLLTYLLSITGNLTIITLTLVDTHLKTPMYFFLRNFSFLEFSYTTTCIPKLLLTMATGDKTISYSNCVTQVFFAFLFGASEF
YLLAAMSYDRYVAICKPLHYMTIMNNKVCVQLVLSCWLAGFFVIFPPLVLGLNLDFCASNIVDHFYCDTTPLMQLSCTDTQLLETMGFVSALVTLLLTLFMVIISYTHIA
ITIIKIPSPEQRKKAFSTCSSHMIVISLSYGSCIFMYLKPSVKQRVSISKGISVLNTSVAPLLNPFIYTLRNQQVKKAFLNTIHRIALFLKK*
44 >lcl|NP_001000067.1|Plus1complement(7860576..7861520) NW_047773 olfactory receptor Olr1055 Olr1055 __SEG__ Chr7 {Rattus norvegicus} MKNQSGELEFILVGLTDDPQLQILIFLFLFFNYILSMIGNFMIILLTLLDPHLKTPMYFFLRNFSFIEITFTTVCIPRFLINILSGDRRISYNDCAAQLFFVFLLGTTEF
YLLAAMSYDRYVAICRPLHYPIIMNSKVCYLLVLSSWVTGFFIIFPPMLLGLKLDFCTSGSIDHFLCDPSPVLQLSCTDTRFIELMTFALAVMTLVITLILVILSYTLII
KTILKFPSAQQRKKAFSTCSSHMVVVSITYGSCIFMYVKTSAKERVSLNKGIAVLNTSVAPLLNPFIYTLRNQQVKDAFKHMLHRFCMKQLNKV*
45 >lcl|NP_001000068.1|Plus1complement(7079283..7080206) NW_047773 olfactory receptor Olr1024 Olr1024 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFMFFNYILSLMGNLMIIFLTLLDLRLKTPMYFFLRNFSFLETAFTSSCIPRFLMSILTGDKTISYGACLTQLFFFFLLLITEF
YLLAAMSYDRYVAICRPLHYPLIMNSKVCHLLVLSSWVTGFLSIFPPLMLGLKLNFCASKLIDHFLCDTSPVLQLSCTDTRFIEWMAFVIAVMTLVITLILVILSYTLII
KTILNFPSAQQRRKAFSTCSSHMVVVSITYGSCIFMYMKTSAKERVTLNKGVAVLNTSVAPLLNPFIYTLRNQQVKDAFKQVLRRLC*
46 >lcl|NP_001000069.1|Plus1complement(7012696..7013655) NW_047773 olfactory receptor Olr1020 Olr1020 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFLFLNYILSMMGNLVIILLTLLDPHLKTPMYFFLRNFSFLEIAFTTACIPRFLMSILTGDRTISYNSCAAQFFFFFLLLVTEF
YLLAAMSYDRYVAICRPLYYPIIMNSKVCHLLVLSSWVTGFFVILPPLMLGLKLDFCASKTIDHFLCDTSPLLQLSCTDTRLIELMAFVIAVMTLVITLILVILSYTLIL
KTILNFPSAQQRRKAFSTCSSHMVVVSITYGSCIFMYMKTSAKERVALNKVVSVLNTSVAPLLNPFIYTLRNKQVKDAFKQVLHRLYSSQNSELRFRPK*
47 >lcl|NP_001000071.1|Plus16761553..6762491 NW_047773 olfactory receptor Olr1012 Olr1012 __SEG__ Chr7 {Rattus norvegicus} MKNHTVPTEFILLGLSDDPELQIVIFLFLILMYILSITGNLTIIMLTLVDPHLQTPMYFFLRNFSVLEITFTTVCIPRFLSTIVTRDKTISYNNCTAQLFFFIFLGITEF
YLLTAMSYDRYVAICRPLHYTTIMNRRVCILLVFSAWLTGFLNIFPPVILFLQLDYCGSNVIDHFACDYFPLLQLSCSDTWLLEVIGFYSAIVILLFTLALIILSYMFIV
KTILKLPSVSQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKERASLTKGVAILNTSVAPMMNPFIYTLRNQQVKQAFKDTIQKVVLFSGK*
48 >lcl|NP_001000072.1|Plus1complement(7912859..7913797) NW_047773 olfactory receptor Olr1057 Olr1057 __SEG__ Chr7 {Rattus norvegicus} MKNHTRQIEFILLGLTDNPQLQIVIFVFLLLNYFLSMIGNLTIIALTLLDPLLKTPMYFFLRNFSFLEILFTTTCIPRFLITTVTQEKTISYNGCICQLFFYIFLGGTEF
FLLATMSYDRYIAICKPLHYASIMSSKVCHQLVLGSWVTGFLVIFPPLIIGLDLDFCASDVIDHFLCDVSPVLQLSCSDTNLLEVTAFILALMTLIVTLVIVILSYAHIV
KTITKFPSVQQKKKAFSTCSSHMIVVSLTYGSCIFIYIKPSANERVTLSKGIAVLNTSVAPLLNPFIYTLRNKQVKQAFGAMCRKIFSASQR*
49 >lcl|NP_001000073.1|Plus1complement(4858220..4859164) NW_047773 olfactory receptor Olr951 Olr951 __SEG__ Chr7 {Rattus norvegicus} MKNQSMELDFILLGLTDDPGLQIVVFLFLFLNYITGLLGNLIIVLLTLLDPRLKTPMYFFLRNFSFLEIMFTTVCIPRFLTTIVTGDKTISYNSCASQLFFYLLLGVTEF
YLLAAMSYDRYVAICRPLHYPIIMNSRVCRQLVLSSWVTGFLIIFPPVAMGLKLDFCDSRVIDHFMCETSPILQISCTDTHILEMMSFALAVVTLIVTLVLVSLSYSFII
KTIMNFPSAQQRTKAFSTCTSHMIVVSTTYGSCIFMYIKPSARERVAMSKGVALLYTSIAPLLNPFIYTLRNHQVKEVFWDVLQKTMGSLKNNF*
50 >lcl|NP_001000074.1|Plus14876211..4877149 NW_047773 olfactory receptor Olr952 Olr952 __SEG__ Chr7 {Rattus norvegicus} MKNYTIITEFVLLGISGNRELQVVIFVFLLITYIVSIIGNLTIIMLTLLDSHLKTPMYYFLRNFSFLEIMFTSVSIPRFLASIITQVKTISYNNCLAQLFFFIFMGVTEF
FLLTTMSYDRYIAICKPLHYTLIMNQKACTLFVLTSWLAGFLTIFPPLMLVLKLDFCASNVIDHFCCDYFPLLQLSCSDTWLLEVTGFYVALVTLLSTLALVILSYMCIF
RTILRIPSASQRKKAFSTCSSHMIVISMSYGSCIFIYVKPSANERASLTKTVAILSTSVAPMLNPFIYTLRNHQVKQAFKDLVHKVGFYRNK*
51 >lcl|NP_001000075.1|Plus1complement(6592173..6593123) NW_047773 olfactory receptor Olr1006 Olr1006 __SEG__ Chr7 {Rattus norvegicus} MRNHTSITTFILLGLTDDPQLQILLFIFLFITYLLSVTDNLTIITPTTVDPYLKTPTYFFLQNFSFLEISFTSACVPRFLYSISTGDRTITYNACATQLFFTDLFGVTGF
FLLAIMSYYRYMAICKPLHYMTIMNNKVCRTMVILCWMAAFMIILPPLSLGFHLEFCDSNIIDHFGCDANPILKISCSDTWLIEQMVIGSAVLTFIITLLCVVFSHIYII
RTVLKFPSVQQKRKALSTCSSHMIVVSITYGSCIFIYIKPSAKEEVTINKGVSLLISSISPMLNPFIYTLRNKQVKQASHDLLKKLAFLLSKVYLR*
52 >lcl|NP_001000076.1|Plus1complement(6620859..6621803) NW_047773 olfactory receptor Olr1007 Olr1007 __SEG__ Chr7 {Rattus norvegicus} MKNQSMELDFILLGLTDDPQLQIVVFLFLFLNYMMSLVGNLIIVLLTLLDPRLKTPMYFFLRNFSLLEIMFTTVCIPRFLTTIVTGDKTISYNNCASQLFFILLLGVTEF
YLLTAMSYDRYVAICRPLHYPIIMNSRVCHQLVFSSWVTGFLIIFPPLAMGLKLDFCDSRIIDHFMCETSPILQISCTDTRVLEMMSFVLAVVTLVVTLVLVSLSYSLII
KTIINFPSAQQRTKAFSTCTSHMIVVSITYGSCIFMYIKPSARERVTVSKGVALLYTSIVPLLNPFIYTLRNQQVKEVFWDILQKTLSFSKHKV*
53 >lcl|NP_001000077.1|Plus1complement(6429404..6430339) NW_047773 olfactory receptor Olr1000 Olr1000 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFMFFNYILSLMGNLIIIFLTLLDLRLKTPMYFFLRNFSLLEIAFTTACIPRFLMSIITGDKTITYNACVAQLFFFVLLLITEF
YLLAAMSYDRYVAICRPLHYPIIMNSKVCHLLVISSWVTGFLSIFPPLMLGLKLEFCASKTVDHFLCDTSPVLQLSCTDTRFIEWIAFVVAVLTLIITLILVILSYTLIL
KTILKFPSAQQRRKAFSTCSSHMVVVSITYGSCIFMYIKTSAKERVTLNKGVAVLNTSVAPLLNPFIYTLRNQQVKDAFKQVINRLCYSKL*
54 >lcl|NP_001000078.1|Plus1complement(6624716..6625648) NW_047399 olfactory receptor Olr1579 Olr1579 __SEG__ Chr13 {Rattus norvegicus} MKTVNCTQVREFVFQGFSNFQEHQLTLFIVFFTLYILTLTGNLIIVTIIRIDHHLHTPMYFFLSVLSTSETFYSLVIIPRMLGSLVGLSQSISLECCGIQLFFFLGFGIT
NCLLLAVMGYDRYVAICNPLRYSIIMNWRVCVTLASSVCVTGFLLSLVQAMAIFRLPFCNTLIKHFFCDVRPILDLACMVPVINDILTLVLTLMVITAPATFLFVSYVLI
ISTILKIASADGWKKTFATCSSHLTVVVIHYGCASTVYFKPKSENTKDQDQLISVTYTVITPLLNPVVYSLRNKEVQDALRRVLCRKYLS*
55 >lcl|NP_001000079.1|Plus16700821..6701762 NW_047399 olfactory receptor Olr1582 Olr1582 __SEG__ Chr13 {Rattus norvegicus} MPKKNSTVVTEFLFEGFSSFGWQHRLGLFIAFLTLYLLTLSGNVIIVTIIRLDRHLHTPMYFFLSMLSISETFYTIAIIPRMLAGLLNPRQAIDIQGCATQLFFYLTFGI
NNCFLLTAMGYDRYVAICNPLRYSVIMGKKACILLASGSLGIGLSMAIVQVTSVFGLPFCDGFVIAHFFCDVRPLLKLACTDTTINEIINFVVSVCVLVLPMGLVFISYV
VIISTIFKISSAEGRKKAFATCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTVITPLLNPVVYSLRNKEVKEALRKAIGLRPLSS*
56 >lcl|NP_001000080.1|Plus16714150..6715091 NW_047399 olfactory receptor Olr1583 Olr1583 __SEG__ Chr13 {Rattus norvegicus} MLKSNTTSVTEFLFEGFSSFAWQHRLALFAIFLTLYFLTLSGNVIIVSIIHLDHHLHTPMYFFLAVLSISDTCYTVTIIPRMLSDLLNPYHTIAFRDCVVQIFFYLTFGI
NNCFLLMVMGYDRYVAICNPLRYSVIMGKRACFHLASGSLGIGLGMAIVQVTSVFSLPFCDGFVIPHFFCDVRPLLKLACTDTTINEIINFVVSVCVLILPMGVVFVSYV
VIISTILKIASAEGRKKAFATCASHLTVVIIHYGCTAIIYMKPKSQSLLGQERLISVTYTLITPLLNPLVYSLRNKEVKDALRRALWQKPLLS*
57 >lcl|NP_001000081.1|Plus17072132..7073076 NW_047399 olfactory receptor Olr1584 Olr1584 __SEG__ Chr13 {Rattus norvegicus} MDHVNYTWSRTFILAGFTTSGTLRPLAFLGTLCIYLLTLAGNLFIIVLVQSDSGLSTPMYFFISVLSFLEIWYVSTTVPTLLQTLLHGHSPIPSAACFTQLYVFHSLGMT
ECYLLGVMALDRYLAICRPLHYHSLMSRQVQLWLAGATWVAGFSAALVPAGLTASLPYCLKEIAHYFCDLAPLMRLACVGSSWHAQVHGAVIGVATGCNFLLILGLYGNI
LTAVLKLPSAASRAKAFSTCSSHMTVVALFYASAFTVYVGSPQSRPEGTDKLIALVYALLTPFLNPIIYSLRNKEVKEAVKRVSDKIRTLLRDT*
58 >lcl|NP_001000082.1|Plus17110941..7111894 NW_047399 olfactory receptor Olr1588 Olr1588 __SEG__ Chr13 {Rattus norvegicus} MDQHNFSSLTEFVLLGFPNVEHIGGCLFVLLLLAYLFTIGGNTLIFLVIRLDAALHKPMYHFVSVLSFLELWYTATTIPKMLANLLSEKKAISFTGCLLQTYFFHSLGAS
ECYLLTAMAYDRYLAICRPLHYPSIMTTALCVKMAAGCWTCGFLCPISEVILVSQLPFCNYNEIPHIFCDFPPLLSLACKDTSTNVLVDFAVNAFIILVTFLFIMASYGR
IIGAVLKIKTAAGRRKAFSTCASHLIVVLIFFGSIIFMYVRLKKSYSLTLDRTLAVVYSVLTPLANPIIYSLRNKELIQAIKRTFFKKVEKASPTHH*
59 >lcl|NP_001000083.1|Plus17133528..7134466 NW_047399 olfactory receptor Olr1589 Olr1589 __SEG__ Chr13 {Rattus norvegicus} MGTGNWSQVTEFIILGFPYFQGVQTYLFVLLLSIYLTTILGNLLIFLVVYLDSRLHTPMYKFVSILSFLELGYTAATIPKMLANLLSEKKTISFSGCLLQIYFFHSLGAT
ECYLLTAMAYDRYLAICRPLHYPTLMTQTLCAKIATGCWLGGLAGPVVEISLVSRLPFCGPNHIQHIFCDFPPVLSLACTDTSVNVLVDFIINSCKILATFLLILSSYLQ
IIRTVLKIPSAAGKKKAFSTCASHLTVVLIFYGSILFMYVRLKKSYSLDYDRALAVVYSVVTPFLNPFIYSLRNKEIKEALKRQLMRTGMLG*
60 >lcl|NP_001000084.1|Plus1complement(7175255..7176178) NW_047399 olfactory receptor Olr1592 Olr1592 __SEG__ Chr13 {Rattus norvegicus} MVIEFLFSVFPPLHEGGLLFFILLILVYAFIISGNLVIFVAVQLDLALHTPMYFFISVLSFLEIWYTTTTIPKMLSSLVSEKKTISLGGCLMQMYFFHSLGITEGCVLTA
MSIDRYIAICYPLRYPTIMTSKLCIQLTAGSCFCGFLLVLPEIAWIATLPFCGSNKIHQIFCDFTPVLRLACTDTSLVVIVDAIHAVEILASFLVIALSYIRIIMVILGM
PSAEGRHKAFSTCAAHLAVFLLFFGSVAVMYLRFSATYSVFWDTVIAVTFVILAPFLNPIIYSLRNKEMKDAIGRLFHRKRDARAQK*
61 >lcl|NP_001000085.1|Plus17202351..7203298 NW_047399 olfactory receptor Olr1593 Olr1593 __SEG__ Chr13 {Rattus norvegicus} MRINRTTSVTEFLFSGLPEFEDGRFLFFIPLFFIYVFIVIGNLIVFFAVRMDTRLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISKRRTISLIGCLLQMYFFHSLGNS
EGILLTTMAIDRYIAICNPLRYPTIMTPRLCAQLSAGSCIFGFLVLLPEIAWISTLPFCGPNQIHQIFCDFEPVLRLACTDTSMILVEDVVHAVAIIFSVLVIAFSYIRI
ITVILRIPSGEGRRKAFSTCAAHLGVFLMFYGSVSLMYLRFSATFPPVLDTAIALMFAVLAPFFNPIIYSLRNKDMKTAIKKLLSSPTMLPTSAS*
62 >lcl|NP_001000086.1|Plus17355104..7356033 NW_047399 olfactory receptor Olr1600 Olr1600 __SEG__ Chr13 {Rattus norvegicus} MINQTILKEFILVGFSVYPHVQTCLFVVFLCLYIVTLAGNLTIMGLTWVERSLHTPMYFFLSALSFSETCYTLTIIPKMLVDLLDKDSHISVTGCGLQMCFFLGLGGTHC
ILLTVMGYDRFLAICNPLRYPLLMTNVACGQLVASAWVGGFFISLIETTLIFRVPFCIPNLIRHFFCHMRAVLRLSCTDSNFTEFTVTLMSVSGLLGTFLLILLTYVFIL
SSVLKIPSAEGKQKAFSTCASHLTVVIIHFGFASVVYLKPENSGGDDTLIAVPYTVITPFLSPIIFTLRNKDIKNAFRKITRKTIVLKT*
63 >lcl|NP_001000087.1|Plus17390801..7391754 NW_047399 olfactory receptor Olr1601 Olr1601 __SEG__ Chr13 {Rattus norvegicus} MSNLSRSHVEEFVLVGFPTAPPFQSLLFVFFFAIYLLTLLENMLIVSTIWLTPSLHRPMYFFLSHLSFLELWYINVTIPRLLGAFLTEDGRVSYGGCMTQLYFFIALACT
ECVLLAVMAYDRYLAICEPLRYPSLMPPRLATRLAAASWGSGFFSSMMKLLFISRLSYCGPNIINHFFCDISPLLNLTCSDKEQAELVDFLLALVMILLPLVGVVSSYAA
IIVAILRIPTAQGRHKAFSTCTSHLAVVVIYYSSTLFTYARPRAMYTFNYNKIISVLYTVIVPFLNPAIYCLRNKEVKDAFRKTMLGRCHHPREDPD*
64 >lcl|NP_001000089.1|Plus1complement(1970384..1971310) NW_047453 olfactory receptor Olr1624 Olr1624 __SEG__ Chr15 {Rattus norvegicus} MEIKNSSVVTEFILLGLTQSQEAQLLVFTMISVFYLIILPGNFLIIFTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFFCEKKVISYKACITQLFFLHFLGAG
EMFLLVVMAVDRYIAICRPLYYSTLMNPRVCYALLLALWLGGFAHSIVQVALILNLPFCGPNQLDNFFCDVPQVVKLACTDTFAVELLMVSNSGLLTLLCFLGLLASYAV
ILYHVKGHSSEGKSKAISTCTTHIIIVFLMFGPAIFIYTRPFQALQADKVVSLFHTVIFPLMNPVIYTLRNQEVKTSMRKLLSQHAVC*
65 >lcl|NP_001000090.1|Plus1complement(2035371..2036342) NW_047453 olfactory receptor Olr1626 Olr1626 __SEG__ Chr15 {Rattus norvegicus} MNETNYTRVSEFVLLGLSSSKELQPFLFLIFSLLYLAILLGNFLIILTVTSDSRLHTPMYFLLANLSFIDICVSSFATPKMLADFLVERKTISFEACMAQIFCVHQFAGG
EMVLLVSMAYDRYVAICKPLHYMTIMSRRVCIILVIIPWFVGFIHTMSQLAFTVNLPFCGPNQVDSFFCDLPLVTKLACTDTYVISLLIVADSGVLTMCTFVFLVVSYTV
ILITVRNRSSASMAKARSTLTAHITVVILFFGPCIFIYVWPFNGYSLDKVLAVFYTIFTPILNPLIYTLRNKDVKAAMSKLRSRYLKPGQVSSLIRNVLFPET*
66 >lcl|NP_001000091.1|Plus12079482..2080456 NW_047453 olfactory receptor Olr1627 Olr1627 __SEG__ Chr15 {Rattus norvegicus} MNETNYSRVTEFVLLGLSSSKDLQPFLFLIFSLLYLAILLGNFLIILTVNSDSRLHTPMYFLLANLSFIDICVASFATPKMLADFLVERKTISFDACLAQIFFVHLFTGG
EMVLLVSMAYDRYVAICKPLHYMTIMSRRVCIILVIISWFVGFIHTTSQLAFTVNLPFCGPNQVDSFFCDLPLVTKLACIDTYVVSLLIVADSGFLSLSSFLLLVVSYTV
ILITVRNRSSASMAKARSTLTAHITVVTLFFGPCIFIYVWPFSSYSVDKVLAVFYTIFTPILNPVIYTLRNKEVKAAMSKLRSRYLKPGQVSALIRNVLLLETK*
67 >lcl|NP_001000092.1|Plus1complement(2134851..2135822) NW_047453 olfactory receptor Olr1630 Olr1630 __SEG__ Chr15 {Rattus norvegicus} MDSTNYSVVSEFVLLGLSRSRELQIFYFVFFSALYIVIVLGNLLIIIAVTSDSSLHSPMYFLLGNLSFFDICQASFATPKMIVDFLSERKTISFTGCIAQIFFIHLFTGG
EMVILVSMAYDRYVAICKPLHYMIIMNHSTCTALVLISWAVGLIHTLSQLSFTVKLAFCGPNEVDSFFCDLPRVVKLACIDSYITEILIVVNSGILSLSTFSLLVSSYVI
ILVTVWFKSSAAMAKAFSTLAAHIMVVVLFFGPCIFIYVWPFTTYPVDKFLAIFYTVFTPILNPIIYTLRNRDMKAVMGKIAAQYLRPPKIAEMPFVTRIPHD*
68 >lcl|NP_001000093.1|Plus1complement(1502697..1503650) NW_047453 olfactory receptor Olr1608 Olr1608 __SEG__ Chr15 {Rattus norvegicus} MTVANKSIVTEFVLLGLSNSWELQIFFFIVFSVFYVATMVSNSIIVVIVISDSHLHSAMYFLLTNLSLIDMSLASFATPKMIIDYLTDHKTISFDGCIAQIFFLHLFTGT
EIILLMAMSFDRYIAICKPLRYASIISPQVCIALVVSSWIVGIMHSMSQVIFALTLPFCGPNKIDSFFCDLPVVFQLSCVDTYVLGLFMISTSGIIALSCFILLFNSYVI
VLLTIKHHSSKGSSKALSTCTAHFIVVFMFFGPCIFIYMWPQNSFVIEKILSVFYTIFTPILNPVIYTLRNHEVNSAMRKLGSKFLNFSTETPSHSF*
69 >lcl|NP_001000094.1|Plus1complement(1580692..1581618) NW_047453 olfactory receptor Olr1610 Olr1610 __SEG__ Chr15 {Rattus norvegicus} METENRTVVTEFILIGLTQSHDIQRLVFVLSLIFYIIILPGNILIILTIKSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDIFSEKKIISYKACITQLFFLHFLGGG
EGLLLVVMAFDRYIAICRPLHYSTVMSPRACYVMLLALWLGGFAHSIIQVVLILRLPFCGPNHLDNFFCDVPQVIKLACTDTFAVELLMVFNSGLLTLVCFLGLLTSYAV
ILCHVHRSASEGKNKAISTCTTHVIIIFLMFGPAIFIYTRPFTTLSADKVVSFFHTVIFPLMNPVIYTLRNQEVKTSMKKLIIRHIIC*
70 >lcl|NP_001000096.1|Plus1complement(1607558..1608499) NW_047453 olfactory receptor Olr1612 Olr1612 __SEG__ Chr15 {Rattus norvegicus} MEPANDTTVTEFVLTGLSQTREVQLVLFVIFLSFYLFILPVNILIICTIRLDPHLSSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGAS
EMFLLTVMAFDRYAAICRPLHYATIMNRHLCCILVALSWTGGFVHSIIQVALIVRLPFCGPNELDNYFCDITQVVRIACANTFLEELVMIFSSGLISVVCFIALLMSYAF
LLAMLKKHSSSGESTSRAISTCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKAAMKKLVNRYVFCKEK*
71 >lcl|NP_001000097.1|Plus11877793..1878767 NW_047453 olfactory receptor Olr1620 Olr1620 __SEG__ Chr15 {Rattus norvegicus} MKALSNSSTITGFILLGFPCPREGQILLFVLFFMVYLLTLMGNASIICAVCCDSRLQTPMYLLLANFSFLEIWYVTSTVPNMLANFLSETKVISFSGCFLQFYFFFSFGS
TECFFLAVMAFDRYLAICRPLHYPALMTGRLCNILVISCWVLGFLWFPVPIIFISQMSFCGSRIIDHFLCDPGPLLALTCTKSPLIELAFSILSPLPLIIPFVFIMGSYT
LVLAAVLKVPSASGKRKAFSTCGSHLAVVALFYGSVLVMYGSPTSEHESGMQKIVTLFYSVLTPLLNPVIYSLRNKHMKVALKEILKRIKTWSTKKDLEQLNLY*
72 >lcl|NP_001000099.1|Plus1complement(3416123..3417064) NW_047453 olfactory receptor Olr1640 Olr1640 __SEG__ Chr15 {Rattus norvegicus} MERVNHTLLTEFVLTGVPHPPRLRTFLFVFFLLIYILTQLGNMLILITVCADTQLHARPMYVFLGALSVIDMGISTIIVPRLMMNFTPGIKPIPFGGCVAQLYFYHFLGS
SQCFLYTTMAYDRYLAICQPLRYPVLMSAKLSILLVAGAWVAGSIHGAIQAILTFRLPYCGPNQVDYFFCDIPAVLKLACADTTVNELVTFVDIGVVVASCFSLILLSYI
YIIRAILRIRTADGRRRAFSTCGAHVTIVTVYYVPCAFIYLRPDSHSILDGAAALFPTAITPFLNPLIYTLRNQEVKTALRRMVGRQSTKSEV*
73 >lcl|NP_001000100.1|Plus1complement(3444288..3445244) NW_047453 olfactory receptor Olr1641 Olr1641 __SEG__ Chr15 {Rattus norvegicus} MRRNRNTSLDTVVTDFLLLGLAHPPNLRTFLFLVFLLIYILTQLGNLLILLTVWADPKLHARPMYILLGVLSFLDMWLSSVIVPRIILNFTPANKAIAFGGCVAQLYFFH
FLGSTQCFLYTLMAYDRYLAICQPLRYPVLMNGKLCTILVAGAWVAGSIHGSIQATLTFRLPYCGPKEVDYFFCDIPAVLRLACADTAINELVTFVDIGVVAASCFLLIL
LSYANIVHAILKIRTADGRRRAFSTCGSHLTVVTVYYVPCIFIYLRAGSKSSFDGAVAVFYTVVTPLLNPLIYTLRNQEVNSALKRLRAGRGNVGGDK*
74 >lcl|NP_001000101.1|Plus1complement(3518820..3519752) NW_047453 olfactory receptor Olr1644 Olr1644 __SEG__ Chr15 {Rattus norvegicus} MEKAVLINHTSVTSFRLTGLSANPKVQMAVFFIFLIFYVLTLVGNILIVITIIFDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTLSEDKLISFDACVVQMFFLHLF
ACTEIFLLTVMAYDRYVAICKPLQYMTIMNWKVCMLLATALWTGGTIHSISLTSLTIKLPYCGPDEIDNFFCDVPQVIKLACTDTHIIEILIVSNSGLISVVCFVVLVVS
YAVILVSLRQKISEGKRKALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKVVSVFFTAVTPLLNPIIYTLRNEDMKSALNKLIRRREK*
75 >lcl|NP_001000102.1|Plus1complement(3543653..3544657) NW_047453 olfactory receptor Olr1645 Olr1645 __SEG__ Chr15 {Rattus norvegicus} MEKAVLINQTSVTSFRLTGLSANPKVQMFVFFIFLVFYVMTLVGNILIVITIIFDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLSDTLSDEKVISFDACVVQIFFLHLF
ACTEIFLLTVMAYDRYVAICKPLRYMTIMNWKVCTVLGVAMWTAGTVHSISFTSLTIKLPYCGPDEIDNFFCDVPQVIELACTDTRITEILVVSNSGMISMVCFVIIVVS
YAVILVSLRQQISDGKRKALSTCAAHLTVVTLFLGHCIFIYSRPSISLPEDKIVSAFFTAVTPLLNPIIYTFRNEDMKSALKKLIRRKERKESKNDNCLGFLVIQIKEST
IYCI*
76 >lcl|NP_001000103.1|Plus1complement(4206100..4207044) NW_047454 olfactory receptor Olr1646 Olr1646 __SEG__ Chr15 {Rattus norvegicus} MENSTTIVTEFILLGLSDACELQVIIFLGFLLTYFLILLGNFLIIFITLADRRLYTPMYYFLRNFAVLEIWFTSVIFPKMLTNIVTGHKTISLLGCFLQTFFYFFLGTTE
FFLLAVMSFDRYVAICNPLRYGTIMSKRVCVQLVFCSWTAGFLLIMVPSSILFQQPFCGHNIINHFFCDNFPLMELICADTSLVEILGFIIANFSLLGTLAVTATCYGHI
LYTILHIPSAKERKKAFSTCSSHIIVVSLFYGSCIFMYVRSGKNGQGEDHNKVVALLNTVVTPTLNPFIYTLRNKQVKQVFREHISKILKLNPT*
77 >lcl|NP_001000104.1|Plus1complement(30734..31681) NW_047487 olfactory receptor Olr1653 Olr1653 __SEG__ Chr17 {Rattus norvegicus} MADTVANTTEYMEFLLMGYPDEQVLQTLCATLFFLLYLAALVGNLLIITVTTVDKHLQSPLYFFLKNLSLIDICYISVTVPKSIMNSATNTHSITFLGCVLQVFCVIFLA
GSEFALLLVMSYDRYAAICFPLHYEAIMSKDACVQMVAAAWLSGCVYGSVHATGTFSVRFCGPNVVYQFFCDIPSLLRLACFGDEILEYVFIITSCCFAFVCFILMVISY
VHIFTIILRIPSTQGRFKTFSTCVPHLTVVTLFLSSGFVAYLGSTAKSPSSLNVFMSVFYSLLPPSLNPVIYSFRNSDVKVALHNIFGEKMITYL*
78 >lcl|NP_001000105.1|Plus13944649..3945569 NW_047492 olfactory receptor Olr1658 Olr1658 __SEG__ Chr17 {Rattus norvegicus} MINQSCQEQFILLGFSDRPRLESILFIFILIFYMVTLVGNIVIILLSHLDPCLHTPMYFFLTNLSFLDLCFTTSSIPQLLFNLGGQDKSISYIGCAIQLFMFLGLGGTEC
VLLAVMAYDRFTAICKPLHYSVIMHSQLCWKLVSVAWSVGLLNSLVMSPVTMKLPRCGRCQVRHFLCEMPALIKIACVDTVAVESTVFILSVIIVLVPLILILISYSYIA
LAVLRIKSASGRRKAFNTCGSHLTVVSLFYGNIIYMYMQPGHKASQDQGKFLTLFYNLVTPMLNPVIYTLRNKDVKGALKMLVTRK*
79 >lcl|NP_001000106.1|Plus14591735..4592673 NW_047492 olfactory receptor Olr1660 Olr1660 __SEG__ Chr17 {Rattus norvegicus} MNNTSSETDFILLGFSSQPQLEHIISAVVFVFYLVTLVGNTTIILVSYLDSQLHTPMYFFLSNLSFVDLCYTTSIVPQMLVNLWGPKKSITYGGCALQFFFALDLGATEC
LLLAVMAYDRYAAVCQPLYYTVIMHPVLCQKMVLSAWLGGLGSALILCPLTLKLPRCGHREVDNFFCEMPALIKMACVYSRVIEIVVFTLGVIFLLVPLSLIVISYAVIT
QAVMKIKSATRWRKILNTCGSHLTVVTLFYGTLIYMYMKPQNIVSHEEGQFFTLFYTIVIPSLNPLIYTLRNKDVKNAVKRILGMCKHSAKV*
80 >lcl|NP_001000107.1|Plus1complement(4647849..4648802) NW_047492 olfactory receptor Olr1662 Olr1662 __SEG__ Chr17 {Rattus norvegicus} MDPSNYSTLHVFILLGFSDHPHLEMILSGVVTFFYIVTLVGNTAIILASLLDPHLHTPMYFFLRNLSFLDLCFTTSIVPQMLVNLWGPEKTISSVGCIVQLYVYMWLGSI
ECLLLAVMSYDRFTAICKPLHYFVIMNPRLCVKMIVMVWGISLANSVVLCTLTVNLPRCGHNLLDHFLCELPAMVRIACVDTTTVEMSVFALGIVIVLTPLILILISYGY
IAKTVLNMKSKAGQQKAMNTCGSHLTVVSIFYGSIIYLYLQPGNRASKDQGKFLTLFYTIITPSLNPLIYTLRNRGMKDALKKLMRFYHRFSELRRN*
81 >lcl|NP_001000110.1|Plus111061423..11062376 NW_047555 olfactory receptor Olr3 Olr3 __SEG__ Chr1 {Rattus norvegicus} MPPSWAAPPWANQSRTHELEFVLLGFAHVPSLRPMLAALFLAAFLLTLLGNTLIVLLTSLDLGLRKPMYFFLRQLALVEICFSLDVAPRLLVTLLQPGRGVSSTSCALQL
LLVLSCVTSECFLLTVMAWDRFLAICRPLRYGAIMSPQLCHLLATTCWLAGIPVALVFTIWLFKFPFCGARGIRHFFCDIAPLLNLVCADTRVFEANVFVATVLVIMVPF
CLIATSYVMILAAVLRMPSASGRHKVLSTCASHLIVVILFYGTTGVIHLRPKASYSPESKQVVSLSYTMVTPMLNPLIYSLRNKEVKAAFGRVCCGR*
82 >lcl|NP_001000111.1|Plus111081702..11082640 NW_047555 olfactory receptor Olr4 Olr4 __SEG__ Chr1 {Rattus norvegicus} MERSLELANMTRVQQFLLLGLSTRLDIRDALFAVFLTLYLLTLVENALIIYLICSHSELHKPMYFFLGNLSCLEMCYVSVTMPTLLVGLWTGPYHISFVTCMTQLFFFIV
LICTECTLLASMAYDRYVAICRPLHYPLLMRPQVCLGLALSSWLGGLVVSVAKTTCIASLSYCGPNVLNQFFCDVSPLLNLSCTHVTLTELVDFISAIVIFCGTLLVSLA
SYSAIGMAVLRMPSAAARRKAFSTCASHLVVVGIFYSAALFIYCRPSRIKSMDLNKVLSVIYTVVTPLCNPIIYCLRNKEVHTVLKKTFHWP*
83 >lcl|NP_001000112.1|Plus111092292..11093230 NW_047555 olfactory receptor Olr5 Olr5 __SEG__ Chr1 {Rattus norvegicus} METSLDLTNMTRVHQFVLLGFPTRLGIRDTLFVIFLGLYLLTLVENALIIYLICSHSELHKPMYFFLGNLSCLEMCYVSTTMPTLLVGLWTGPYHISFVTCMTQLFFFVS
LICTECTLLASMAYDRYVAICRPLHYPLLMRPQVCLGLALSSWLGGLVVSAIKTKCIASLTYCGPNVLNQFFCDVSPLLNLSCTHVALTELVDFISAIVIFCGTLLVSLA
SYSAIGMAVLRMPSAAARRKAFSTCASHLVVVGIFYSAALFIYCRPSRIKSMDLNKVLSVIYTVVTPLCNPIIYCLRNKEVHTVLKKTLHWP*
84 >lcl|NP_001000113.1|Plus1complement(11124204..11125148) NW_047555 olfactory receptor Olr8 Olr8 __SEG__ Chr1 {Rattus norvegicus} MEKSLELGNATRVQEFVLLGLSTRLGIRDVLFIIFLSLYLLTLMENTLIIYLIFSHSELHKPMYFFLGNLSCLEMCYVSVTMPTLLMGLWTGPCHVPFTGCMTQLFFFIS
LICTECTLLASMAYDRYVAICRPLHYPLLMRPRVCLGLALSSWLGALLVSVIKTACIASLSYCGPNILNHFFCDVSPLLNLSCTHVALTELVDFISAIVILWGSLLVAIA
SYVAIGRTVLGMPSAAARHKAFSTCASHLVVVGIFYSATIFIYARPSRIEAMDLNKVLSVIYTVVTPMCNPIIYCLRNREVQLAFHRTMRWSSV*
85 >lcl|NP_001000114.1|Plus1383835..384782 NW_047561 olfactory receptor Olr11 Olr11 __SEG__ Chr1 {Rattus norvegicus} MAVYNLTTVTQFILIGLSDLPEVRYPLFVAFVMIYQITLLGNGVILLAILTERKLQTPMYYLLTNLSLLDIFCPSATVPKMLKNLLAEDHRISYVGCALQLYFLVALAGT
EVFLLAVMAYDRYVAICFPLRYSLIITKVRCVQLLFGTWAAGFLNSFVHTMSTFSLSFCKSNRVNQYYCDIPPVVALSCSSTYVAEMLVLVVGGIFGVGAFLITLISYIY
IVSTILKIRSAEGKRKAFSTCASHLLVVFLFYGTTIFTYIRPTSSQHSPGRDRLISMLYAVVTPMLNPIIYSLRNTEVKGALRKVLHLRICSQKG*
86 >lcl|NP_001000115.1|Plus138067..39014 NW_047561 olfactory receptor Olr10 Olr10 __SEG__ Chr1 {Rattus norvegicus} MAVYNLTSVTQFILIGLSDLPEVRYPLFVAFIMIYQITLLGNGIILLAILTERKLQTPMYYLLTNLSLLDIFCPSATVPNMLKNLLTEDHRISYVGCALQLYFLVALAGT
EVFLLAVMAYDCYVAICFPLRYCLIMTKVRCVQLLFGTWAAGFLNSFVHTMSTFSLSFCKSNRVNQYYCDIPPVVALSCSSTYVAEMLVLVVGGIFGVGAFLITLISYIY
IVSTILKIQSAEGKRKAFSTCASHLLVVFLFYGTTIFTYIRPTSSQHSPGRDRLISMLYAVITPMLNPIIYSLRNKEVKGALRKVLHLRICSEKA*
87 >lcl|NP_001000116.1|Plus1complement(1249555..1250481) NW_047561 olfactory receptor Olr13 Olr13 __SEG__ Chr1 {Rattus norvegicus} MITENGTLSQGFLLLGFPGSQVLQTSLFLFFLVMYLLTIGGNVAILLLVSTSHQLQTPMYFFLSNLSFLEIWYTTAAVPKALAILVGRSQTISFSGCLLQMYLVFSLGCT
EYFLLAAMAYDRYLAICFPLHYQVIMNSLLSAQLALCSWICGFLAISVPAALISTLSFCGTHSINHFFCDIAPWIALACTSTQGVETVAFVIAFVVILSSCLITLISYAY
IIRTILRIPSTSGRRKAFSTCSSHLTVVLIWYGSTIFLHVRTSIKDDLQLTKAVHVLNTVVTPALNPFIYTLRNKEVREILEKKWKRM*
88 >lcl|NP_001000118.1|Plus11425380..1426372 NW_047561 olfactory receptor Olr20 Olr20 __SEG__ Chr1 {Rattus norvegicus} MANSTLVTEFLLEVFSETWELRILLSVLFLLVYLGSLLGNLTIIIAITLDQTLNTPMYFFLRNLSILDMCYISITVPSTCVNSLIDHRNISLGGCAAQIFFFLFCACVET
LFLAIMAQDRYVAICKPLLYPVIINHQFCIQMTLASLLSSLVLASVHTFKTFQLSFCHSNVVPQFFCDMPALLRLSCSDTFNNKLLILLTDIGLSGSCFVFIAISYIRIL
STVLKIPIKGERGKAFSTCVPHIVVVSVFLISAAYMYLRPPVVTFEVVQEMTISVFYAMIPPFLNPIIYSLRNKQIKEAVRKVTLQVFFIFEYKRNTYLSWYSRGKELIK
*
89 >lcl|NP_001000119.1|Plus11563479..1564474 NW_047561 olfactory receptor Olr23 Olr23 __SEG__ Chr1 {Rattus norvegicus} MMANSTLVTEFLLEVFAKSRELRILLSVLFLLVYLGSLLGNLIIIIATTVDQTLNTPMYYFLRNLSIVDMCYVSVTVPNACFNSLTDHRNISVAGCAAQIFLVFFCACVE
LFLLTIMAQDRYVAICKPLLYPVIMNHQFCVQMTLVSLHSSLVIASVHTFKTFQLSFCHSNVVPQFFCDVPSLLKLSCSDTFNNKLLMLLSAIVIGCSCFTFIAVSYVRI
LSTVLKVPVKGERGKAFSTCVPHIVVVSVFLISATYVYLRPPVLTLEVVKEMSLSVSYTIVPPFLNPIIYSLRNRQIKAAVKKVILRLSFTFEYKRNEYLSDISRRRKLT
K*
90 >lcl|NP_001000120.1|Plus11721707..1722636 NW_047561 olfactory receptor Olr30 Olr30 __SEG__ Chr1 {Rattus norvegicus} MVNSTLVAGFLLEVFAETWEFRLLLSVLFLLVYLGSLLGNFIIIIATTIDQTLNTPMYFFLRNLSILDMGYVSVTMPTACINSLTDHRNISVFGCAAQIFLVLFCACIEI
LFLTIMAQDRYVAICKPLLYPVIMNHQFCVQMTLTTLLSSLVIASVHTLKTFQLSFCHSNVVPQFFCDIPSLLRLSCSDTFNNKLLLLLTAIGLSGSCFTFIAVSYVRII
SAVLKVPVKGDRGKAFSTCVPHIIVVSVFLSSGAYVYLRPQSTSEIVEDMILSVFYTIVPPFLNPIIYSFRNKQIKEAVKKVIFRYVYS*
91 >lcl|NP_001000121.1|Plus115961283..15962233 NW_047561 olfactory receptor Olr35 Olr35 __SEG__ Chr1 {Rattus norvegicus} METTTCNGSVDGSTVFYLVGIPSLPEPFYLPVFFLFLLFYLLILMGNTLILVAVVAEPSLHKPMYFFLINLSALDILFTTTTVPKMLSLLLLGDRFLSFPSCLLQMYLFQ
SFTCSEAFILVVMAYDRYVAICRPLHYPVHMTPQTNTALAASAWITALLLPVPAVVKTSQMVYNDVAYIYHCFCDHLALVQSSCSDTTPQTLMGFCIAMVVSFLPLLLVL
LSYVRILISVLRINSKEGRSKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYSILTPILNPLIYTLRNKDVKAAITKIVYLKSVM*
92 >lcl|NP_001000122.1|Plus12885021..2885974 NW_047562 olfactory receptor Olr48 Olr48 __SEG__ Chr1 {Rattus norvegicus} MPTFHNACSVPSSLWLTGIPGLESLHMWLSIPFGSMYLVAVVGNITILAVVRVERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFGAGSIGLDACLCQMFLIHCFA
TVESGIFLAMAFDRYVAICNPLRHSMVLTQTVVGRLGLAALLRGVLYIGPLPLMIRLRLPLYKTRVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVLILDSVAIAAS
YVMIFRAVMGLATPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRDRLLQILKTGTKIR*
93 >lcl|NP_001000123.1|Plus1complement(2867805..2868764) NW_047562 olfactory receptor Olr47 Olr47 __SEG__ Chr1 {Rattus norvegicus} MLISNNACSVPSSFWLTGIPGLQSLHMWLSIPFGSMYLVAVVGNITILAVVKTERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFGACRIGLDACLIQMFFVHCFA
TVESGIFLAMAFDRYVAICDPLHHTSVLTHAVVGRLGLAALLRGVFYIGPLPLLIRLRLPLYRTHIIAHSYCEHMAVVTLACGDTRANNLYGMGIGLLVLILDSVAITAS
YVMIFRAVLGLSTSDARFKTLGTCGSHICAILVFYIPIAVSSLTHRFGRHVPSHIHILLANFYLLIPPILNPIVYAVRTKQIRERLLHIIKSGTQHRDM*
94 >lcl|NP_001000124.1|Plus12846687..2847640 NW_047562 olfactory receptor Olr45 Olr45 __SEG__ Chr1 {Rattus norvegicus} MLVNNITSTHPVAFLLMGIPGLEQLHIWISIPFCSAYTLAVLGNCTLLFIIRVDAALHEPMYLFLSMLAAIDLVLSSSTLPKMLALFWFRDREINFHACLIQMFFLHSFA
IMESAVLLAMAFDRYVAICKPLHYTTILTKPLIIKIGLAAVTRAVTLMTPLPFLLRRFHYCRGVMIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLASQEARYKAFGTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILLANFYLLFPPMVNPIIYGVKTKQIRERVLGLFLRKDLKGK*
95 >lcl|NP_001000125.1|Plus1complement(2829775..2830722) NW_047562 olfactory receptor Olr44 Olr44 __SEG__ Chr1 {Rattus norvegicus} MQHTNHSHQNPSSFLLMGIPGLEAAHFWIAFPFCSMYALAVLGNMAVLLVVRSEPSLHQPMYLFLCMLSTIDLILCTSTVPKLLALFWANAAEIAFGACAAQMFFIHGFS
AVESGILLSMAFDRYLAICRPLHYGSLLSAESVSKLGAAALLRGLGLMTPLTCLLARLSYCGRVVAHSYCEHMAVVKLACGGTQPNNIYGITAATLVVGTDSICIAVSYA
LILRAVLGLSSKEARAKTFGTCGSHLGVILLFYTPGLFSFYTQRFGQHVPRHVHILLADLYLVVPPMLNPIIYGMKTKQIRDGALRLLKRGPAQS*
96 >lcl|NP_001000126.1|Plus12755411..2756352 NW_047562 olfactory receptor Olr41 Olr41 __SEG__ Chr1 {Rattus norvegicus} MTTLNHTVVSHTVFRLLGVPGLEDQHMWISIPFFISYVTALLGNSLLIFVLTRPSLHGPMYFFLCMLAGADIVLSTSTVPQALSIFWFHAGEISLDRCITQLFFMYSTFI
AESGILLVMAFDRFIAICYPLRYSTIFTISLIGKIGMAIFLRSFVTIFPVIFLVKRLTFCKNKIIPHTYCEHIGLAKYACNNIRVNFWYGIFVLMSTITLDVVLIFVSYV
LILRSIFRMPSQDARHKTLNTCGSHVCVIILFYGPGIFTTLTQRFGRHIPPHIHILLANVCILVLPMLNPIIYGIKSKQIQEQIVHVLFTNYK*
97 >lcl|NP_001000129.1|Plus13253397..3254359 NW_047562 olfactory receptor Olr62 Olr62 __SEG__ Chr1 {Rattus norvegicus} MISSQAFINISFFQPQSFLMTGIPGLEAVHGWISIPFSSMYTVALTGNCLILLAVRRTHSLHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRFIDFNACLIQMFFL
HFFSVVESSVLLAMSFDRFVAISNPLRYASVLTNTVIIRIGVAITTRATLSLLPLPFLLKRLNYCPGKILLSHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSLL
IVMSYSLILYTVMGLASPRERVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYSVKSKPIRGAMFRVLNRKGQG*
98 >lcl|NP_001000130.1|Plus1complement(3182920..3183870) NW_047562 olfactory receptor Olr56 Olr56 __SEG__ Chr1 {Rattus norvegicus} MSTSENTTASSIIFLLTGVPGLEALHTWISIPFCFLYATALSGNSLILFAIISQPSLHEPMYYFLSMLSTTDLGLSISTMVTMLGIFWFNAREISFNACLSQMFFIQLFT
VMESSVLLAMAYDRYVAITNPLRYASVLTDLKIVVIGVAIITRGTLIQTPLAVLLKRLSYCRSHVLHHSYCFHPDIMKLSCTDTRINSAVGLTALISTAGVDSVFIVLSY
VLIIRTVLSIASPEERKKAFSTCISHIGAVAVFYIPLLSLSFVHRFGRRAPPYVHTLIANAYLLIPPVMNPIIYSVKTKQIRKAVLKVLSSSMTKS*
99 >lcl|NP_001000131.1|Plus13113398..3114372 NW_047562 olfactory receptor Olr50 Olr50 __SEG__ Chr1 {Rattus norvegicus} MVASSNSSSHPLFFILLGIPGLENYQFWIAFPFCVMYIVALTGNITILYIIQTDHTLHEPMYLFLALLGITDLVLSSSTQPKMLAILWFHDHEIEYNACLIQVFFIHAFS
SVESGVLMAMALDRYVAICFPLRHSSILTTSVVIKLGAAVMVRGLLWVSPFCFMISRMPFCPNNVIPQSYCEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSY
VMILRAVLRLPSGEARLKAFGTCASHVCVILAFYIPALFTFLTHRFGHHVPRVVHIIFANFYLLVPPMLNPIVYGVRTKQIRDRVIRGFRRKKLEPGITVAPGQ*
100 >lcl|NP_001000132.1|Plus13099253..3100179 NW_047562 olfactory receptor Olr49 Olr49 __SEG__ Chr1 {Rattus norvegicus} MAPTFLLVGLPGLEATPSWWSVPLITIYLLSALGNGTVLWIIALEPTLHRPMYFFLFLLSVSDVGLATVLMPTLLGLAFTDAHAIPASACLLQMFFIHVFSVMESSVLLA
MAFDRAVAICRPLHYSVLLTNGVISKIAVAIAFRCLSLHLPLPFLLAHMPYCRPQVLTHSYCLHPDMVRLACPGTWGAFYSLVVVLSAMALDPLLIFFSYGLIGRALQGV
GSTEDRWKAGQTCAAHLSAVLLFYTPMILLALINRFKLPLPLPAHTLLSYVHFLLPPLINPVLYSVKMKEIREKILKRLLPRKVGCAL*
101 >lcl|NP_001000133.1|Plus13375299..3376267 NW_047562 olfactory receptor Olr68 Olr68 __SEG__ Chr1 {Rattus norvegicus} MVSDTAPVPTHVCFQHSEVKYFLLIGIPGLEYAHAWISIPICLMYLIAIMGNCTIIFVIKTEPSLHEPMYYFLTMLAVSDMGLSFSSLPTMLKIFCFNAMQISPNACFAQ
EFFIHVFTAMESSVLLIMSLDRFLAIHNPLRYSSILTGSRVAKIGLILAIRSTALVLPFPFTLRKLKYCQKNLLSHSYCLHQDVMKLACSDNKINFIYGFFVALCTMLDF
ALILMSYMLILKTVLSIASLAERLKALNTCVSHICAVLIFYVPIITLAAIHRFAKHKSPLLVILIADMFLLVPPLMNPIVYCIKTRQIREKVLGKLVNLCVR*
102 >lcl|NP_001000134.1|Plus13435202..3436146 NW_047562 olfactory receptor Olr74 Olr74 __SEG__ Chr1 {Rattus norvegicus} MLPSRNSSSHSTFFILLGIPGLENYQFWVAFPFCVMYVVAVTGNITILHIIRIDHTLHEPMYLFLAMLATTDLVLSSSTQPKMLAILWFHDHEIEYNACLIQVFFIHAFS
SVESGVLMAMALDRYVAICFPLRHSSILTTSVVIKLGAAVMVRGLLWVSPFCFMISRMPFCPNKVIPQSYCEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSY
VMILRAVLRLPSGEARLKAFGTCASHIGVILTLYIPALFTFLTHRFGHHVPRVVHIMFANVYLLVPPMLNPIIYGVRTKQIRDRVTRGFCGKGS*
103 >lcl|NP_001000135.1|Plus13476290..3477237 NW_047562 olfactory receptor Olr78 Olr78 __SEG__ Chr1 {Rattus norvegicus} MLSWNSSDVTGPIFILKGFPGLEYVHTWLSVPFCLAYLVAFIGNVTILSVIWIESSLHQPMYYFLSILALTDLGMSMSTLPTMLTVLWLDIREIQASACYAQLFFIHTFT
FLESSVLLAMAFDRFIAICRPLHYSTILTNSVIGKIGMACLLRSMGVVLPTPLLLRQYHYCHINALSHAFCLHQDVLRLSCSDARINSVYGLCVVIATLGVDSVFILISY
VLILNAVLSIASREERLKALNTCVSHVCVVLIFFVPVIGVSMVHRFGKHLSPIVHILMADIYLLLPPVLNPVVYSVRTKQIRLGILRKFRLSRRF*
104 >lcl|NP_001000136.1|Plus13565262..3566200 NW_047562 olfactory receptor Olr83 Olr83 __SEG__ Chr1 {Rattus norvegicus} MTIQSNRSVFHPATFFLIGIPGLEEIHAWISLPFCCIYLVALVGNTMILVVIKTGRSLREPMFYFLAILSSVDLALSTTSVPRMLGIFWFDAHEINFGGCVAQMFLIHAL
TGMEAEVLMAMAFDRYLAICVPLHYTTILTSRVLMGISICVVVRPALFICPMIYLIYRLPFCQAHVIAHSYCEHMGIAKLSCGNIHINAVYGLFVVSLFLLNLVLIGISY
GYILRAVFRLPSHDARLKALSTCGSHVAVLCVFYIPSVFSFLTHRFGHNIPHYIHILVANLYVVIPPFLNPIIYGVRTKQIRERVLHIFTKR*
105 >lcl|NP_001000137.1|Plus13579935..3580918 NW_047562 olfactory receptor Olr84 Olr84 __SEG__ Chr1 {Rattus norvegicus} MKRKLRHLTVGMSVYNKSDVHPSTFILIGIPGLEAEHMWISIPFCMVYILALVGNSSLLFIIKTDSSLHEPMYLFLCMLAVADLVVCTTAVPKLLSVFWFHDGEIRFEAC
LTQIFLIHSCSTMESGFFLAMAFDRYIAICNPLRHSAILTRTLTGGIGLAVVLRGIALLSPHPFLLRWLPYCKTNIISHTYCEFMALIKIACAETSIRRAYSLIVAFLTG
GVDFILIICSYVLILNTVFHLPSKDARLKTLGTCGSHVCVILVSYTPAFFSFLTHRFGHKVAPQVHIFVANIYLLVPPMVNPIIYGVRTKKIRNRFLKMFRFSKLTN*
106 >lcl|NP_001000138.1|Plus13586798..3587733 NW_047562 olfactory receptor Olr85 Olr85 __SEG__ Chr1 {Rattus norvegicus} MLLSNDTQFHPSSFLLLGIPGLESHHAWIGFPFCVVYLIALLGNVTILLVIKTESSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFSFRVILFGACLTQMFFIHNFT
GMESAVLLAMAYDRYVAICNPLRYSTILTNKAVSMIGLGVLVRTFLSVIPFVFLILRLPFCGNNVIPHTYCEHMGLARLSCASIKVNIIYGLGAISILVFDIIAIAFSYA
QILCAVFRLPSREARIKSLSTCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQIYDRVKKILLQK*
107 >lcl|NP_001000139.1|Plus13685873..3686820 NW_047562 olfactory receptor Olr91 Olr91 __SEG__ Chr1 {Rattus norvegicus} MGYTNLSYLNPRTVILVGIPGLEHVQFWIGFPFFVVCLVALLGNLFLLIIVPRERSLHQPMYIFLAVLAATDLGLCLAIAPKMLAIFWFGSCSMAFDTCLTQLFFIHALQ
GMESGILLAMAFDRYVAICDPLRHPSILTPLFLLRVILMVAVRATVLVGILPVLLKRLQRFHSIVIVHSYCEHMAVVKLAAEDVTINKSYGLFVAFAILGFDMIFVFISY
FLIFQAVLHLPQKEARSKAFNTCTAHIVVFLEFYILAFFSFFSHRFGHVSPYIHILLSTIYLLLPPALNPIVYGVKTKEIRKWVVHIFVLKSNTQ*
108 >lcl|NP_001000140.1|Plus1complement(3693648..3694592) NW_047562 olfactory receptor Olr92 Olr92 __SEG__ Chr1 {Rattus norvegicus} MPSCNNSIPQPLIFILTGIPGLESSHGWFSTFFFLIFVITIIGNGTILNIIWIEKTLHEPMFLLLATLSVVDLCLVTVTVPRMLGIFWMNAKEISLEACLTQMFFIPSFY
VMESGILLAMAFDRFAAIWYPLRYTTILDRNMLVKMALAILARAVAVVTPAPILTKRLERFQTQVISYSYCAYMAVVMIACGDISNHVVYGLMVIVASVGIDLLFVILSY
TLILCAVFRIPSGQARRKALSTCGSHLCVIGLFYSPVVFSVLSQILGYHMAPYLQIIIDNLYFLVPPMVNPLIYAARTKQMRERVLRVLTCQRN*
109 >lcl|NP_001000141.1|Plus1complement(3702311..3703255) NW_047562 olfactory receptor Olr93 Olr93 __SEG__ Chr1 {Rattus norvegicus} MGPGNESQLSPSTFWLMGIPGLEHLHVWIGIPFCSMYMVALMGNVTILAVVRAERSLHEPMFLFLCMLSITDLVLSTSTLPRMLCLFWMAAHDITFDACLAQMFFIHSFT
AMESGFFLAMAIDRYVAICDPLRHATILTHSRIAVMGAVVVLRGVGFFSPHPILLKQLPYCRTRIIAHTYCEFMAVVKLACLDIGATKRYSLGAAFGIGSCDCFFIAISY
VLILRAVFRLPSREASLKALGTCGSHVCVIVVFYSTAGFTFLTHRFGHNVAPQIHILVANMYLLVPPFLNPIVYGVRTKKIRDYVLNTLKVKGS*
110 >lcl|NP_001000143.1|Plus13758849..3759796 NW_047562 olfactory receptor Olr98 Olr98 __SEG__ Chr1 {Rattus norvegicus} MVNNTTHYISFFYLVGIPGLEKFHSLISIPVCLLFVLTLLGNSIVIATIKVEPSLHQPMYFFLCMLGMNDIFLTCSTSLKMLDIFWFNEHWIEFDICLTQMYFIHMLCIF
ESAILVAMAFDRFVAICIPLHYSTILTTTMVIKLGVIGLSRAVFMVLPCPLLIKRLPYYTSYIIPHAYCEHMAVVKLASANTLINRAYGISAAFAVTILDIWLIATSYIK
ILQAVFRLSSQNARSKALGTCAAHICTILAFYTPALFSFLTHRIGKNVSPSVHIIFASLYLLVPPTVNPLVYGVKTKQIRDRVLSLFSHLKITEG*
111 >lcl|NP_001000144.1|Plus13814440..3815390 NW_047562 olfactory receptor Olr103 Olr103 __SEG__ Chr1 {Rattus norvegicus} MVNNTTHHYISFFYLVGIPGLEKFHSLISIPVCLLFVLTLLGNSIVIATIKVEPSLHQPMYFFLCMLGMNDIFLTCSTSLKMLDIFWFNEHWIEFDVCLTQMYFIHMLCI
FESAILVAMAFDRFVAICIPLHYSTILTTTMVIKLGVVGLSRAVLMAFPGPLLIKRLPYYTNYIIPHAYCEHMAVVKLASANTLINRAYGISVAFSVTILDIWLIATSYI
KILQAVFRLSSQNARSKALGTCAAHVCTILAFYTPALFSFLTHRFGKHVSPSVHIILASMYLLVPPTVNPLVYGVKTKQIRDRVLSLFSHLKTTEG*
112 >lcl|NP_001000145.1|Plus1complement(3825632..3826591) NW_047562 olfactory receptor Olr104 Olr104 __SEG__ Chr1 {Rattus norvegicus} MSYSNLTSPSFFLIGLPGLEAVYIWLSIPLCTMYFASLAGNSLILWVVKSEPSLHQPMYYFLSMLAVTDLGLSASTMPTMLTIYMLGVSEVPLDMCFAQLFFIHTFSIME
SSVLLTMAFDRVVAISRPLHYATILTNPRVASLGVVILVRSIGLHIPAPIMLKKLPYCQKHHLSHSYCLHPDVMKLACTDTQINSAYGLFVVLSTLGVDSLLIVLSYGLI
LHTVLSIASKTERLKALNTCVSHICSVLLFYTPMIGLSMIHRFGKWASPCSRVLLSYLHFLTPPVLNPVVYTIKTKQIRQRIWRIFWSGGGSTGHIQGH*
113 >lcl|NP_001000146.1|Plus1complement(3839510..3840457) NW_047562 olfactory receptor Olr105 Olr105 __SEG__ Chr1 {Rattus norvegicus} MAVSKHSNASSFFFILMDLPGLETSHCWTAIPICLIYILSVLGNIIIMHIVKSVPSLHTPMYLFLSMLSMADLGLSASTLPSMVAVFLLGQRLIGAAACFMQLFFIHTFS
VIESAILLAMAFDRCVAIREPLRYATILTTRRIGAIGLAVVVRSAALHLPLPVLLGRLAFQPVSALSHSYCVHPDVLRLSCSSTVVNSGFGLFVMLSTLGMDAVLILLSY
VLILKTVLSIASNAERLKAFNTCISHICAVLLFYTPLVSLSMIHRFGRKKLPAQVYMLLSYLHFLMPPMLNPIVYSVKTKEIRVRILKMLHPKKH*
114 >lcl|NP_001000147.1|Plus1complement(3850049..3851020) NW_047562 olfactory receptor Olr106 Olr106 __SEG__ Chr1 {Rattus norvegicus} MLHINITNSIFSASLVTGIPGLETVYIWVSIPFCAMFLITIVGNMTIIIVIWHEQTLHVPMYLILAMLASSDLGLSLFTFPTLLRIFLLNAREVTASACFTQMFFIHTFQ
VLESAIILAMAFDRYMAISRPLHYHSILTDTVISRIGLSIVVRTLVVQVPLPILLRRLYFCHSNVLSHSYRLHPDIIKLSCSSTSVNSIFGLFVVLSTVGLDFLLILLSY
VLILKTVLCMASHSGRLKALNTCISHLCAVVLFFTPMICLSMLHRFGPRLPSHVYVTLANMHFLIPPVMNPIVYVVKTKQIRDKIQKLFIKKATEKARVSPIT*
115 >lcl|NP_001000148.1|Plus13862500..3863453 NW_047562 olfactory receptor Olr107 Olr107 __SEG__ Chr1 {Rattus norvegicus} MSDLNATLNCPTFSFIGIPGLEAAHMWISIPFCLLYLVALGGNVLLLLLVRAEQNLHEPQFYFLAMLALTDLGLSLSTMPSVLAIFWFDIHDVGLDACLTQMFFIHTLSS
VESGVLVAMAFDRLVAICAPLTYTRILNHHTVVCLSGAALIRGATLLAPLPFFLRTFPFCGANILSHSYCYYPDMLNLACGDVTFSSVYGLVCVLCTFAVDAIFILVSYM
KILGTVMKLGIQDRNWKSLQTCVCHLCTVLVFYLPLISLAVLHRYTQETSPILYTTMSNAYLLMTPLLNPLVYSLKSRQIQAALRKRFGVQRVVAGE*
116 >lcl|NP_001000149.1|Plus13879663..3880604 NW_047562 olfactory receptor Olr108 Olr108 __SEG__ Chr1 {Rattus norvegicus} MSEFNTTFQPYVFILTGLRGLVGARLWLGPLLSLMYITTLAGNCTVIYLVRTERSLQEPQYHFLSMLAGADIVLSVSTLFSVLKVFIFDFYEIAFDSCLAQLFFIHASSS
MGSGILLAMAFDRFVAISHPLQYTTILTSSRVTKMGLAAFLRGVALMMPLPILLKRLPFCKGQMLSYSYCIHPNVMKLACGQVKINIFYGLVLVIFSFGVDFLLIAISYA
LIFQAVMGIASREGQMKALNTCLSHIFIVFIYYGPLLAITVMHRISHRSSPVAHAVLGNIYLFMPPMFNPIVYSLKTKQIRSALRKSLKIQRR*
117 >lcl|NP_001000150.1|Plus13940327..3941289 NW_047562 olfactory receptor Olr112 Olr112 __SEG__ Chr1 {Rattus norvegicus} MTSSTSLNHTNLRDIWYTMTGIPGLEDVHIWLSIPIFCMYIVAVVGNTFLILLISTERSLHEPMYFFLSMLALADIFLSTVTIPKVLAIFWFQAGGISFASCVSQMFFLH
FIFVTESGILLSMAFDRYVAICYPLRYTTILTPSVIIKMGIASVTRSFFICFPLIFLVYRLTYCGRNIIHHSYCEHMGIARLACDSIKVNIYYGLVVALFSICLDVVLII
VSYALILCSVYKIPSQDARLKALSTCGSHVCVILLFYTPVFFSSLAHRFGGDSIPLHVHILLANLYVVLPPSLNPIIYGVKTKQIQEKVVQFFSMNKVIC*
118 >lcl|NP_001000151.1|Plus1complement(3949768..3950709) NW_047562 olfactory receptor Olr113 Olr113 __SEG__ Chr1 {Rattus norvegicus} MSALSVTNFTSSKFALTGFPGLEIYYFWLSVPFSIIYVTVFLGNCMILHVIRTELSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWGLIQEISLDACIAQSYFIHGLS
FMESSVLLAMSFDRYIAICNPLRYSSILTNDRIIKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSFCLHQDLIRMACGDIRFNSIYGLALVISNLLLDSVLILMSY
IMILYTVLSIASREERIKSLQTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNVYILFPPLMNPIIYSIKTQQIRLRIQRLFLKGT*
119 >lcl|NP_001000152.1|Plus1complement(3972305..3973258) NW_047562 olfactory receptor Olr115 Olr115 __SEG__ Chr1 {Rattus norvegicus} MVENVTHEHIASFFLVGIPGLENVHCWIGIPVCLLFVLTLLGNSIIIATIKLEPSLHQPMYFFLCMLATNDMCLASSAALKMLAIFWFDAHWINFDACLTQMYFIHTLCI
MESAILVAMAFDRFVAICVPLHYASILTTSMVTKLGLVGLIRGMLMVLPCPVLIKRLPYYTKYVIPHAYCEHMAVVKLASGNTLINRAYGISVALSVITVDLGLIATSYV
KILQSVFRLSSQNARSKALGTCAAHVCTILVSYTPALFSFLSHRIGKKVPPSVHIIFASMYLLVPSAVNPVVYGVKTKQIRDRVIDLFFTHKKFPEK*
120 >lcl|NP_001000153.1|Plus1complement(4042083..4043036) NW_047562 olfactory receptor Olr119 Olr119 __SEG__ Chr1 {Rattus norvegicus} MPVIWLNTSSCPFLLTGFPSLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPMYYFLGMLAATDLGVTLTTMPTVLGVLWLNHREIGHGACFSQAYFIHTLSI
VESGVLLAMAYDRFVAIRNPLRYTTILTDTRVIKIGIGVVMRAGLSIMPIIIRLHWFPYCQSHVLSHAFCLHQDVIKLACADITFNRLYPVVVVFCMGLLDFLVICFSYF
LILKTVMSIASTDERTKALNTCVSHICCILVFYGTEVGLTFIHRFGKNIPHIVHITVSYICFLFPPFMNPVIFSIKTKQIQISLLRLFSPPYSRTQP*
121 >lcl|NP_001000154.1|Plus1complement(4050015..4050959) NW_047562 olfactory receptor Olr120 Olr120 __SEG__ Chr1 {Rattus norvegicus} MSLFLMSNLSTSRFVLTGFPGLEVYYILFAIPFSVIYAMVFLGNCMILHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWSFLQEISLDACIAQSYFIHGLS
FMESSVLLAMSFDCYIAICNPLRYSSILTNDRIIKIGVAILCRSSMLIPPVIIRLKFLNYCRPHFLSHSFCLHQDLIRLSCSDIRFNSFYALSLVICTLLLDAVLILASY
VMILHTVLSIASREERIKSLQTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVQVLMGNIYILFPPLMNPIIYSIKTQQIRVRIQRLFSLNGT*
122 >lcl|NP_001000155.1|Plus1complement(4066595..4067548) NW_047562 olfactory receptor Olr121 Olr121 __SEG__ Chr1 {Rattus norvegicus} MAGNATCQHIASFFLVGIPGLENVHCWIGIPVCLLFVLTLLGNSIIIATVKLEPSLHQPMYFFLCMLASNDMCLASSAALKMLAIFWFDAHWINFDACLTQMYFIHTLCI
MESAILVAMAFDRFVAICVPLHYASILTTSIVTKLGLVGLIRGMLMVLPCPVLIKRLPYYTQYVIPHAYCEHMAVVKLASGNTLINRAYGISVVLSVIIVDIGMIGTSYV
KILQSVFWLSSQNACSKALGTCAAHVCTILASYTPALFSFLTHRIGRNVPPSVHICIASVYLLVPSAVNPVVYGVKTKQIRDRVIDLFFTHKKFPEK*
123 >lcl|NP_001000156.1|Plus14077824..4078774 NW_047562 olfactory receptor Olr122 Olr122 __SEG__ Chr1 {Rattus norvegicus} MPHPNSTIFRPSVLTLTGIPGLESVQFWIGIPFCIMYIIALLGNSLLLVVIKVERSLHEPMYLFLAMLGATDIALSTCILPKMLGIFWFHLPTIYFDACLLQMWLIHTFQ
CIESGILFAMAMDRYVAICDPLRHASVFTQRLLTQIAVGVTLRAALFVAPCLILIKCRLRLYWTTVVSHSYCEHMAIVKLAAEDIRVNKIYGLFVAFSILGLDIIFITLS
YIRIFITVFRLPQKEARFKAFNTCIAHICVFLEFYLLAFFSFFTHRFGFHIPSYIHILLSNLYLLVPPLLNAIVYGVKTKQIRDQVSKILYCNYSS*
124 >lcl|NP_001000157.1|Plus1complement(4100277..4101224) NW_047562 olfactory receptor Olr124 Olr124 __SEG__ Chr1 {Rattus norvegicus} MAGNASHQIASFFLVGIPGLENFHCWIGIPVCLLFVLTLLGNSIIIATVKLESSLHQPMYFFLCILAMNDMCLTCSTALKMLNIFWFDAHWIDFDACLTQMFFIHTLCIM
ESAILVAMAFDRFVAICIPLRYASILTTPMVIKIGLVGLSRAILLIMPCPLLVKRLLYYTKYVIHHAYCEHMAVVKMASGNTQVNRIYGILVALSVTVFDLGLIATSYIK
ILQAVFQLSSQSARSKALGTCVAHMCTILAFYTPALFSFLTHRFGKNVPPSIHIIFAILYLLVSPTVNPLVYGVKTKQIRDRVVSLFFFSQKQKF*
125 >lcl|NP_001000158.1|Plus1complement(4130238..4131188) NW_047562 olfactory receptor Olr126 Olr126 __SEG__ Chr1 {Rattus norvegicus} MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIPMYIFLAILAVTDIVLSTCILPKMLGIFWFHMPQISFDACLLQMELIHSFQ
ATESGILLAMALDRYVAICNPLRHATIFSPQLTTCLGAGVLLRSLILTFPMILLIKCRLEYYRTTVISHSYCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFS
YVRIFITVFQLPQKEARLKAFNTCIAHICVFLQFYLLGFFSFFTHRFGAHIPSYVHILLSDLYLLVPPFLNPIVYGVKTKQIRDQVFKMLFSKKPL*
126 >lcl|NP_001000159.1|Plus1complement(4175582..4176544) NW_047562 olfactory receptor Olr128 Olr128 __SEG__ Chr1 {Rattus norvegicus} MKVVSFFHNHTNPQDVWYVLIGIPGLEDLHTWIAIPICSMYIVAVIGNVLLIFLIMTERSLHEPMYFFLSMLALADLLLSTATAPKMLAVFWLHSRGISFGSCVTQMFFI
HFIFVAESAILLAMAFDRYVAICYPLRYTTILTSSVIGKIGTAAVARSFLICGPFIFLVYRLLYCGRYIIPHSYCEHMGIARLACDDITVNIIYGLTMALLSTGLDIVLI
IISYTMILRTVFQIPSWAARYKALNTCGSHICVILLFYTPAFFSFFAHRFGGKTIPRHIHILVANLYVVVPPMLNPIIYGVKTKHIQDRVVFLFSSVSTC*
127 >lcl|NP_001000160.1|Plus14381036..4381989 NW_047562 olfactory receptor Olr136 Olr136 __SEG__ Chr1 {Rattus norvegicus} MKNSSSSVGFLPTTFILVGIPGLETEHIWISIPFCLMYIIIFLGNGTILHVIRTEASLHQPMYLFLAILALAEVGVSASTLPTVLGLFLFDTTEITFEACLLQMFFIHSF
SIMESAVLLAMSVDRFVAIYSPLRYTAILTLPRIFRTGAIIGLKSVILMAPLPVLLRRLPFCGHNALSHSYCLHPNLIHLPCGDISINNIYGLFVVTSTFGIDSLLIVVS
YGLILHTVLGITTGDGRKKALNTCGSHICAVLAYYVPMIGLSMVHRFAHHVSPLLQTMMANAYLFFPPVINPIVYSIKTKEIRRVIIRMLSEKKFRV*
128 >lcl|NP_001000161.1|Plus14435435..4436382 NW_047562 olfactory receptor Olr139 Olr139 __SEG__ Chr1 {Rattus norvegicus} MSEVTNTTHDPFYFILTGIPGFEAIHLWISIPFFCLYTISIMGNTTILTVIRTEPSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQLFFLHGFS
FMESSVLLAMSFDRYVAICRPLHYASILTSEVIGRIGFAIICRCVLAVLPSLFLLKRLPFCHSHLLSHSYCLHQDMIHLVCADIRVNRWYGFALVLLIIVLDPLLIVLSY
ALILKSVLNTATWADRLRALNNCLSHILAVLVLYVPMVGVSMTHRFAKHVSPLVHVLMANIYLLAPPVMNPIIYSAKTKQIRQGITRLLLQRKVH*
129 >lcl|NP_001000162.1|Plus14461454..4462401 NW_047562 olfactory receptor Olr140 Olr140 __SEG__ Chr1 {Rattus norvegicus} MSEVTNTTHDPFYFILTGIPGFEAIHLWISIPFFCLYTISIMGNTTILTVIRTEPSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQFFFLHGFS
FMESSVLLAMSFDRYVAICRPLHYASILTSEVIGRIGLAIICRCVLAVLPSLFLLKRLPFCHSHLLSHSYCLHQDMIHLVCADIRVNSWYGFALVLLIIVLDPLLIVLSY
ALILKSIFNTATWADRLRALNNCLSHILAVLVLYVPMVGVSMTHRFAKHASPLVHVLMANIYLLAPPVMNPIIYSAKTKQIRQGITHLLFQRKVH*
130 >lcl|NP_001000163.1|Plus14492974..4493912 NW_047562 olfactory receptor Olr143 Olr143 __SEG__ Chr1 {Rattus norvegicus} MALFNVTRPASFLLTGIPGLESLHPWLAVPLCVMYAVALGANTVILQAVRVEPSLHAPMYYFLSMLSFSDVAMSMATLPTVLRTFCLDARSIAFEACLVQMFLIHSFSMM
ESGILLAMSFDRYVAICDPLHYATVLTNEFIAGMGLAVTARSFITLFPLPFLIKRLPICRSNVLSHSYCLHPDMMKLACADITINSIYGLFVLVSTFGMDLLFIFLSYVL
ILRSVMAIASHEERLKALNTCVSHILAVLAFYVPMIGVSTVHRFGKHAPRYIHVLMSNIYLFVPPVLNPLIYSAKTKDIRRAIFRMFHRIKL*
131 >lcl|NP_001000164.1|Plus1complement(4500044..4500988) NW_047562 olfactory receptor Olr144 Olr144 __SEG__ Chr1 {Rattus norvegicus} MRSFHTNTSSTSSFILTGFPEMESLEHWLAALLLLLYVISIVGNALILFIIKEEQSLHQPMYYFLSLLSVNDLGVSFSTLPTVLASMCFHIPETAFDACLAQMFFIHFFS
WTESGILLAMSFDRYVAICNPLHYSSVLTDARVAHMGMSIIIRSFCMVFPLPFLLKRLPFCKANVLTHSYCLHPDLIRLPCGDTTINSMYGLFIVISAFGVDSVLILLSY
VLILRSVLAIASREERLKTLNTCVSHISAVLIFYVPMISVSMVHRFVKHAPEYVHKFTSLVYLFVPPMLNPIIYSIKTKEIRRRLHKMLLGTKF*
132 >lcl|NP_001000165.1|Plus14557698..4558669 NW_047562 olfactory receptor Olr148 Olr148 __SEG__ Chr1 {Rattus norvegicus} MHVPRRTTGSNMSDSLPVTLFLTGIPGLEFAHLWIAIPFCVMYLIALLGNAALILIIGTESALHAPMYLFLCLLSLTDLALSSTTVPKMLAILWLNANEISFGGCLAQMF
CVHSIYALESSVLLAMAFDRYVAICNPLRYTTILNHTVIAQIIFAGIVRSVAIVSPFIFLLRRLPYCSHRVMAHTYCEHMGIARLACANITVNIVYGLTVALLAMGLDSI
LIAISYGFILRAVFRLPSRDAQHKALSTCGSHLGVILVFYIPAFFSFLTHRFGHNRVPKNVHIFLANLYVLVPPVLNPIIYGARTKEIRSRLVKLFHLGKDLV*
133 >lcl|NP_001000166.1|Plus1complement(4624053..4625003) NW_047562 olfactory receptor Olr149 Olr149 __SEG__ Chr1 {Rattus norvegicus} MITYNVSSYNPGPFLLVGIPGLEQFHVWIGIPFCVIYVIAMTGNCVLLYLIVAERSLHEPMFFFLSMLALTDLILSTAGVPKTLSIFWMGAREITFPGCLTQMFFLHYSF
VLDSAILMAMAFDRYVAICSPLRYATVLTPKTIIKIAVGISFRSFCIILPDVFLLTRLPFCRTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVVLIAVSY
TLILCAVFRLPSRDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVSLTFHIMFANLYIVIPPAMNPIVYGVKTKQIRDKVILLFSVKSTEG*
134 >lcl|NP_001000167.1|Plus14821425..4822399 NW_047562 olfactory receptor Olr153 Olr153 __SEG__ Chr1 {Rattus norvegicus} MEIFNLSSFSPGFFILLGIPGLEQLHLWIGISFFIIYLVAFAGNSILLYLILTERSLHEPMFFFLSMLAGTDLILCNTCVPKTVSIFWLGPQHITFPGCLTQMFFLHFSF
AMDSAILLAMAFDRYVAICFPLRYTTILTHQIVIKIVVVIISRSFCIIFPCVFLLKRLPFCRELVIPHTYCEHIGIARLACADISINIWYGFAVPIMTVMSDLILIGISY
TVILRTVFNLPSRDARQKALSTCGSHVCVILIFYTPAIFSVLAHRFGHNIPHSFHILFANLYVAIPPAINPIIYGVKTKQIRDKINLLFFPKSTIDMTQRAWER*
135 >lcl|NP_001000168.1|Plus14849486..4850457 NW_047562 olfactory receptor Olr155 Olr155 __SEG__ Chr1 {Rattus norvegicus} MPCNSTSHPSFFILQGIPGMEDKHRWISIPFSSMYLITVMGNCTILLTISMERSLHKPMFLLLFLLALTDLGMSTTTIPKVLCIFWFGQSQISYEGCLAQLFFIHSISAM
QSSVLMTMAFDRYVAICKPLRYSTILSNSRIGLIGLAGLVRAILFILPMPILLQHMPFHANRVIPTTYCEHMAVVKMVCVDTTVNRIYGLVVAMLVVGVDISAIASSYVL
ILRAIMHLSSKEAHHKAVNTCTTHICVMLVSYTPSLFSFLTHRFGRGIPPHIHTILGNLYFLVPPMLNPIIYGVKTKEFRDKVTKYLYRRKEPIIFSHNQKLA*
136 >lcl|NP_001000169.1|Plus14875296..4876285 NW_047562 olfactory receptor Olr157 Olr157 __SEG__ Chr1 {Rattus norvegicus} MSITTGQTMDAPNHTDLDPSIFFLLGIPGLEQFHMWLSLPVCCLGTATIMGNITILVVVATEPTLHKPVYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHISASACLAQ
MFFIHAFCMMESTVLLAMAFDRYVAICHPLRYSTILTDTIIARIGVVAMMRGSLLMLPCPFLIGRLSFCQSHVIPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVD
LFCIGLSYALIAQAVFRLSSQEARSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHIHILLANVYLLFPPALNPVVYGVKTREIRERVAKVFQWGQGTRLKISK*
137 >lcl|NP_001000170.1|Plus14904508..4905473 NW_047562 olfactory receptor Olr159 Olr159 __SEG__ Chr1 {Rattus norvegicus} MSAQNNTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLHRPMYYFLAMLSLTDLVMCSSTIPKALCIFWFHLKEIGFDDCLVQMFFTHTFT
GMESGVLMLMALDRYVAICYPLRYSTILTNAIIAKIGFATFLRGVLLIIPFTFLTKRLPYCRGNIIHHTYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITVSY
TMILRAVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPTMNPVVYGVKTKQIRDCVIRILSGSKDFKAHSI*
138 >lcl|NP_001000171.1|Plus14958839..4959804 NW_047562 olfactory receptor Olr163 Olr163 __SEG__ Chr1 {Rattus norvegicus} MSAQNNTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLHRPMYYFLAMLSLTDLVICSSTIPKALCIFWFHLKEIGFDDCLVQMFFTHTFM
GMESGVLMLMALDRYVAICYPLRYSTILTNAIIAKIGFATFLRGVLLIIPFTFLTKRLPYCRGNIIHHTYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITVSY
TMILRTVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGGQTIPPSCHIIVANIYLLLPPTMNPVVYGVKTKQIRDCVIRILSGSKDFKAHSI*
139 >lcl|NP_001000172.1|Plus1complement(5029736..5030704) NW_047562 olfactory receptor Olr165 Olr165 __SEG__ Chr1 {Rattus norvegicus} MSVQNNTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLHRPMYYFLAILSLTDLVMCLSAIPKALCIFWFHQKEIGFDDCLVQMFFTHTFT
LMESGVLMLMALDRYIAICYPLRYSTILTNAIIAKIGFATYLRGALLIIPIIFVIKYLPYCRGNIINHTYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITVSY
TMILRTVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFSFFSHHFGGHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDCVIRIFQGRRISKLTVCK*
140 >lcl|NP_001000173.1|Plus1complement(5061869..5062828) NW_047562 olfactory receptor Olr167 Olr167 __SEG__ Chr1 {Rattus norvegicus} MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANTVIVSIIYQEASLHQPMYHFLGILAIVDMGLATTIMPKILAIFWFNAKAISFNECFVQMYAI
HFFVAMESGIFVCMALDRYVAICRPLQYTSIVTESFVVKATVFMAFRNCVAPMSVPVLAAQRNYCSRNQINHCFCTNLGVTSLACEDRKINSINQLLLAWTLMGSDLGLI
MVSYALILRSVLRLNSAEAASKALSTCTSHLFLIFFFYTVIIVMSITHSAKMSVPVIPVLLNVLHNVVPPALNPMLYALKNKELKQGLYKVLRLDVKGG*
141 >lcl|NP_001000174.1|Plus15096331..5097290 NW_047562 olfactory receptor Olr168 Olr168 __SEG__ Chr1 {Rattus norvegicus} MSVQNNTDLTPASFVLNGIPGLEDIHIWISFPFCSMYAVAMMGNCGLLYLIVFEDSLHRPMYYFLAMLSLTDLVICSSIIPKALCIFWFHQKEIGFDDCLVQMFFTHTFT
GVESGVLMLMALDRYIAICYPLCYSTILTNAIIAKIGIATFLRGALLIIPIIFVIKYLPYCRGNIINHTYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITVSY
TMRAVVSLSSADARQKAFSTCTAHICAIVFSYSPALFSLFSHWFGGHTFPPSCHIIVANIYLLLPPTMNPIVYGVKMKQIRDCVIRILSGSKDFKAHSI*
142 >lcl|NP_001000175.1|Plus1complement(5119678..5120643) NW_047562 olfactory receptor Olr170 Olr170 __SEG__ Chr1 {Rattus norvegicus} MSILNVSSLTPASFILNGIPGLEEVHLWISFPLFTMYSIALTGNFGLIYLIYSEEVLHRPMYIFLALLSFTDVLMCTSTVPNTLCILWFNFKEIDFKACLAQMFFVHTFT
GMESGVLMLMALDRYVAICYPLRYATILTNVVIAKAGMLTFLRGVALVIPFIFLTKRLPYCMGNVIPHTYCDHMSVAKISCGNVQINAIYGLMVALLIGGFDILCITVSY
TMILRAVVSLSSADARQKAFSTCTAHICAIVITYVPAFFTFFTHRFGRHTIPPHIHIIMANLYLLMPPTMNPIVYGVKTKQIRESVIRFLFKGGENSSHKI*
143 >lcl|NP_001000176.1|Plus15173043..5173993 NW_047562 olfactory receptor Olr171 Olr171 __SEG__ Chr1 {Rattus norvegicus} MPGVNTSSLTPRYFILNGIPGLEAAHIWISLPFCFMYLIAVTGNCGLIYLISHEEALHRPMYYFLAMLSATDVSGCNTMVPSMLCIFWFSLKEIDFNACLVQMFFIHMLT
GMESGVLTLMALDRYVAICYPLRYSSILTNTMITKIGIAALIRSVLLMIPFAFLIKRLPYCRGNLIHHTYCDHMAVAKLSCGNIKINAVYGLIAAVFIGGFDLFCIFMSY
AMIIHAVVKLSSADARHKAFSTCTSHICAIIITYVPAFFNFFTHRFGRTTIPHHIHIIIANLYLLLPPTLNPIVYGVKTKQIREGVIKMFVRQKDV*
144 >lcl|NP_001000177.1|Plus1complement(5180785..5181741) NW_047562 olfactory receptor Olr172 Olr172 __SEG__ Chr1 {Rattus norvegicus} MSRANSSSLTPEFFILNGVPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIGHEESLHRPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNFKKIEFNSCLAQMFFVHMLT
AMESGVLMLMALDRYVAICYPLRYTTILTNPVIAKAGLATFLRSVMLIFPFTLLTKRLPYCRGTLIPHTYCDHMSVAKVSCGNAKVNAIYGLMAALLIGVFDICCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPAFFTFFTHRFGGHTIPHHIHIIVANLYLLLPPTMNPIVYGVKTKQIRESVIKFLLGDKLGIN*
145 >lcl|NP_001000178.1|Plus1complement(5235651..5236607) NW_047562 olfactory receptor Olr176 Olr176 __SEG__ Chr1 {Rattus norvegicus} MSGSNSSSLIPEFFILNGVPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIGHEEALHRPMYYFLALLSFTDVTWCTTTVPNMLCIFWFNFKKIGFNSCLVQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYTSILTNPVIAKAGLATFMRSVMLIFPFTLLTKRLPYCRGTLIPHTYCDHMSVAKVSCGNAKVNAIYGLMVALLIGVFDICCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPAFFTFFTHRFGGNTIPHHIHIIVANLYLLLPPTMNPIVYGVKTKQIRESVIKFLLGDKISNT*
146 >lcl|NP_001000179.1|Plus15290725..5291663 NW_047562 olfactory receptor Olr178 Olr178 __SEG__ Chr1 {Rattus norvegicus} MSGSNGTKFHPSFFVLLGVPGLERMHLWIGFPFGFVYLIALVGNIIILFVIKNEHSLHQPMFYFLAMLSSIDLGLSTSTIPKMLGIFWFNLREISFGGCVTQMFFIHIFT
AMETVVLVAMAFDRYVAICNPLRYSQILTNRTIGLILVVVFGVNFILVIPLVFLILRLPFCGHHIIPHTYCEHMGIARLACANIKVNMIFGLILISMVFADVLLIAISYI
LILRAVFSLPSRDARLKALNTCGSHICVILAFFTPAFFSFMTHRFGRNVPAYIHILLANLYVVVPPALNPVIYGVRTKQIREQVLSIFWKKS*
147 >lcl|NP_001000180.1|Plus1complement(5349048..5349998) NW_047562 olfactory receptor Olr180 Olr180 __SEG__ Chr1 {Rattus norvegicus} MTERMSLSNDTQAHPSSFLLLGIPGLEDAHIWIGFPFCFLYLIAILGNVAILFVIQTEHSLHEPMYYFLAMLDSIDLGLTTATIPKMLGIFWFNLREISFGGCLSQMFFI
HFFTVMESITLLVMGFDRYIGICKPLQYTVILTTKIIGVIAGIAVLRSLYIVVPLVFLLLRLPYCGHHIIPHTYCEHMGIARLACASIRVNIMFGLSNIALLLLDVVLII
LSYVRILYAVFCLPSREARLKALNTCGSHIAVLTFFTPAFFSFLTHGFGYNVPQYIHIFLANLYVVFPPALNPLIYGVRTKQIRARVMRIFFQKDD*
148 >lcl|NP_001000181.1|Plus1complement(5392252..5393193) NW_047562 olfactory receptor Olr183 Olr183 __SEG__ Chr1 {Rattus norvegicus} MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLIAVLGNVILLFVVHLEHSLHQPMFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFT
GIETFMLVAMAFDRYIAICNPLRYNTILTNRVICIIAGIGLFRNFILVFPLIFLILRLSFCEHNVIPHTYCEHMGIARLACVSIKVNVLFGLLLISMILLDVILIALSYV
KILHAVFKLPSWEARLKALNTCGSHVCVILAFFTPALFSFLTHRFGHNIPRYIHILLANLYVIIPPALNPIIYGVRTKQIRDRAVMTLFCKEV*
149 >lcl|NP_001000182.1|Plus1complement(5403304..5404257) NW_047562 olfactory receptor Olr184 Olr184 __SEG__ Chr1 {Rattus norvegicus} MTERMSLSNDTQAHPSSFLLLGIPGLEDAHVWIGFPFCFLYLIAILGNAAILFVIQTEHSLHEPMYYFLAMLDSIDLGLTTATIPKMLGIFWFDLREISFGGCLSQMFFI
HFFTVMESITLLVMGFDRYIAICKPLQYTVILTTKVIVVIAGIAVLRSLYMVVPLVFLLLRLPYCGHHIIPHTYCEHMGIARLACASIRVNIMFGLSNIALLLLDVVLII
LSYVRILYAVFCLPSREARLKALNTCGSHIGVILTFFTPAFFSFLTHRFGHNVPQYIHIFLANLYVVVPPALNPLIYGVRTKQIRERVMRLFFQKGN*
150 >lcl|NP_001000183.1|Plus15413162..5414115 NW_047562 olfactory receptor Olr185 Olr185 __SEG__ Chr1 {Rattus norvegicus} MPSINLQQNVLSNVTEAHPLSFLLLGIPGLEATQFWLGFPFSVVYLIALVGNIIILFVIWTDRTLHQPMFYFLAMLSVVDLSLSTATIPKMLSIFWFRLQELCFGCCVAQ
VFFIHFFTVMESIVLLAMGFDRYVAICNPLRYTTILTNRVIGVIAALVVIRSLCMIVPIIFLLLRLPYCGHRIIPHTYCEHMGVARLACASIRANVYFGLGNISILFLDV
LLIIVSYARILYAVFHLPSQDARVKALNTCSSHICVILAFFGPALFSFLTHRFGHNIPQYIHILLANLYVVIPPALNPVIYGIRTKQIQQRVKSLFV*
151 >lcl|NP_001000184.1|Plus15452563..5453504 NW_047562 olfactory receptor Olr189 Olr189 __SEG__ Chr1 {Rattus norvegicus} MLHSNKTQFHPSSFLLIGIPGLEDLHLWIGFPFFAAYLIAVLGNTIILFVIQTEHSLHQPMFYFLAMLACTDLGLSTATIPKMLGIFWFNLGEITFGACITQMYTIHLCT
GLESVVLTVMAIDRYVAICNPLRYSMILTNKVIAILGVLIIVRTLVFVTPFIFLIFRLPFCGVRIVPHTYCEHMGLAKLACANIRVNVIYGLVAFSVGYIDLSVIGFSYI
RILQAVFRLPSWDARLKALSTCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQIRERVVRMLNPKMH*
152 >lcl|NP_001000185.1|Plus15466840..5467787 NW_047562 olfactory receptor Olr190 Olr190 __SEG__ Chr1 {Rattus norvegicus} MTAHRNDTTSTGVSDFLLNCFVRSPSWQLWLSLPLSLLFLLAMGANAILLITIRMEASLHEPMYYLLSLLSMLDIVLCLTVIPKVLAIFWFDLRPIGFSTCFLQMYIMNS
FLAMESCTFMIMAFDRYIAICHPLRYPSIITDQFVVKAATFILVRNVLIPLPIPILSARLHYCGRNVIENCICANMSVSRLSCSDVTVNRLYQFAGGWTLLGSDLILIFL
SYTLILRAVLRLKAEGAVAKALSTCGSHFILILFFSTILLVFILTHVAKRKVSSDVPILLNILHHVIPAALNPIVYGVRTQEIKQGIKRLLKKGW*
153 >lcl|NP_001000186.1|Plus1complement(5505286..5506227) NW_047562 olfactory receptor Olr193 Olr193 __SEG__ Chr1 {Rattus norvegicus} MALSNNNSEAPTPEFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRMEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDHKSIGFSACFLQMFVMNSF
LTMESCTFMVMAYDRYVAICKPLQYPSIITDQFVVRAAIFIISRNALFSLPVPILSARLRYCAHNIIKNCICTNLSVSKLSCDDITFNKLYQLVAGWTLLGSDLILIVLS
YSFIFRVVLRIKAEGAVAKALSTCGSHFILILFFSTVLLVLVITNLARERIPPDVPILLNILHHLIPPALNPIVYGVRTREIKQGIQNLLRRW*
154 >lcl|NP_001000187.1|Plus1complement(5575882..5576832) NW_047562 olfactory receptor Olr196 Olr196 __SEG__ Chr1 {Rattus norvegicus} MALSNSSWRQPQPPFFLVGVPGLEESQHWIALPLGVLYLLALVGNVTIIFIIWTDSSLHQPMYLFLAMLAAIDLVLASSTAPKALTVLLAHAHEIGYIVCLTQMFFIHAF
SSMESGILVAMALDRYVAICHPLHHSTILHPGIIGRIGMVVLVRGLVLLVPFPILLQKVVFCRATVISHAYCEHMAVVKLACSETTVNRAYGLSVALLVVGLDVLAISIS
YALILQAVLKVPGGEARLKAFSTCGSHVCVILIFYVPGMFSFLTHRFGHHVPHHVHVLLATLYLLVPPALNPLVYGVKTRQIRQRVLRVFYTKASS*
155 >lcl|NP_001000188.1|Plus1complement(5596079..5597032) NW_047562 olfactory receptor Olr197 Olr197 __SEG__ Chr1 {Rattus norvegicus} MTFSNNSLLLPHTFFLTGIPGLTAAHVWISLPFCFMFVLSLTGNAVLLSLIWKEHRLHQPMFLFLAMLSFVDLVLSLSTLPKMLAIFWFGATAISSYACLSQMFLIHAFS
AMESGVLVAMALDRFVAICNPLHYATILTLEVVAKIGGLVALRGVGLTIFFPSLACRLSFCASHTIAYTYCEHMSVVKLACGATTVDSLYAFAVAIFLGVGDVAFIAYSY
GQIVKTVMRFPSPEARGKAGSTCTAHVCVILFFYGPGFLSVVMQRFGPSTASAAKVILANLYLLFPPALDPIVYGIKTKQIRECLLTIIGSKKIEPS*
156 >lcl|NP_001000190.1|Plus1complement(5679412..5680356) NW_047562 olfactory receptor Olr201 Olr201 __SEG__ Chr1 {Rattus norvegicus} MLGANFTIIHPAVFILLGIPGLEQYHTWLAIPFCLMYIAAVLGNGALILVPSEHTLHEPMYVFLSMLAGTDILLSTSTVPKALAIFWFHAGEIPFDACIAQMFFIHVAFV
AESGILLAMAFDRYVAICTPLRYSAVLTPMTIGKMTLAIWGRSIGTIFPIVFLLKRLSYCRTNVIPHSYCEHIGVARLACADITVNIWYGFSVPMASVLVDVALIGISYT
LILQAVFRLPSQDARHKALNTCGSHIGVILLFFIPSFFTFLTHRFGKNIPHHVHILLANLYVLVPPMLNPIIYGAKTKQIRDSMTHMLSVMWKS*
157 >lcl|NP_001000191.1|Plus16386200..6387147 NW_047562 olfactory receptor Olr203 Olr203 __SEG__ Chr1 {Rattus norvegicus} MEVCNSTLGSGFILVGVLDDSSFPELLCATITALYFLALTSNGLLLMVITMDARLHVPMYLLLWQLSLMDLLQPSVIIPKAIIDFLLKDNTISFGGCALQMFLALTLGSA
EDLLLSFMAYDRYVAICHPLNYRILMSQKVCWVMIATSWILASLSALGYSMYTMRYPFCKSRQIRHLFCEIPPLLKLACGDTSTYELMVYLMGVTLLFPALAAILTSYLL
ILLTVLHMPSNEGRKKALVTCSSHLTVVGMWYGGAIFMYILPSSFHSPKQDNISSVFYMIVTPALNPLIYSLRNNEVTEALRRVLGKRLPVKSTF*
158 >lcl|NP_001000192.1|Plus1complement(6443309..6444256) NW_047562 olfactory receptor Olr204 Olr204 __SEG__ Chr1 {Rattus norvegicus} MELWNSTLGSGFILVGILDGSGSPELLCATITALYFLALTSNGLLLLVITMDARLHVPMYLLLGQLSLMDLLLTSVITPKAVVDFLLKDNTISFGGCALQMFLELALGSA
EDLLLAFMAYDRYVAICQPLNYTILMSHKVCWLMIATSWILASLSALGYSIYTMQYSFCKSRMINHLFCEIPPLLKLACTDTSRYELMVYLMGVIALLLPLAAILASYSL
ILFTVLHMPSNESRKKALVTCSSHLTVVGMWYGGASFMYVLPSPFHTAKQDNISSVFYTIVTPALNPLIYSLRNKEVTGALKRVLRKRLSTQPNL*
159 >lcl|NP_001000193.1|Plus1complement(6502229..6503176) NW_047562 olfactory receptor Olr206 Olr206 __SEG__ Chr1 {Rattus norvegicus} MELWNSTLGSGFILVGILDGSGSPELLCATITALYFLALTSNGLLLLVITMDARLHVPMYLLLGQLSLMDLLLTSVITPKAVVDFLLKDNTISFGGCALQMFLELALGTA
EDLLLAFMAYDRYVAICQPLNYTILMSHKVCWLMIATSWILASLSALGYSIYTMQYSFCKSRMVNHLFCEIPPLLKLACADTSRYELMVYLMGVIALLLPLAAILASYSL
ILFTVLHMPSNESRKKALVTCSSHLTVVGMWYGGASFMYVLPSPFHTAKQDNISSVFYTIVTPALNPLIYSLRNKEVTGALKRVLRKRLSTQPNL*
160 >lcl|NP_001000194.1|Plus1complement(6537705..6538655) NW_047562 olfactory receptor Olr208 Olr208 __SEG__ Chr1 {Rattus norvegicus} MELWNSTLGSGFILVGILDDSGSPELLCATFTALYMLAMISNGLLLLVITMDPQLHVPMYLLLWQLSLMDLLLTSVITPKAVIDFLLKDNTISFGGCALQMFLELTLGGA
EDLLLAFMAYDRYVAICHPLNYMIFMKPRICWLGVFISWALASLSAVGYTIYTMQYPFCKSRKIKHLFCEIPPLLKLACADTSTYELMVYVMGVIFLLLPLAAILSSYTL
ILLTVLHMNSHEGRKKALVTCSSHLTVVGMWYGGASFMYVLPSSFHTPKQDNIFSVFYTIVTPALNPLIYSLRNREVTGALKRLLGGRLLPEHCTF*
161 >lcl|NP_001000195.1|Plus16592367..6593317 NW_047562 olfactory receptor Olr210 Olr210 __SEG__ Chr1 {Rattus norvegicus} MKPYNSTLGSGFILEGILDGSGSPELLCAIVASLYMLALTSNGLLLLVITVDARLHVPMYLLLRQLSLIDLLFTSVVTPKTVVDFLLRNNNISFEGCALQLFSAMTLGGA
EDLLLAFMAYDRYVAICRPLDYMIFMSPKACWLIVATSWILASLSALGHTVYTMHFPFCMSQVIRHLLCEVPPLLKLACADTSQYELMVYVTGVTFLLLPLSAIVASYSL
ILFTVLHMPSNEGRKKAFVTCSSHLTVVGMFYGGATFMYVLPSSFHSPKQDNIISVFYTIITPALNPLIYSLRNREVIGAFKRVLGRRILPAHSTL*
162 >lcl|NP_001000196.1|Plus1complement(6596734..6597660) NW_047562 olfactory receptor Olr211 Olr211 __SEG__ Chr1 {Rattus norvegicus} MGGRNKTYIVEFILLGLSENPKVQILLFCIFLVIYFLSVFGNLLIIILIHIDSRLHTPMYFFLKNLSFADLCFSTSIVPQMLVHFLSKKKTISFIGCSIQIVVFLLAGCT
ECALLAVMSYDRYAAVCKPLHYSTIMTQRLCFQLAVVSWVSGALACSVDSAFTLYIPYRGQNVINHYFCEPPALLKLASADTYNAEMALFLVGVIILLAPVSLILVSYGN
IISTVIRMQSKEGRLKVFSTCGSHLTVVVFYYGSGIFAYMRPNSKTMSEKDKVVSVFYSVMTSMLNPIIYSLRNKDVKGALGKLVGRL*
163 >lcl|NP_001000197.1|Plus16660970..6661920 NW_047562 olfactory receptor Olr214 Olr214 __SEG__ Chr1 {Rattus norvegicus} MEFRNSTLGSDFILVGILDDSGSPDLLCATIIALYLLAITSNGVLLLVITMDARLHVPMYLLLGQLSLMDLLLTSVITPKAVMDFLLKDNTISFEGCAFQMFLELALGSA
EDLLLAFMAYDRYVAICHPLNYMIFMRPSVCWFIVGTTWFLASVIALGLTIYTMQYPFCQSRQIKHLFCEIPPLLKLACADTSTYELMVYLAGVSMLILPLAVILASYIR
ILFTVLRMPSNEGRKKALVTCSSHLIVVGMWYGGSSLMYVLPSQFHSPKQDNILSIFYTVVTPALNPLIYSLRNKEVTGALRRIFGRRLQPAKSTF*
164 >lcl|NP_001000198.1|Plus16684665..6685612 NW_047562 olfactory receptor Olr215 Olr215 __SEG__ Chr1 {Rattus norvegicus} MEVCNSTLGSGFILVGILDDSDFPQLICATITTLYFLAMTSNGLLLLVITMDAQLHVPMYLLLWQLSLMDLLLTSVITPKAVIDFLLKDNTISFGGCALQMFLALTLGTA
EDLLLSFMAYDRYIAICHPLNYTILMSQKVCWVMIATSWILASLSALGYSMYTMQYPFCKSRQIRHLFCEIPPLLKLACADTSTYKLMVYLMGVTLLFPALAAILASYTL
ILLTVLHMPSNEGRKKALVTCSSHLTVVGMWYGGAIVMYVLPSSFHSPKQDNISSVFYTIFTPALNPLIYSLRNKEVTGALRRVFGKKLSVQSTF*
165 >lcl|NP_001000199.1|Plus1complement(6712035..6712985) NW_047562 olfactory receptor Olr217 Olr217 __SEG__ Chr1 {Rattus norvegicus} MELWNFTLGSDFILVGILDDSGSPELLCATFTALYILALISNGLLIMVITMDARLQVPMYFLLGQLSLMDLLFTSVVTPKAVIDFLLGDNTISFEGCALQMFLALTLGGA
EDLLLAFMAYDRYVAICHPLNYMIFMRPRICWLMVATSWILASLMALGYTAYTMQYPYCKSRMIRHLLCEIPPLLKLACADTSTYELMVYVMGVTFLIPPLAVILASYSL
ILFTVLHMPSNEGRKKALITCSSHLTVVGMFYGAATVMYVLPSSSHGPRQDNIISVFYTIVTPALNPLIYSLRNKEVVGALIRVLGRYILPAHPTL*
166 >lcl|NP_001000200.1|Plus1complement(6789488..6790411) NW_047562 olfactory receptor Olr221 Olr221 __SEG__ Chr1 {Rattus norvegicus} MGEHNRTSVTEFILLGLSQDPQTQVLLFFLFLLIYLLTVLGNLLIIVLIHSDPRLHTPMYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKAISFAGCSIQLVMLLLVGCT
DCALLAVMSYDRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGVLVSLVDATFTLRLPYRGNNVINHFFCEPPALLKLASADTYSTEMAIFAMGVVILLAPVSLILISYWN
IVSTVIQMQAGEGRLKVFSTCGSHLIVVGLFYGSAIFAYMRPNSKIMNERDKMISVFYSAVTPMLNPIIYSLRNKDVKGALRRIMSR*
167 >lcl|NP_001000201.1|Plus1complement(6816128..6817060) NW_047562 olfactory receptor Olr222 Olr222 __SEG__ Chr1 {Rattus norvegicus} MGKLNDTYLTEFILLGLSSDHQTQILLFVVFLIIYLITVFGNLLIILLIHVDSRLHTPMYFFLKILSLNDLCFSTTIVPKMLVHFLGVRKTISFAGCSMQMFFFLIMGCT
ESSLLAVMSYDRYVAVCKPLHYSTIMTQRVCVLLVVGSWASGIFVSVIDTSFTLCLPYQGPNLINHYFCEPPALLKLASEETYTAEMVIFAMGIIILLGPVSLILFSYWN
IISTVVQIHSSEGRLKVFSTCSSHFIVVIFFYGSTIFTYMQPNSKKMNERDKVISVFYSVVTSMMNPFMYSLRNKDVKEALKKVLKIEIG*
168 >lcl|NP_001000202.1|Plus1complement(6834813..6835763) NW_047562 olfactory receptor Olr223 Olr223 __SEG__ Chr1 {Rattus norvegicus} MENITSISEFILMGFPTAPWLQILLFFIFFITYLFVLLENLIIILTVWVTGSLHKPMYYFLSTMSFLEAWYISVTVPKMLAGFLFRPNTISFLGCMTQLYFFMSLACTEC
VLLAAMAYDRYVAICWPLRYPVMMTTGFCIQLTISSWVSGFTISMAKVYFISRVAFCGNNVLNHFFCDVSPILKLACMNLSMAETVDFALAIVILVFPLSATVLSYGFIV
STILHIPSAIGQRKAFSTCASHLTVVVIFYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNKEVKDAIRKTISGGRALSLGESIF*
169 >lcl|NP_001000203.1|Plus16903805..6904758 NW_047562 olfactory receptor Olr227 Olr227 __SEG__ Chr1 {Rattus norvegicus} MAIGNQTRVTEFILMSFSSLPTEIQTLLFLAFLSIYLVTLLGNSLIILVTLADPMLQSPMYFLLRNLAFLEIGFNLVIVPKMLGTLIAQDTSISFLGCATQMYFFFFFGV
AECFLLATMAYDRYVAICSPLHYPVIMNQGTRARLAAASWFPGFPVATVQTTWLFSFPFCANNKVNHFFCDSPPVLRLVCADTARFEVYAIVGTILVVMIPCLLILCSYT
LIVASILKIPSAQGKHKAFSTCSSHLLVVSLFYVSSSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNNEVKNALSRTFYKALALRNHIT*
170 >lcl|NP_001000204.1|Plus1complement(6971598..6972542) NW_047562 olfactory receptor Olr229 Olr229 __SEG__ Chr1 {Rattus norvegicus} MGRENQTFVVEFLLLGLSQDAQTQILLFVLFFIIYVLTVLGNLLIIILILMDSRLHTPMYFFLRNLSFADLCLSSSIVPQVLSHFLVKRKTISFWGCVTQVIVSLQIGCT
ECALLAVMSYDRYVAVCKPLHYFTVMTQQLCLQLALGSWASGLLVSLIDITVAFHLPYQGQNTVSHYFCELPALLKVASADTYSTEMAIFAMGIVILLAPVSLILISYWN
IISTVIQMQSGEGRLKAFSTCGSHLIVVVLFYGSGIFNYMQPNTKTTRKRDKIMSVFYTVVTPMLNPIIYSLRNKDVKSAFKRLAARIAFFQKQ*
171 >lcl|NP_001000205.1|Plus16989374..6990327 NW_047562 olfactory receptor Olr230 Olr230 __SEG__ Chr1 {Rattus norvegicus} MAAGNQTRVTEFVLMSFSSLSSEIQDVLFLAFLAIYLVTLIGNSLIILVTLADPMLQSPMYFFLRNLSFLEIGFNMVIVPKMLGTLIAQDTSISFLGCATQMYFFFFFGV
AECFLLATMAYDRYVAICSPLHYPIIMNQGTRVKLAAASWFPGFPVATVQTTWLFRFPFCANNKVNHFFCDSPPVLKLVCANTARFEVYAIVGTILVVMIPCLLILCSYT
LIVASILKIPSAQGKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPLLNPIIYSLRNNEVKNALSRTFHKALALRKLIL*
172 >lcl|NP_001000206.1|Plus16998472..6999419 NW_047562 olfactory receptor Olr231 Olr231 __SEG__ Chr1 {Rattus norvegicus} MTWGNWTTVKEFILTSFSSLSYEIQALLFLLFLIIYLVTLLGNVLIILVTTADSALQSPMYFFLRNLSFLEIGFNLVIVPKMLSTLILQDKSISFLGCATQMYFFFFFGA
AECCLLATMAYDRYMAICDPLHYPIIMSCRSCAQLAAASWFSGFPVATVQTTWIFSFPFCGPNTVNHFFCDSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYV
RILATIFRMPSAEGKRKAFSTCSSHLLVVSLFYSTAILTYFRPRSNTSPENKKMLSLSYTVVTPMLNPIIYSLRNNEVKAALRRIMHRTLGPQKL*
173 >lcl|NP_001000207.1|Plus1complement(7020627..7021574) NW_047562 olfactory receptor Olr233 Olr233 __SEG__ Chr1 {Rattus norvegicus} MRQANQTQVTEFLLLGLSDDPHTQTLLFILFLGIYLVTVLGNLLLMFLVWADSRLHTPMYFFLCNLSLADLCFSTNIVPQALTHLLSRKKSISFRRCAAQLLLFLIFGCT
QCALLAVMSYDRYVAICNPLHYSSIMTWRLCIQLATVSWTSGILVSVVDTTFTLRLPYRGSNSIPHFFCEAPALLTLASTDTQTSEMVIFLMGVVILLIPVSLILVSYGH
IIVTVVKMKSAAGRFKAFSTCGSHLIVVILFYGSGIITYMTPKSSKEQEKLVSVFYAMVTPMLNPLIYSLRNKDVKGALWKVALKNFSSRPIIIQ*
174 >lcl|NP_001000208.1|Plus17069379..7070323 NW_047562 olfactory receptor Olr234 Olr234 __SEG__ Chr1 {Rattus norvegicus} MGRKNQTFVVEFLLLGLSQDAQTQILLFVLFFIVYVLTVLGNLLIIILIFMDSRLHTPMYFFLRNLSFADLCFSNSIVPQVLSHFLAKRKTISFWGCVTQVIVSLQIGCT
ECALLAVMAYDRYVAVCKPLHYSTIMTQQLCLQLALGSWASGLLVSLVDITVAFHLPYRGQNIVSHYFCELPALLKVASADTYSTEMAIFAMGVVILLAPVSLILISYWN
IVSTVIQMQSGEGRLKAFSTCGSHLIVVVLFYGSAIFNYMQPNTKTTKKQDKIMSVFYTVVTPMLNPIIYSLRNKDVKSAFRRLAARVAFFHKQ*
175 >lcl|NP_001000209.1|Plus17849260..7850198 NW_047562 olfactory receptor Olr235 Olr235 __SEG__ Chr1 {Rattus norvegicus} MEPGNHTMVTEFIILGLTEDPTLCCIFFVLFLGVYLTTVLGNICIIILIRRSPQLRTPMYLFLSHLAFVDIGYSSSVTPVMIVNFLRERTAIPVTGCIVQLGSDVVFGTA
ECFLLAAMAYDRYVAICSPLRYSTLMSSRVCFILLVISYAGGCVNSSSFTSCLLSLTFCGPNKINHFFCDLPPLVELSCTHVYIADMSPAISAGSIIVITLFTIIISYVY
ILRSILRMRSTEGRHKAFSTCTSHLTAVTLFYGTVTFVYVIPKSSHSPDQIKVVSVFYTVVIPMLNPLIYSLRNKEVKEAMRKLMARTHSLF*
176 >lcl|NP_001000210.1|Plus1complement(7856253..7857197) NW_047562 olfactory receptor Olr237 Olr237 __SEG__ Chr1 {Rattus norvegicus} MAFQEDGNHTTVTEFILLGLTDDPVLKVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLVNFLVERSTISYLGCTIQLGSGAFF
GTLECFLLATMAYDRFIAICNPLLYSTKMSTQVCIQLLVGSYIGGFLNASSFLLSFFPLLFCGPNRVNHFFCDLAPLIELSCSGGNVPIVPASFCSAFVIIVTVFVIAVS
YTYILITILKMRSTEGRQKAFSTCTSHLTAVTLFYGTITFIYAMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQLGKKIFS*
177 >lcl|NP_001000211.1|Plus1complement(7873074..7874012) NW_047562 olfactory receptor Olr239 Olr239 __SEG__ Chr1 {Rattus norvegicus} MKPGNHTMVTEFIILGLTEDPTLCCIFFVLFLGVYLTTVLGNASIIMLIRRSPQLHTPMYLFLSHLAFVDIGYSSSVTPVMIVNFLRERTAIPVAGCIVQLGSDVVFGTA
ECFLLAAMAYDRYVAICSPLRYSTLMSSRVCFILLVISYAGGCVNSSSFTSCLLSLTFCGPNKINHFFCDLPPLVELSCTHVYIADMSPAISAGSIIVITLFIIIISYVY
ILRSILRMRSTEGRHKAFSTCTSHLTAVTLFYGTVTFVYVIPKSSHSPDQIKVVSVFHTVVIPMLNPLTYSLRNKEVKEAMRKLMARTHSSY*
178 >lcl|NP_001000213.1|Plus17959288..7960220 NW_047562 olfactory receptor Olr242 Olr242 __SEG__ Chr1 {Rattus norvegicus} MEAQNHTTVTEFILLGLTENSTLRVILFMTFLGIYAVTVVGNFSIISLIRNCPQLHTPMYLFLSHLAFVDIGFSTSITPIMLTGFLERTITLSVAACEAQFCIAVTFGTV
ECFLLAAMAYDRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSWTFTSCLLSLSFCGPNQIDHFFCDFPAVLKLSCSDVSIIGMIPSISAGTIIVVTVFVIAVSYTY
ILITILKMRSTEGRKKAFSTCTSHLTAVTLYYGTITFIYVMPKSNYSTEQNKILSVFYTVVIPMLNPLIYSLRNRDVKEALRKAIIRIFP*
179 >lcl|NP_001000214.1|Plus1complement(8017212..8018156) NW_047562 olfactory receptor Olr244 Olr244 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILFGLTRDPVLRVILFIVILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVERHTISYIGCAIQLGSVVFF
GSSECFILAAMAYDRFMAICNPLLYSTKMSTQVCVQLLLIAYIGGFLNTWSFTICFYSLVFCGPNGVNHFFCDFAPLIELSCSDVSVSATVPSFTAGSIIVVTVIVIAIS
YIYILITILKMHSNEGRQKAFSTCTSHLTAVTLFYGTITFIYVMPKSTFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQIGRKIFS*
180 >lcl|NP_001000215.1|Plus18044931..8045914 NW_047562 olfactory receptor Olr245 Olr245 __SEG__ Chr1 {Rattus norvegicus} MGNHTTVTTFLLWGFSSFPELQNLLFVVIFLSHMTILIANASIMVAIKLNHNLHTPMYFFLFALSFSETCTTMVILPRILVDLLSESKVISLPECATQMFFFFGLAGNNC
FIMAAMSYDRYTAIHSPLHYHIFMTQKVCFQLIMASCVIGFLCSLSITFTIFNLSFCDSNTIQHFFCDISPLVYLACDYTAHHAMIIFMLSAFVLVGSFVLIMISYIFIV
FLVVKMPSAQGRHKAFSTCSSHLTVVTMHYGFACFVYLIPKNSGSFHEDMLMAVTYTVLTPLLNPIVYSLRNKEMQTALRKVLYSVNKILPCLAITNPEHLRTTIKH*
181 >lcl|NP_001000216.1|Plus18067517..8068455 NW_047562 olfactory receptor Olr246 Olr246 __SEG__ Chr1 {Rattus norvegicus} METENDTMVTEFIILGLTDSATLRAILFVFFLPVYIVTVVGNISIILLIRSSPQLHTPMYLFLSHLAFVDIGYSTSVTPIMLISFLREETTILLAGCAAQLGSDVAFGTT
ECFLLATMAYDRYVAICSPLLYSTQMSPSICCFLLGASYLGGCMNASSFTGCFVNLNFCGPNKINHFFCDLFPLVKLSCGHAYIAEISPSISSASVLVSTLSTIIVSYIY
ILHSILRMRSAEGRNKAFSTCTSHLTAVTLFYGTVLFVYVMPKSSYSADQVKVASVVYTVVIPMLNPLIYSLRNKEVKEAMKKLMARTHWFL*
182 >lcl|NP_001000217.1|Plus18087336..8088280 NW_047562 olfactory receptor Olr247 Olr247 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTTVTEFILFGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSKLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVEKNTISYFGCTIQFSSAAFF
GGLECFLLAAMAYDRFMAICNPLLYSTKMSTQVYFQLLLVAYIGGLLDSCSFTICFYSLVFCGPNEINHFFCDLAPLLKLSCSNVSITAMILSFTVGLVIVVTMFVIAIS
YTYILITILKMHSTEGRQKAFSTCTSHLTAVTLFYGTITFIYVMPKSNYSIDQNKVMSVFYMVVVPMLNPLIYSLRNNEIKVALKRQFGRKTFP*
183 >lcl|NP_001000218.1|Plus1complement(8172781..8173725) NW_047562 olfactory receptor Olr251 Olr251 __SEG__ Chr1 {Rattus norvegicus} MSWLENGNHTTVAEFLLLGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLVNFLVERNIISYLGCGIQLSLVAFF
GAAECFLLAAMAYDRFMAICNPLLYSTKMSTQVCILLVVASYIGGFLNASFAMVSFCSFLFCGPNIINHFFCDFAPLIELSCSDVSVYVIATSFSAGSVTMITALVIAIS
YSYILITILKMHSTEGRQKAFSTCTSHLTAVTLFYGTVTFIYVMPKSSFSIDQNKIVSVFYLLVIPMLNPLIYSLRNNEIKSALKKQIWRKTVS*
184 >lcl|NP_001000219.1|Plus1complement(8199111..8200082) NW_047562 olfactory receptor Olr252 Olr252 __SEG__ Chr1 {Rattus norvegicus} MALLKHGNNTAVTEFILLGLTDDKVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLGFADMGYSSSVTPNMLVNFLIKQNTISYLGCSIQFGSAALF
GGLECFLLAAMAYDRFVAICNPLLYSTKMSTQVCVQLVVGSYIGGFLNASSFTLSFFSLSFCGPNRINHFYCDFALLVELSCSDVSVPVAVTSFSAASVTMLTVFIIAIS
YTYILITILKMRSTEGRQKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRSNEIKGALKKQLAKNMFSQNNILFCKT*
185 >lcl|NP_001000220.1|Plus18439730..8440674 NW_047562 olfactory receptor Olr263 Olr263 __SEG__ Chr1 {Rattus norvegicus} MAFLEYGNQTAVTEFILLGLTDDPVLRVILFTIILGIYLVTVSGNLSTILLIRVSPQLHHPMYFFLSHLASVDMGLSSSVTPNMLINFLTERNTISYLGCGIQQSLADFL
GSVECFLLAAMAYDRFMAICNPLLYSTKMSTQVCIQLVTGSYIGGFLNTCLIMFYFFSFLFCGPNIVDHFFCDFAPLVELSCSDVSVSVVVISFSAGSVTMITVFIIAIS
YSYILITILKMSSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSTYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGAIKRQFNKQTFC*
186 >lcl|NP_001000221.1|Plus1complement(8430054..8431010) NW_047562 olfactory receptor Olr262 Olr262 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILLGLTDDPVLRVILFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLFNFLVEKNTISYLGCAIQLSLAAFC
GTVECFLLATMAYDRFMAICNPLLYATKMSIRVCIQLVVGSYIGGFLNASSFALFFFSFIFCGPNRINHFYCDFAPLVELSCSNVSVSEFVTSFFSGSVTMVTVCIIAIS
YTYILITILRMASTEGRHKAFSTCTSHLTAVTLFYGMITFIYVMPKSRYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNDIKDALKRHLCKKIFSKDVC*
187 >lcl|NP_001000222.1|Plus1complement(8380629..8381570) NW_047562 olfactory receptor Olr259 Olr259 __SEG__ Chr1 {Rattus norvegicus} MAFLERNHTVVTEFILLGLTDDPVLRLLLFTIILCIYLVTVSGNLSTILLIRVSPQLHHPMYFFLSHLASVDIGISSSVTPNMLVNFLVKRNTISYLGCGIQLSSAAFFG
ATECFLLAAMAYDRFMAICNPLLYSTKMSAQVCMQLIVGSYVCGFLNASSFLISFFSLLFCGQSTVNDFFCDFAPLAELSCSDVSVSVVVISFSAGSVTMITALVIAISY
SYILITILKMRSTEGRQKAFSTCTSHLTAVTLFYGTVTFIYVMPKSSYSMDQNKVISVFYMVVVPMLNPLIYSLRSNEIKGALKRHFGRKTFS*
188 >lcl|NP_001000223.1|Plus19157823..9158758 NW_047562 olfactory receptor Olr285 Olr285 __SEG__ Chr1 {Rattus norvegicus} MTGQNDSSVVEFILLGFSHLPELQVHMFGAFLVIYLVTLAGNATIVTVILLDHSLHIPMYLFLQNLSVVEASFSTAIMPEMLVVLTTEKATISFGGCFAQMYFILLFGGT
ECFLLGAMAYDRFAAICHPLTYPVIMSKRIFVKLAMSSWVLGIMIATMQATWVFSFPFCGPSNINHISCETPAVLELACADTFLFEVYAFTGTILIVMVPFLLILLSYTR
ILFTILRMPSTTGRQKAFSTCASHLTSVTLFYGTACMTYLQPKSRYSPDTKKLMSLAYSLLTPLLNPLIYSLRNKEMKRAVVKLWQRKVVC*
189 >lcl|NP_001000224.1|Plus19094266..9095246 NW_047562 olfactory receptor Olr282 Olr282 __SEG__ Chr1 {Rattus norvegicus} MPLKTAQGSIIASRGQNDSSVAEFILLGFSAFPELQGQMFGAFLVIYLVTLVGNATIVTVILLDQSLHIPMYLFLQNLSVVEMSFSAAITPEMLVVLTTEKATISFGGCF
AQMYFILLFGGTECFLLGAMAYDRFAAICHPLSYPVIMSKRVFVKLVMFSWVSGIMVATVQTTWVFSFPYCGHKEINHLFCETPPVLELACADTFLFEVYAFTGTILIVM
VPFLLILLSYTRILFAILRMPSTTGRQKALSTCASHLTSVTLFYGTASITYLQPKSRYSPDTKKLMSLAYTLLTPLLNPLIYSLRNKEMKRAVLKLWQRKVALHTG*
190 >lcl|NP_001000225.1|Plus19081091..9082035 NW_047562 olfactory receptor Olr281 Olr281 __SEG__ Chr1 {Rattus norvegicus} MRRQNHSSTVDFILLGFSNYPELQRQMFGAFLVIYLVTVLGNAIIITIIFLDQSLHIPMYLFLQNLSLVDLCFSTVITPKILVVLTSEKATITFGGCFAQMYFILLFGGT
ECFLLGAMAYDRFAAICHPLSYPVIMNKRVFVKLAMFSWVSGTMMTTLQTTWVFSFPYCGHKEINHLFCETPPVLELACADTFLFEVYAFTGTILIVMVPFLLILLSYTR
ILFAILRMPSTTGRQKAFSTCASHLTSVTLFYGTASITYLQPKSRYSPDTKKLMSLAYTLLTPLLNPLIYSLRNKEMKRAVLKLWQRKVALHTG*
191 >lcl|NP_001000226.1|Plus1complement(8770360..8771304) NW_047562 olfactory receptor Olr279 Olr279 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNYTAVTEFILLGLTDDPVLRVILFIIILCIYLVTVSGNFSTILLIRVSSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVERNTISYLGCGIQLGSAVFF
GTVECFLLAAMAYDRFIAICSPLLYSNKMSTQVCVQLLIGSYIGGFLNASSFTLSFFSLLFCGPNRVNHFFCDFAPLVKLSCSDVSVPAVVPSFTAGSIIMVTVLVIAVS
YIYILITILKMHSTEGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVVPMLNPIIYSLRNKEIKGALKRQFDKNTFS*
192 >lcl|NP_001000227.1|Plus18693286..8694230 NW_047562 olfactory receptor Olr276 Olr276 __SEG__ Chr1 {Rattus norvegicus} MAFVENGNHTAVTEFILLGLTNDPVFRVILFTIILCIYLVTVSGNLSTILLIRVSPQLHHPMYFFLSHLASVDIAISSSVTPNMLVNFLLERSSISYTGCGIQLGSAVFF
GAIECFLLAAMAYDRFVAICNPLLYLTKMSTQVCMQLLVGSYIGGFLHASCFTFSFVSFLFCGPNSVNHFFCDFTPLVELTCSDNSLLLILDSFSAGSIIVITMLIIAIS
YTYILITVLKMHSTEGRHKAFSTCTSHLTAVSLLYGTVTFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQLGEKNVF*
193 >lcl|NP_001000228.1|Plus18544713..8545657 NW_047562 olfactory receptor Olr267 Olr267 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTSVTEFILLGLTDDPVIRVVLFTIILCIYLVTVSGNLSTIFLIRISSQLHRPMYFFLSHLASVDIGLSSSVTPNMLVNFLIKQNTISYIGCSIQFVSAAFF
GTVECFLLAAMAYDRFVAICNPLLYSTKMSTEACIRLVVGSYIEGFISASFFTLSFFSLFFCGPNKINHFYCDFAPLVELSCSDVSVSIVVITFSAGFITMITVFVIAIS
YSYIFITIMKMHSPEGRQKAFSTCSSHLTAVTLLYGTVMFIYVMPKSSYSTDQNKVMSVFYMVVVPMLNPLIYSLRNNEIKGALKKHLGKKIFS*
194 >lcl|NP_001000229.1|Plus18609532..8610476 NW_047562 olfactory receptor Olr270 Olr270 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILLGLTDDPVLKVILFTIILCIYVVTMSGNLSTILLIRVSPQLHHPMYFFLSHLASVDIAYSSSVTPNMLANFLVKQNTISYLGCSIQFGSAAFF
GTVECFLLAAMAYDRFVAICNPLLYSTKMSTQVCIQLVVGSYIGGFLNASSFLLSFFSFIFCGPNRVNHFFCDFAPLVELSCSDVSVFVVVTSFSAGSVTMLTVFVIAIS
YTYILITILKMRSTEGQHKAFSTCTSHLTAVTLFYGTVMFIYVIPKSNYSTDQKKVVSLFYMVVIPMLNPLIYSLRNNEIKGALKRLLDKKIFS*
195 >lcl|NP_001000230.1|Plus18628436..8629380 NW_047562 olfactory receptor Olr272 Olr272 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGISSSVTPNMLINFLLERNTISYLGCAIQLGSAAFF
GSTESFLLAAMAYDRFMAICNPLLYSTKMSTQVCIRLLVGSYVGGFLNASSFTLSYFSFLFCGPNKVNHFFCDFSPLVELSCSDNDVLLIIDSFSAGSIIVITVLVIAIS
YTYILITILKMRSTEGRHKAFSTCTSHLAAVTVFYGTVTFIYVMPQSSYSTDQNKVLSVFYMVVIPMLNPLIYSLRNNEIKTALKKQLSKKQFS*
196 >lcl|NP_001000232.1|Plus18796791..8797708 NW_047563 olfactory receptor Olr292 Olr292 __SEG__ Chr1 {Rattus norvegicus} MMNGTLVTEFFILGFSEMPHLRVPLLLSFFCLYMAAISGNLLIMVTISASPALHTPMYFFLVNLAMVDILCTSTILPKLLDSMMAGRSISYGGCMAQLFFFTWSLGAELL
LFSAMAYDRFVAICCPLHYSAWMGPRVCAFLAGLVWSISITNTSVHTGLMLRLPFCGSNEIEHFFCEIPPLLKLSCAPTQLNEAMAFAADVFLAVGNFSVTILSYGFIVV
SILRIRSAEGKRRAFSTCSAHLIVVTMYYSTVIYTYIRPASSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRRLLSCS*
197 >lcl|NP_001000233.1|Plus1complement(8823716..8824648) NW_047563 olfactory receptor Olr295 Olr295 __SEG__ Chr1 {Rattus norvegicus} MARPNQTVVTEFVLQGFSEHPTLRLFLTGCFLSLYAMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMAQLFFLVWSLSS
ELLLLTVMAYDRYVAICCPLHYSSRMSPQLCGVLAMGVWSVCALNASINTGLMTRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNSIMTLIADVFYGGINFVLTLLSYGC
IIVSILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSLLSPTLNPLIYTLRNKDVKLALGRFLPSFSH*
198 >lcl|NP_001000234.1|Plus1complement(8852815..8853738) NW_047563 olfactory receptor Olr297 Olr297 __SEG__ Chr1 {Rattus norvegicus} MAPVNQSVVTMFILQNFVDDPWIQDVLFCLFFALFMMAIAGNGLIIMTIYSSANLHTPMYFFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFVFSWVLGSE
LLLFSAMAYDRYLAICRPLHYGTLMNGRACVALATFVWFTGALNSLVLTCLVLPLSFCGPNLITHFFCEIPSVLMLSCSSTFINDIMTVITDMFLTGLNFLLTMTSYVFI
IASILRIRSAEGKKRAFSTCSAHLVVVTLYYSTVLYTYVRPALGTAGLLDKAVAVLYTTVTPSLNPLIYTLRNKEFKTSFKKLLFPH*
199 >lcl|NP_001000235.1|Plus1complement(8907608..8908519) NW_047563 olfactory receptor Olr298 Olr298 __SEG__ Chr1 {Rattus norvegicus} MNGTLVTEFLILGFSEMPHLRVPLLSFLCLYMAAISGNLLIMVTVSASPALHTPMYFFLVNLAVVDILCTSTILPKLLDIMVGGRTISYGGCMAQLFFFTWSMGAELLLF
SAMAYDRFVAICCPLHYSTWMGPRVCAFLAGLVWSISLTNTSVNTSLVLHLPFCSSNVIEHFFCEIPPLLKLSCAPTQLNEVMAFAADVFLAVGNFSVIILSYGFIVTSI
LKIRSTEGKQRAFSTCSAHLFVVTMYYSTIIYTYIRPASSYSLNKDKVVSIIYTSVAPTLNPLIYTLRNKDVKVALRKLLSSC*
200 >lcl|NP_001000236.1|Plus1complement(8926803..8927732) NW_047563 olfactory receptor Olr299 Olr299 __SEG__ Chr1 {Rattus norvegicus} MAVSNYTTVVEFVLQGLSGDPRLQALFLVFFSLLYILALAGNTLIIIAITLNPSLHTPMYFLLANLALLDIVCTSTVLPKLLEGLVGKSSHISYKGCLTQIFFMTWILAA
ELLLLTVMAYDRYVAICHPLHYSMLMSWPICVLLAGIVWVIGIANTSVHTGLMARLNFCGPNQIRNFLCEVPTLLLLSCSPTTLNNIMIVLADVYFGVVNFVFTMISYSF
IIASILRIRSTEGKKRAFSTCSAHLVVVILYYSTVIYTYLQPGSGSSLENSKLVTLLYTAVSPTLNPVIYSLRNKDVKVALRKLFPCFH*
201 >lcl|NP_001000237.1|Plus18955549..8956472 NW_047563 olfactory receptor Olr300 Olr300 __SEG__ Chr1 {Rattus norvegicus} MAPINQSVVTMFFLQNFVDDPWIQNVLFCFFFALFVAAIAGNGLIITVIHSSANLHTPMYFFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFVFSWVLGSE
LLLFSAMAYDRYLAICRPLHYGTLMSGRVCIALATFVWFTGALNSLVLTCLVLPLSFCGPNLITHFFCEIPSVLMLSCSPTFINDIMTVIADMFLTGLNFLLTMTSYGFI
IASILRIRSAEGKKRAFSTCSAHLVVVTLYYSTVLYTYVRPALGTSGLLDKVIAVLYTTVTPSLNPLIYTLRNKEFKTSFKKLLFPN*
202 >lcl|NP_001000238.1|Plus18986053..8986985 NW_047563 olfactory receptor Olr302 Olr302 __SEG__ Chr1 {Rattus norvegicus} MLSPNQTVVTEFVLQGFSEHPGLRLFLTGCFLSLYTMALMGNIVIIALVTFSTGLHRPMYFFLCNLATMDIMCMSSVIPKALVGLLSEENTISFKGCMAQLFFLVWSASS
ELLLLTVMAYDRYVAICCPLHYSSRMSPQLCGILAMGVWSVCALNASINTGLMTQLTFCGPKVIIHFFCEIPPLLLLSCSPTYVNSIMTLVADAFYGGINFVLTLLSYGY
IIASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYISPASSYSPERSKVSSVLYSLLSPTLNPLIYTLRNKDVKIALGKLLPSFSH*
203 >lcl|NP_001000239.1|Plus1complement(9010046..9010969) NW_047563 olfactory receptor Olr303 Olr303 __SEG__ Chr1 {Rattus norvegicus} MASGNQSAITMFILQSFIDDPWIQNVLFCLFFALFVAAIAGNGLIITVIHSSANLHTPMYFFLVNLSLMDVICTVTVLPKVLQSLVAENAISYGGCLTQMFIFTWVLGSE
LLLFSAMAYDRYLAICRPLHYGTLMSGRVCMALATFVWFIGALNSLVLTCLVLPLSFCGPNLITHFFCEIPSVLTLSCSPTFTNDIMTVVADMFLTGLNFLLTMTSYVFI
IASILRIRSAEGKKRAFSTCSAHLVVVTLYYSTALYTYVRPALGNAGLLDKFIAIPYTTVTPSLNPLIYTLRNKEFKTSFKRLLFAH*
204 >lcl|NP_001000240.1|Plus19086576..9087508 NW_047563 olfactory receptor Olr305 Olr305 __SEG__ Chr1 {Rattus norvegicus} MVSPNQSVVTEFVLQGFSEHPSLKLFLTGCFLSLYTMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMTQLFFLVWSGSS
ELLLLTVMAYDRYVAICCPLHYSSRMSPQLCGVVVIGVWSVCALNASINTGLMTRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNSIMTLASDAFYGGINFVLTLLSYGC
IIASILRMRSAEGKKKAFSTCSSHLIVVVMYYSSVFCAYISPASSYSPERNKFTSVLYSILSPTLNPLIYTLRNKDVKHALGRIFASFSH*
205 >lcl|NP_001000241.1|Plus19172015..9172947 NW_047563 olfactory receptor Olr307 Olr307 __SEG__ Chr1 {Rattus norvegicus} MVSQNQTVVAEFVLQGFSEHPSLRLFLTGCFLSLYAMALMGNIVIIALVTSSTGLHSPMYFFLCNLSTMDIICTSSVLPKALVGLLSEENIISFKGCMTQLFFLVWSGSS
ELLLLTVMAYDRYVAICAPLHYSTRMSPQLCGILAIGVWSVCALNASINTGLMTRLSFCGPKVITHFFCEIPPLLLLSCSSTYVNSIMTLVADAFYGGINFVLTLLSYGC
IIASILHMRSAEGKRKAFSTCSSHLIVVTMYYSSVFCAYISPGSSYNPERSKFTSVLYSVLSPTLNPLIYTLRNKDVKLALGRILASFSH*
206 >lcl|NP_001000242.1|Plus19234978..9235910 NW_047563 olfactory receptor Olr309 Olr309 __SEG__ Chr1 {Rattus norvegicus} MVSPNQTVVTEFVLQGFSEHPSLRLFLTGCFMSLYTIALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMTQLFFLVWSGSS
ELLLLTVMAYDRYVAICAPLHYSSRMSPQLCGALAMGVWSICAANASMHTGLMARLSFCGPKVITHFFCEIPPLLLLSCSPTYVNSIMTLIADAIYGGINFVLTLLSYGC
IIASILRMRSAEGKRKAFSTCSSHLIVVAMYYSSVFFAYISPGSSYNPERSKFTSVLYSVLSPTLNPLIYTLRNKDVKLALGRILASFSH*
207 >lcl|NP_001000243.1|Plus19385209..9386141 NW_047563 olfactory receptor Olr315 Olr315 __SEG__ Chr1 {Rattus norvegicus} MLSPNQTVVTEFILQGFSEHPGLRLFLIGCFLSLYTMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIVCTSSVIPKALVGLLSEENTISFQGCMAQLFFLVWSASS
ELLLLTVMAYDRYVAICFPLHYSSRMSPQLCGVLAMGVWSICAVNASVHTGLMTRLSFCGPRVITHFFCEIPPLLLLSCSPTYVNSIMTLVADAFYGGINFVLTLLSYGY
IIASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVSSVLYSILSPTLNPLIYTLRNKDVKLALGRLLPSFSH*
208 >lcl|NP_001000244.1|Plus1complement(23419848..23420780) NW_047563 olfactory receptor Olr321 Olr321 __SEG__ Chr1 {Rattus norvegicus} MELRNNTRVKEFIFLGLTQSQHLSLVLFLVLCFVYVTTLLGNLLIMIIVTFESRLHTPMYFLLRNLAILDICFSSITAPKVLVDLLTKKKTISYAECMTQMFFFHLLGGA
DIFSLSVMALDRYVAISKPLHYVTIMSSRRCTALIAASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTDTFVLELLMISNNGLVTTLWFIFLLVSYMV
ILTMLRSQAGEDRRKAISTCTAHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMKRLKRKLTPLEK*
209 >lcl|NP_001000245.1|Plus1complement(23467816..23468751) NW_047563 olfactory receptor Olr323 Olr323 __SEG__ Chr1 {Rattus norvegicus} MENYTRVKELIFLGLTQSHEVSMVLFLFLLLVYVTTLLGNLLIMVTVTYESRLHTPMYFLLRNLSIADICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDV
FSLSVMALDRYVAISKPLHYVTIMSRGRCIGLIAASWVGGFAHSIVQISLLLTLPFCGPNVLDTFYCDVPQVIKLACTDIFVLELLMISNNGLVATLWFVLLVVSYTVIL
MMLRSHSGEGRKKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMRRLRKRLEPSDREDQ*
210 >lcl|NP_001000246.1|Plus1complement(23482239..23483174) NW_047563 olfactory receptor Olr324 Olr324 __SEG__ Chr1 {Rattus norvegicus} MELRNHTKVTEFIFCGLTQSQELSLLLFFFLSVVYIATVLVNVTIMVTVTWESHLHTPMYFLLRNLSVLDICFSSITVPKVLMDLLSRRKTISFNGCFTQIFFFHLLGGA
DIFSLSVMAFDRYMAIFKPLHYVTIMSKGRCTALIAASWVGGFIHSIVQISLLLPLPFCGPNVVDNFYCDVPQVLKLACTDTFVLELLMISNNGLITTLWFVLLLVSYTI
ILTMLRSHTGEGKRKAISTCTSHMTVVTLHFVPCIYVYARPFTALPMDRAISITLNIIVPVLNPMIYTLRNQEMKSAMKRLRKRLILSEVE*
211 >lcl|NP_001000247.1|Plus1complement(23491013..23491957) NW_047563 olfactory receptor Olr325 Olr325 __SEG__ Chr1 {Rattus norvegicus} MGQINHTHVKEFVFLALTRFRELEFFLFSVFFLVYVTTVLGNALIVVTITSESRLHTPMYFLLRNKSVLDIVFSSITVPKLLVDLLSERKAISYNGCLTQIFFFHFAGGA
DIFFLSVMAYDRYLAIAKPLHYVTIMRREVWVALVVASWVGGGLHSIVQIILMLPLPFCGPNTLDAFYCDVPQVVKLACTDTFALELLLISNNGLVTLLWFLLLLGSYTI
ILIMLKSHSGEGRNKALSTCTSHIMVVTLHFVPCVYVYCRPFTTLPMDTAISINNTVITPMLNPMIYTLRNQEMKSAMKRLQRRLGPSESNKLG*
212 >lcl|NP_001000248.1|Plus1complement(23502740..23503693) NW_047563 olfactory receptor Olr326 Olr326 __SEG__ Chr1 {Rattus norvegicus} MALTNPRNSSSVIMFIFLGFSDHPELRTFLFLTFLGIYLVTLTWNLALIFLIRGDIRLHTPMYFFLSNLSFVDICYSSSVAPKMLFDFFREQKTISFLGCAAQFFFFVGL
GLTECFLLTAMAYDRYAAISNPLLYMTIMHQGLCMRMVAGAYLGGFLSSFIQASSIFQLCFCGPNVINHFFCDLPPILALSCSNTFFSQVVNFLVVITVGGTSFLILLVS
YSYIVSAVLKIHSVKGRWKAFNTCASHLMAVTMLFGTALFMYLRPSSSYSFSRDKVVSVFYSLVIPMLNPLIYSLRNKEIKDALWKMIEKRKVFTNL*
213 >lcl|NP_001000250.1|Plus1complement(23765618..23766577) NW_047563 olfactory receptor Olr332 Olr332 __SEG__ Chr1 {Rattus norvegicus} MAGGRNSTTVTRFILLGFSDQPQIKAFLFMFFLGIYLLTLAWNLSLITLIRMDSHLHTPMYFFLSNLSFLDICYSSSTAPKMLSDIVTDENTISFLGCATQYFVFCGMGL
TECLLLAAMAYDRYTAICNPLLYMAIMSHTLCLKLVAGAYMGGFLSSLIETCSIYQHDFCGPNIINHFFCDLPPVLALACSDIFTSQVVTFIVGVIVGVMSVLVVLISYG
YIVAAVLRINSAKGRTKAFSTSASHLTAVTLFYGSGLFMYMRPSSSYSLSHDKVVSVFYAVVIPLMNPIIYSLRNKDIKCAVRKAVERDYMLSHGHSFF*
214 >lcl|NP_001000251.1|Plus123656289..23657230 NW_047563 olfactory receptor Olr329 Olr329 __SEG__ Chr1 {Rattus norvegicus} MVIGGGNITKITQFILLGFSDFPRITVLLFVIFLMIYIMTMTWNLSLIALIRMDSHLHTPMYFFLSNLSFIDLCFVTSTAPKMLSNFFQEKQTISFVDCIVQYFILSTMG
LTECCLMTAMAYDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGLTGSLSQVCALLQLHFCGPNVIRHFFCDISQLLNLSCSDAFFIQVLLAILTMCFGIANAFATMLSY
GFIVLSILKITSAKGRSKAFNTCASHLTAVSLFYSTGIFVYLRSSSGGSSSFDRFTSVFYTVVIPMLNPLICSLRNREIKDAMKRLQKKKICT*
215 >lcl|NP_001000252.1|Plus124223256..24224194 NW_047563 olfactory receptor Olr338 Olr338 __SEG__ Chr1 {Rattus norvegicus} MENRTEVTEFILLGLTNAPELQTPLFIIFTLIYFINMTGNLGMLVLILWDSRLHTPMYIFLGNLSLVDIFYSSAVTPTVVAGLLVGNQAISYSACAAQMFLFVVFATAEN
FLLAAMAYDRYAAVCKPLHYTTTMTPTTCACLTIACYAGGFLNSSIHTGDTFRLYFCKSNVVHHFFCDVPAVMVLSCSDRHVSEMILLYGASFVICSALLVILISYIFIF
ITIFKMRSTAGYQKAMSTCVSHFTAVSIFYGTLIFMYLQPSSHHSMDTDKIVSVFYTMVIPMLNPVVYSLRNKEVKSAFKKVVEKAKYSLGI*
216 >lcl|NP_001000253.1|Plus124528314..24529258 NW_047563 olfactory receptor Olr340 Olr340 __SEG__ Chr1 {Rattus norvegicus} MENSTKVTDFIFAGLTDDPELQIPLFIVFLLIYLSTLLGNLGMVGLILLDSHLHTPMYLFLSHLSLVDFGYSSAVTPKVMAGLLSIDKTISHNGCAIQFFFFVSFITTES
FLLAAMAYDRYAAVCKPLLYTTTMTTNTCVCLIIGSYVCGFLNSSIHTGNIFRLSFCKSDVIDHFFCDAPPLLALSCSDTSVSEMVILFVVGFNDLFSIVVIMVSYLFIF
ITILRMHSSEGRQKTFSTCASHLTAVSIFYGSGIFMYLQPSSSHTMGSDKMASVFYTMIIPMLNPLVYSLRNKEVKSAFKKAVEKAKFSIAFTF*
217 >lcl|NP_001000254.1|Plus1complement(24577039..24577983) NW_047563 olfactory receptor Olr343 Olr343 __SEG__ Chr1 {Rattus norvegicus} MKNSTEVTEFILAGLTDDPELQIPLFIVFLLIYLSTLLGNLGMVGLILLDSHLHTPMYLFLSHLSLVDFGYSSAVTPKVMAGLLSIDKTISHNACGTQFFFFVGFITTES
FLLAAMAYDRYAAVCKPLHYTTTMTTNTCACLIIGSYVCGFLNSSVHTGNIFRLSFCKFNVIDHFFCDAPPLLALSCSDTSLSETVIFFVVGFNALFSIVVIVISYLFIF
ITILRMHSSEGRQKAFSTCVSHLTAVSIFYGTVIFMYLQPSSSHTMGTDKMASVFYTMIIPMLNPLVYSLRNKDVKGAFKKAVVNAKSTITFIF*
218 >lcl|NP_001000255.1|Plus124625884..24626810 NW_047563 olfactory receptor Olr346 Olr346 __SEG__ Chr1 {Rattus norvegicus} MENCTKVREFILLGLTDDPGLQVPLFIMFTIIYLIDVVGNMGMIMLVLMDSHLHTPMYFFLCNLSLIDLGYSSAVTPMVMSELLMVSKVVSYNACAAQMFFFVGFATGEN
YLLASMAYDRYVAVCKPLHYSTRMTTSVCICLNIGSYICGFLNAIFHVGDIFSLSFCKFNIVHHFFCDVPAVLALSCSDIHLSEMILVFLSTFNVFFALLIILVSYLFIF
ITILKMKSDKGHQKALSTCTSHLTVVSIFYSTVIFMYLQPSSSHSMDADKVASMFYTMIIPALNPLVYSLRNKEVNNAFKKMVKKSTL*
219 >lcl|NP_001000256.1|Plus124791284..24792207 NW_047563 olfactory receptor Olr352 Olr352 __SEG__ Chr1 {Rattus norvegicus} MENVTEMTWFVLLGLNDDPKLQLPLFITFFLIYIITLMGNLGMILLILLDSRLHTPMYIFLSNLSLVDFCYSSTVTPKVMAGFLTGDKIMSYNACASQIFFFATFANVES
YLLVSMAYDRYAAVCKPLRYATTMTTGVCVGLVIVCYICGFLNASIYTVNALSLSFYKLNVVHHFFCDIPAIMIVAYSDRHVNDLVLISVASFNIFFALILILISYMLIF
TNILKLRSAAGYRKALSTCTSHFIAVSIFYGTLTFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPLVYSVRNKEVKNAFTKIVLRSK*
220 >lcl|NP_001000257.1|Plus124836830..24837777 NW_047563 olfactory receptor Olr357 Olr357 __SEG__ Chr1 {Rattus norvegicus} MMQNNSELTEFILVGLTDVQFLQVPLFIIFTLIYLTTLVGNLGMILLIILDSRLHTPMYFFLSNLSFADCVYASAVTPKVIEGFLTEDKIISYNACAAQMFFFGVFAIIE
SFLLASMAYDCHAAVCKPLHYSTTMTTMICSLLLAGSYVSGILQSSIHVAFTFHLSFCHSNVVNHFFCDIPPLLSLSCSSIYTNEIVLFMLAAFDVGFTLLVILTSYLLI
FVAILRMNSAESRKKAISTCSSHLTTVSIFYGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPIVYSLRNKEVKNAFKKVARKALSSLGLVN*
221 >lcl|NP_001000258.1|Plus125220656..25221597 NW_047563 olfactory receptor Olr371 Olr371 __SEG__ Chr1 {Rattus norvegicus} MQNISEVTEFILVGLTDAPELQIPLCIIFTFIYLTTLIGNLGMIGLILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVIEGFLTENKIISYNTCATQMFFLIAFAIAEG
FLLASMAFDRHAAVCKPLHYSTTMTTTICTLLIAGSYIIGFLQSSIHVAFTFHLSFCHSNRVNHFFCDIPPLLDLSCSSIYTNEIVLFILAALNVALTVLVILNSYILIF
VAIMRMRSADGQKKAISTCASHLTTVSIFYGTIIFMYLQPSSTHSMDTDKVASVFYTMIIPMLNPIVYSLRNTEVKNAFRKFTGKVLFSLGLV*
222 >lcl|NP_001000259.1|Plus125380333..25381292 NW_047563 olfactory receptor Olr375 Olr375 __SEG__ Chr1 {Rattus norvegicus} MVDEKSFFNKSGPPVFTFRVLTNVPEFQAILFILFLLLYLMILCGNTTIIWVVSKYSFLHMPMYFFLGSLSFVEICYITDVVPLMLSNIFGAQKPISLASCGTQMFFFSV
FGCTDCFLLTVMAYDRYVAICHPLHYNLIMTQKLCIKLVIGSLSLALFLSLPLTAFTFTLPFCRYHLEINHFLCDVAPIMRLACADIHVNQAVLYVVSILVLTVPFLLIC
ISYVFIASTILRMHSAKGRQRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYIFGTPLLNPLIYTLRNKDIKDALRNSFFRTSASDTS*
223 >lcl|NP_001000260.1|Plus125404943..25405890 NW_047563 olfactory receptor Olr376 Olr376 __SEG__ Chr1 {Rattus norvegicus} MSQGNQTTISEFILLGLSNQAEKQKFIFVIFLSMYLVTVLGNSLIILVIGLDVNLHTPMYLFLANLSFADISSSSTSVPKMLMNIQTKSQYISYEGCFTQMYFSIVFVVI
DNFLLGVMAYDRYVAICHPLTYTSIMHSTFCLLLTVCPWALSNIVALTHTLLANQLIFCNDNTIQHFFCDLAPLLKLSCSDAMINNIVKFIVGLSVITFPFALILFSYVC
IIRDVLRISSMEGKWKAFSTCGSHLTVVFLFYGTIIGVYFFPLSTHPEDTDKIGAVLFTVVTPMLNPFIYSLRNKDMKGAFKKLINKSHFFLLMS*
224 >lcl|NP_001000261.1|Plus1complement(25450719..25451654) NW_047563 olfactory receptor Olr379 Olr379 __SEG__ Chr1 {Rattus norvegicus} MDKVNLTLVTEFFLIAFTEHPEWGLPLFHLFLFIYFFTLLGNSGMIFLIRTDHRLHTPMYFLLSHLSFMDICYSSVTVPQTMAVLLEHGAALSYARCVAQFFLFTFFGSI
DCYLLALMAYDRYVAVCQPLLYVTIMTQKALLSFVAGAYIAGLLSALVRTVSAFTLSFCGNNEIDFIFCDLPPLLKLTCGESYIQELVIIVFAIFVIPACMVVIVISYLF
IIVAILRIPSAGGRVKTFSTCASHLTAVSLFFGTLIFMYLRDNSGQASEKDRVVSVFYTTVIPMLNPLIYSLRNKEVKEALRKIFNRIKIL*
225 >lcl|NP_001000262.1|Plus1complement(25542368..25543315) NW_047563 olfactory receptor Olr383 Olr383 __SEG__ Chr1 {Rattus norvegicus} MADNGTRLTEFILMGFQLQAEIQLGLFFMFLAFYLITIVGNLGMIMLIQSDPQLHTPMYFFLSHLSFLDICYSSVIVPQLLETLGNNKMVITYERCATQFFFFTLYASTE
CFLLAVMAYDRYVAVCNPLLYAMAMTPQTRLGLIAAAYSGAMVNTVVRTGCTFSISFCKSNQVDFFFCDLPPLLKLACSETKLREQVIFLLAFLVIITSVSVILVSYLFI
IWAILKIRTAGAKAKTFSTCASHMIAVALFFGTLMFMYLKGNMGKSLWEDKIVSVFYTVVIPMLNPMIYSLRNKEVKEALKKALKRIKAFQESKT*
226 >lcl|NP_001000263.1|Plus125591583..25592533 NW_047563 olfactory receptor Olr384 Olr384 __SEG__ Chr1 {Rattus norvegicus} MAKNNVTTVTEFILMGFNDHPNWEIPLFLVFLSLYLVTILGNLGMVILIHIDVQLHIPMYFFLSHLSVLDTCYTSVITPQILATLATGKTAISYGHCAAQFFFFTVCAGT
ECFLLSVMAYDRYVAISKPLLYTVAMHPRKCWSLVVGAYLCGVSGAILRTTCTFSLSFCENNQINFFFCDLPPLLKLACSDTANVEIIIVFFGNFVILANALVILISYLL
IIKAVMKMKSSGRRAKTFSTCVSHLTAVALLFGTLIFMYIRSGSKKSLEEDKVVSVFYTIVIPMLNPLIYSLRNKDVKSAFKKVIGKCPVSHSIQI*
227 >lcl|NP_001000266.1|Plus1complement(178032..178970) NW_047596 olfactory receptor Olr1671 Olr1671 __SEG__ Chr20 {Rattus norvegicus} MVENFNASWEGYFIFLGFSKWPHLEVVLFVVILIFYMMTLTGNLFIIVLSHLDSHLYTPMYFFLSNLSALDLCYTTSSVPQLLFNLWGPEKTISYAGCMLQLYFVLALGT
TECVLLVVMSYDRYAAVCKPLHYSVLMNPRFCQLLAAASWVCGFTTSALHSSFTFWVPLCGHRQVDHFFCEVPALLQLSCVDIHANELTLMVMSAIFVVVPLILILSSYG
AIAWTVLKMQSTARLQKVFGTCGAHLTVVSLFFIPIMCIYLQPSTKSSQDHAKFIALFYTVVTPSLNPLIYTLRNKDVRGAIRRLRRYERER*
228 >lcl|NP_001000267.1|Plus1complement(92810..93748) NW_047596 olfactory receptor Olr1668 Olr1668 __SEG__ Chr20 {Rattus norvegicus} MAVSNESHPKEFILLGFADHPWLELPLFVTLLITYPMALMGNIAIILVSTLDPRLHSPMYFFLRNLSFLDMCYTTSVVPQMLFNLGSSRKTISYVGCVIQLYIFHVMGGT
ECLLLAIMSIDRYVAICRPLHYTLIMSQRVCVLSVSIMWLTGVIFGFSEATLTLQLPLCGQYKLDHLLCEIPVLIKTACGEKEFNELALSVVCIFILIVPLFLILASYVN
IGRAVLRIKSSEGRRKAFGTCSSHLIVVSLFYGPGMSMYLQPPSSITRDQPKFMALFYAVITPTLNPFIYTLRNKDVKGALKKLLRSIFSSK*
229 >lcl|NP_001000268.1|Plus1complement(196471..197409) NW_047596 olfactory receptor Olr1673 Olr1673 __SEG__ Chr20 {Rattus norvegicus} MTPINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDMCYTTSIVPQMLINLGGSTKTISYMRCAIQLYFYHTMGGT
ECVLLALMSFDRYIAVCKPLHYTLIMKQRNCVLLVSIVWLIGISYAVTEATVTLQLPLCGHNKLDHLVCEIPVLIKTACGEKETNELALSVVCIFLLAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFMSK*
230 >lcl|NP_001000269.1|Plus1complement(334752..335690) NW_047596 olfactory receptor Olr1683 Olr1683 __SEG__ Chr20 {Rattus norvegicus} MKLINTSHPEEFILLGFADRPWLELSLFIILLVTYPTAMIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLGGSTKTISYMRCAVQLYFFHTMGGT
ECVLLALMSFDRYVAICRPLHYTLIMNQRKCLLLVSTVWLTGISYAVSEATVTLQLPLCGHNKMDHLVCEIPVLIKTACGEKETNELALSVVCIFLLAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGAVGNLFRNIFMSK*
231 >lcl|NP_001000270.1|Plus1350709..351650 NW_047596 olfactory receptor Olr1684 Olr1684 __SEG__ Chr20 {Rattus norvegicus} MGTVCNDTHGDFILRGFSDKPYLEKILFGVILVFYCFTLAGNTIVIFVSSKDPKLQIPMYFFLSNLSLLDICFTSSCVPQMLVNLRSPKKTITYSGCATQLYIFLWLGAT
ECVLLVVMAVDRYVAVCHPLRYLTVMRPKVCLQLAVLAWGSGLMQSLIQSTATLRLPFCSQPVVDDFVCEVPALIQLSSADTTYNEVQMSVASVILLVLPLAIILSSYGA
IVKSVLKIKSPAGQKKAFGTCTSHLLVVSLFYGSVTGVYLQPKTHYANESGKFLTLFYTVITPTLNPLIYTLKNKEVKGAVIRLWWKTWVSQR*
232 >lcl|NP_001000271.1|Plus1783080..784018 NW_047596 olfactory receptor Olr1704 Olr1704 __SEG__ Chr20 {Rattus norvegicus} MIWKNITTMSGFLLMGFSDNHELQILQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLAHSGYISYGQCMLQVFFFTALAWS
EMAILTVMSYDRYVAICLPLHYEVIMGPRKCTWAVAAVWLSGSISGTLYTVSILSIRFCGDKIIHQFFCDIPQLLKLSCSNDHLVIMGVADFLSAMAFACFIGIVISYVH
IFSTVLRMPSADSRSKVFSTCLPHLFVVSLFLSTGFCAYLNPTSDSPTALEFLFSIFYTVLPPTLNPLIYSLRNETIKSVVRKLLFSRKFAL*
233 >lcl|NP_001000272.1|Plus1complement(678312..679277) NW_047596 olfactory receptor Olr1695 Olr1695 __SEG__ Chr20 {Rattus norvegicus} MINSSVNSDFILVGFSDQPQLEKRLFIVVLISYLLTLVGNTIIILISSIDSKLKTPMYYFLTHLSFVDICFTTSIVPQLLWNLKGPAKTITAVGCVVQLYVSLTLGSTEC
ILLAVMAFDRYAAVCKPLHYVAVMNPQLCQALAGISWLSGVGNALIQGTITLWLPRCGHRWLHHFFCEVPSMIKLACVDIHANEVQLFVASLVLLLLPLALILTSYGHIA
KEVLRIKSSQAWHRALGTCGSHLMVVSLFYGSITVIYIQPNSSYAHTHGKFISLFYTVMTPTLNPLIYTLRNKEVKGALERLFSRAAGVCKQNRARGDRTL*
234 >lcl|NP_001000273.1|Plus1complement(609214..610185) NW_047596 olfactory receptor Olr1691 Olr1691 __SEG__ Chr20 {Rattus norvegicus} MTARNITTMSGFLLMGFSDNHELQVLQALLFLVTYLLGTAGNFIIITITTLDPKLQSPMYYFLKHLSILDLSSLSVTVPQYVYSSLAQSGYISFGQCVMQVFFFTALAWT
EMAILTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSITGTLYTASILSIRFCGDKIIHQFFCDVPQLLKISCSNDYVGVQKVSTFMTLLAFACFMGIAFSYGQ
IFSTVLRIPSAESQTKVFSTCLPHLFVVSFFLSTGICAYLKPTSDSPTALDFILSIFYTVLPPTLNPVIYSLRNESFKGAVKKLLLSEEFIGKNYICSVVRAC*
235 >lcl|NP_001000274.1|Plus1complement(581243..582214) NW_047596 olfactory receptor Olr1690 Olr1690 __SEG__ Chr20 {Rattus norvegicus} MTAKNITTMSGFLLKGFSDNHELQILQALFFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVYSSLAQSGYISYGQCMMQVFFFTALAWS
EMAILTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSISGTLYTASTLSIRFCGDKIIHQFFCDVPQLLKISCSNDYFGVLGVSTFMTVLAFACFVGIAFSYGQ
IFSTVLRIPSAEGRSKVFSTCLPHLFVVSFFLSTGICAYLKPTSDSPTALDLILSIFYTVLPPTLNPVIYSLRNASLKGAVKKLLLSEEFIGKNYFCSVIHAC*
236 >lcl|NP_001000275.1|Plus1540075..541079 NW_047596 olfactory receptor Olr1688 Olr1688 __SEG__ Chr20 {Rattus norvegicus} MTARNITTMSGFLLMGFSDNHELQILQALLFLMTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDFSSFSVTIPQYVYSSLAQSGYISYGQCMMQVFFFTALAWS
ELAILTMMSYDRYVAICLPLHYEVIMSPRKCTWAVVAVWLSGSLTGTLYTASTLSIRFCGDKIIHQFFCDVPQLLKISCFNDYFGVVKVTAFMSVLVFACFMGIAFSYGQ
IFSTVLRIPSAEGQSKVFSTCLPHLFVVSFFLSTGICAFLNTTSDSSAALDFILSIFYTVLPPTLNPVIYSLRNESFKGAVKKLLFSEEFIGKNYFCSVVHACQQWTQRI
FFIC*
237 >lcl|NP_001000276.1|Plus1831802..832716 NW_047596 olfactory receptor Olr1708 Olr1708 __SEG__ Chr20 {Rattus norvegicus} MTGFVLMGFSDNHELQVLQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVESSLARSGYISYGECMMQVFFFTALASSEMAMLTVM
SYDRYVAICLPLHYEVIMGPRKCTWAVAAVWLSGSMSGTLYTVSIHSIRFCGDKIIHQFFCDVPQLLKLSCSNDHFVIIGMIDFLSVITFACFIGIIISYVHIFSTVLRM
PSAESRSKVFSTCLPHLFVVSLFLSTSFCAYLNPTSGSPSTLEFLFSVFYAVIPPTLNPLIYSLRNETIKSVVRKLLFNIKFDV*
238 >lcl|NP_001000277.1|Plus1complement(1185189..1186118) NW_047596 olfactory receptor Olr1724 Olr1724 __SEG__ Chr20 {Rattus norvegicus} MNCTQAPGFILLGLSRDPEKWQLFFSIFLALYLLGLLGNLLLLLAIGADIHLHTPMYFFLSQLSLVDLCFITTTAPKMLQALWTGDGSISFSGCLTQFYFFAVFADMDNL
LLAVMAIDRYAAICHPLLYPLLMTPCRCEVLASGSWGVAHCVSLFYTLLLSQLYFQTNEGIPHFFCDSRPLLLLSCSDNHLNEGLMMGLSAVMGISALFCILSSYASIFH
AVARVPSAQGKRKALATCSSHFSVVLLFHSTVFATYLKPPSTSHSSGEVVAAVLYTLVTPTLNPFIYSLRNRDVKSSLRRILNIEKSQD*
239 >lcl|NP_001000279.1|Plus11246310..1247263 NW_047596 olfactory receptor 1730 Olr1730 __SEG__ Chr20 {Rattus norvegicus} MEGKNRTTPSEFIILGFSHLNELQFLLFTIFFLTYICTLGGNVFIIVVTMADSHLHTPMYYFLRNLAFIDICYTTTNVPQMMVHLLSEKKTISYGGCVTQLFAFIFFVGS
ECLLLAAMAYDRYIAICKPLRYSFIMNKALCSWLAASCWTGGFLNSMLHTVMTFHLPFCGNNQINYFFCDIPPLLILSCGDTALNELALLSIGIVIGWTPFLCIILSYLY
IISTILRIRSSQGRHKAFSTCASHLLIVILYYGSAIFTYVRPISSYSLEKDRLISVLYSVVTPMMNPVIYTLRNKDIKEAVKAIGRKWQPPVFSSDM*
240 >lcl|NP_001000281.1|Plus1complement(10009733..10010662) NW_047657 olfactory receptor Olr439 Olr439 __SEG__ Chr3 {Rattus norvegicus} MGHSNDTKVTEFILLGFAGQHESWHILFVVFLIIYIATLVGNIGMILLIKLHSSLHTPMYFFLQHLAFVDLCYSSAITPKTLQNFVSSKPSISFTGCIVQLLVYGIFVTS
DCFILAAMAVDRYVAICNPLRYPIIMSQRLCILLLLGSYTMGFLNATVNTGFTFLSNFCKSNTINHFFCDVPPILALSCSSIDLNIMVLTIFVGFNLTFTVSVVILSYTF
ILAAILRMSSAAGRRKAFSTCASHMTAVTIFYGTLSYMYVLHGTNKSQEQEKVASVFYGIMIPMLNPLIYSLRNQDVIGALRNIGNKCF*
241 >lcl|NP_001000282.1|Plus1complement(10027080..10028027) NW_047657 olfactory receptor Olr440 Olr440 __SEG__ Chr3 {Rattus norvegicus} MIQYNETEVKGFYLLGFGVRHDIQYVLFIVFLVIYVTSMLGNTGMILLIHTDSRLQTPMYFFLQHLAFVDICYTSAITPKMLQNFVVEDRSISFGGCVAQLLIYAIFATC
DCYLLAAMAVDRYVAICKPLHYPILMSRKVCIQMVAGSYLIGSINSSVHTGFTFSLSYCKSNHINHFFCDVPPIISLSCSNIDTNIRLLIFFVGFNLIFTVLVVIFSYIY
IMAAILKMSSTSGRKKTFSTCASHLTAVTIFYGTLAYMYLQPHSENSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKDAIKLTRKKLFRSGPQK*
242 >lcl|NP_001000283.1|Plus1complement(10048178..10049122) NW_047657 olfactory receptor Olr441 Olr441 __SEG__ Chr3 {Rattus norvegicus} MAQDNGTKVTDFYLLGFGVQRDIQCILFIVFLVIYVISMVGNTGMILLINTDSRLQTPMYFFLQHLAFVDICYTSAITPKMLQNFMVEDKSITFKGCVVQLFVYAIFATS
DCYLLAVMAVDRYVAICKPLRYPIIMSRQVCIQLVAISYLMGSINSSVHTGFTFSLSFCKSKVNHFFCDIPPIVTLSCYNNDINFMLILVFVGFNLTFTVLIVILSYIYI
MAAILKMSSTAGRKKTFSTCASHLTAVTIFYGTLAYMYLQPHSDNSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKDAIKATGKKFLKLDLNY*
243 >lcl|NP_001000284.1|Plus1complement(10058592..10059539) NW_047657 olfactory receptor Olr442 Olr442 __SEG__ Chr3 {Rattus norvegicus} MTQRNATEVTDFYLLGFGVQQNTQCVLFIVFFVIYVTSMVGNTGMILLINTNSRLQTPMYFFLQNLAFVDICYTSAITPKMLQSFMVEDCSISYTGCVIQLLVYATFATS
DCYLLAVMAVDRYVAICKPLRYPIIMSRQVCLLLVALSYLMGSINSSVHTGFTFSLSYCNSKNINHFFCDVVPIISLSCSNTDINIMLLIVFVGFNLTFTVLVIIFSYIY
IMAAILKMSSTAGRKKTFSTCASHLTAVTIFYGTLSYMYLQPHSDNSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKEGFKAMSRRFLRMKSNP*
244 >lcl|NP_001000285.1|Plus110218922..10219866 NW_047657 olfactory receptor Olr443 Olr443 __SEG__ Chr3 {Rattus norvegicus} MEEKNQTVMPAFIFLGITDNLHQKIVIFIIFSFVYLVTLGGNVGMITLIWLDPRLHSPMYFFLSHLSFVDVCSSSSIAPKMLCDIFAENKTISFVGCAAQMWFFGLFVAT
ECFLLAAMAYDRYAAICKPLLYTLIMSPHLCVLLVIGPYAIALISTMTHTTLTFCLPFCGPYIINHFFCDISPLLSLACTDTKFNKVVLFVLAGAVGVFSGLIILMSYVC
ILMAILKIQTANGRRKAFSTCSSHLAAVSILYGTLFFIYVRPNASSSLNINKVISLFYTLMIPMLNPIIYSFRNTEVKGAFRRTLQKKHFLVGA*
245 >lcl|NP_001000286.1|Plus110255434..10256378 NW_047657 olfactory receptor Olr447 Olr447 __SEG__ Chr3 {Rattus norvegicus} MEEKNQTTVLEFFFLGLTDYLHEKIVLFIMFFFIYLITLAGNVGMINLIWVDPRLHTPMYFFLSQLAFVDVCSSSCVAPKMLCDIFVENKAISFMGCAAQMWFFGLFVTT
DCFLLAAMAYDRYTAICKPLLYTLIMSKKVCIQFVIGPYLLAAINITTHTTMTFRLPFCGSNTINHFFCDVSPLLSLACADTWINKVVLFVMAGVIGVPSGLIIIFSYMC
ILVAILKIKTADGRQKAFATCSSHLTAVSILYGTLFFIYVRPNASTSLDINKVISLFYTVVIPMLNPLIYSLRNKEVKNALKRILERKNFLTGA*
246 >lcl|NP_001000288.1|Plus1complement(10292766..10293704) NW_047657 olfactory receptor Olr450 Olr450 __SEG__ Chr3 {Rattus norvegicus} MEVDNRTILTEFILVGFSADPHWQLVLFGIFLTIYLLTLSGNMMLVVLIRIDSKLHTPMYFFISNLSFLDFWYTSVYTPKILATCISEDKRISLAGCGAQLFFSCVVAYT
ECYLLAAMAYDRHSAICSPLIYSSIMSSSLCTGLVVGCYIGGFLNAIAHTANTFRLTFCGKNIIDHFFCDAPPLVKMSCTDTRVYEKVLLGVVGFTVLSSILAILISYFN
ILLAILRIRSASGRRKAFSTCASHLVSVMLFYGSLLFMYSRPSSTYSLEKDKVAALFYTVVNPLLNPLIYSLRNKDVKDAFKKATQTIRPHT*
247 >lcl|NP_001000289.1|Plus110334640..10335584 NW_047657 olfactory receptor Olr453 Olr453 __SEG__ Chr3 {Rattus norvegicus} MADENYTRITEFIFIGLRYHAKLQVFLFLLFLLFYLVTMTGNLGMIILIRVDSRLHTPMYFFLSHLSFVDICFSSVVGPKMLMDFFADRKVISFLGCVLQQWFFGFFVAI
ECLLLASMAYDRYVAICNPLLYSVAMSQRLCIQLVVGPYAVGFFNTMTHTTAAFRLPFCGSNIINHFFCDMSPILSLICADIRINKLLVFVVAGAVLVVSSTTIIISYFH
ILIAILRIRSAEGRRKAFSTCSSHVTAVSILYGTLFFIYVRPSAISSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKAAMGRTVAKAKVFLKN*
248 >lcl|NP_001000290.1|Plus110360889..10361824 NW_047657 olfactory receptor Olr454 Olr454 __SEG__ Chr3 {Rattus norvegicus} MDEENVTEVTEFILLGFTGDMVLQQVLFFIFLTIYIISLLGNITLISLICSDSRLHTPMYFFIGNLSFLDLWYSSVYAPKILITCISEDKSISFAACLAQFFFSAGLAYS
ECYLLAAMAYDRYVAIANPLLYSQAMSPRLCASLVAASYLGGFANSTIITSETFTLSFCRDNIIDDFFCDLPPLVKLACDVKESYQAVLYFILASNVITPTVLILASYLF
IIAAILKIRSTEGRLKAFSTCGSHLTAVTLYYGSILFIYSRPSTSYALERDKVVSVFYTVVIPMLNPLIYSLRNKDVKEALRKMLDTVKLS*
249 >lcl|NP_001000291.1|Plus1complement(10369547..10370482) NW_047657 olfactory receptor Olr455 Olr455 __SEG__ Chr3 {Rattus norvegicus} MERSNHTVTDFILLGFSTDPVMEKILFVLFLGVYSMTLIGNTTLIILICNDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILVTCISEDKSISFAGCLAQFFFSAGLAYSE
CYLLAAMAYDRYTAISNPLLYAQAMSRRLCICLVVYSYTGGFVNAIILTSNTFTLDFCGDNVIDDFFCDVPPLIKLACDVRESYQSVLYFLLASNVISPTLLILTSYLFI
IAAILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPSSSYSLERDKMVSTFYTVLFPMLNPMIYSLRNKDVKEALRKLFKLAHAEV*
250 >lcl|NP_001000292.1|Plus110423059..10423997 NW_047657 olfactory receptor Olr458 Olr458 __SEG__ Chr3 {Rattus norvegicus} MEVDNRTILTEFILVGFSADPHWQLILFGIFLTIYLMTLSGNMTLIILIRIDSRLHTPMYFFIGGLSFLDFWYNSVYIPKILVNCVSDDKRISLAGCGTQFFFSCVAAYT
ECYLLAAMAYDRHAAICSPLLYSSIMSTSLCTGLVAGSYVGGILNAIAHTANTFRLRFCGKNIIDHFFCDVLPLVKMSCTDTHVYVKILSSMVGFTVLSSILAIIISYFN
ILLAILRIRSASGRRKAFSTCASHLVSVTLFYGSLLFMYSRPSSNYSLERDKVAAMFYTIINPFLNPFIYSLRNKDVKEAFKKLMQRIQQQT*
251 >lcl|NP_001000293.1|Plus1complement(10439749..10440678) NW_047657 olfactory receptor Olr459 Olr459 __SEG__ Chr3 {Rattus norvegicus} MERGNHTVSEFILLGFTSDPTTQLVLFVMFLIMYTLTVLGNCILMVLICSDPKLHTPMYFFIGNLSFLDLWLSTVYTPKILVICISENKSMSFASCVAQFFFSAGLDYSE
CYLLAAMAYDRYVAISKPLIYSQAISIKQCAFFVAASYMGGFINSSIITKKTFTFDFCNDNIIDDFFCDLLPLVNLACGGKEGYQALMYFLLTSNVMIPIALILASYIII
IATILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPRTSYSLDTDKVVSTFYTVVFPMLNPFIYSLRNKDVKEALNKLLKIIPL*
252 >lcl|NP_001000294.1|Plus110467870..10468805 NW_047657 olfactory receptor Olr461 Olr461 __SEG__ Chr3 {Rattus norvegicus} MGHMKINSTVTEFVFLGLSSDPKVQLVLFFVFLFFYMLSVVGNIIIITIILIEPRLQTPMYFFLTNLSFLDICYTSTNVPQMLSNMVWGKKTIPFASCATQMYFSLSFGM
IECVLLGVMAYDRYAAICHPLHYTVIMDQNTCVQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFCEVPSVLRLACTDTSLTELVVFVFSIIIVFIPFLLIIVSYA
RILLSVLRMRSASGRYKALSTCASHLTVVTLFYGTAIFMYMRPQSKSSRAGGKVIAVFYTVVTPMLNPLIYSLRNQDVKGSLRRALTKQKT*
253 >lcl|NP_001000295.1|Plus1complement(10489119..10490051) NW_047657 olfactory receptor Olr462 Olr462 __SEG__ Chr3 {Rattus norvegicus} MHKENHSVVTEFIFMGITQDPQLQIIFFVVFLIVYLVNVIGNVGMIILIITDSQLHTPMYFFLCNLSFVDLGYSSAIAPRMLADCLTKHKVISFSSCATQFAFFVGFVDA
ECYVLAAMAYDRFVAICRPLHYSTLMSKKVCLVLMLGSYLAGLVSLVAHTSLTFSLSYCASNVINHFFCEIPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAF
ILIAIIRMRSAEGRLKAFSTCGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAAFKKLIGKKPQ*
254 >lcl|NP_001000296.1|Plus110513422..10514375 NW_047657 olfactory receptor Olr464 Olr464 __SEG__ Chr3 {Rattus norvegicus} MVRIVKGIQDKNDTDVTEFILLGLSDNPDLQHFLFILFLIIYMVTLVGNLGMMALIKIDRCLHTPMYFFLSSLSFVDASSSSTVTPKMLLNLMAEDKSISFNGCATQFFF
FGSFLGTECFLLAMMAYDRYAAIWSPLLYPVLMSGRICFMFVSTSFLAGFGNAAIHTGMTFRLSFCASNKINHFYCDTPPLLKLSCSDIHTNGIVIMIFSSFTVLICVLI
VLISYLCILIAILKMSSAEGRHKAFSTCSSHLMAVTIFFGSILFMYLRPTTSYSMEQDKVVSVFYTVVIPMLNPLIYSLKNKDVKEAVKKIIQKHIL*
255 >lcl|NP_001000297.1|Plus110518258..10519205 NW_047657 olfactory receptor Olr465 Olr465 __SEG__ Chr3 {Rattus norvegicus} MSSLNNTAVMDFILVGLTDSPVLGRILFVVFLVIYFITLTGNLCMIVLIRTNSHLQTPMYFFLGHLSFVDICYSSNVTPNMLHGFISDQKTISYAGCFTQCLLFIALVIT
EFYILASMALDRYVAICSPLHYSTRMSKNVCVSLIAFSYMFGFLNGLSQTLLTFHLSFCGSHAINHFYCADPPLIMLACSDTHVKKMAMFVVAGFTLISSLSIILFSYLY
IFAAILRIRSAEGRQKAFSTCGSHLTTVTIFYGTLFCMYLKPPSERSVEESKVIAVFYTFLSPLLNPLIYSLRNKDVINAMKQAIKGKFCQKILV*
256 >lcl|NP_001000298.1|Plus110538328..10539263 NW_047657 olfactory receptor Olr466 Olr466 __SEG__ Chr3 {Rattus norvegicus} MTCLNHTAMMDFILVGLTDNPVLGRILFVVFLVIYFITLTGNLCMIVLIRTNSHLQTPMYFFLGHLSFVDICYSSNVTPNMLHGFISDQKTISYAGCFTQCLLFIALVIT
EFYILASMALDRYVAICSPLHYSTRMSKNVCVSLVAFPYVFGFLNGLSQTLLTFHLSFCGSHEINHFYCADPPLIMLACSDTHVKKMAMFVVAGFTLSSSLAIILLSYLF
IFVAIMKIRSADGRQKAFSTCGSHMTTVTIFYGTLFCMYLRPPSQKSVEESKVIAVFYTFLSPMLNPLIYSLRNKDVINAMKQIIKGKFLQ*
257 >lcl|NP_001000299.1|Plus110572028..10572951 NW_047657 olfactory receptor Olr469 Olr469 __SEG__ Chr3 {Rattus norvegicus} MLKKNYTAVTEFIFLGLTDRAELQPVLFVVFLLIYLITVTGNVSMIFLIRSDSKLHTPMYFFLSHLSFVDLCYATTVAPQMLVNFLSKRKNISFIGCMIQFHFFISLVIT
DYYMLAVMAYDRYVAICKPLLYTSKMSRGVCLSLVMTQYIYGFVNGLIQTILMLRLTFCGPNEINHFYCADPPLMVLACSDTYVKKTAMFVVAGSNLSCSLTIILISYIF
IFTAILRMRSAEGRRKAFSTCGSHLTAVTIFYGTLFCMHLRPPSETSVEQGKIVAVFYIFVSPMLNPFIYSLRNKDVKNAIRKVIQK*
258 >lcl|NP_001000300.1|Plus110588740..10589714 NW_047657 olfactory receptor Olr470 Olr470 __SEG__ Chr3 {Rattus norvegicus} MLLTNSTKITEFILLGLTDRTELQPLLFVLFLFVYLVTVLGNMGMMALIRLDSRLHKPMYFFLSNLAFVDLCYTSTATPQMLSNFLSDKKTISFIGCFIQCYLFIALLLT
EFYILAAMAYDRYVAICDPLRYSVKMSRRVCICLAMCPYAYGFSDGLLQAILTFRMTFCKSNVINHFYCADPPLIKLSCSDTYIKEHAMLISAGFNLSSSLTIILVSYAF
IIAAILRIKSAEGRHKAFSTCGSHMMAVTLFYGTLFCMYVRPPTDKTVEESKIIAVFYTFVSPLLNPLIYSLRNKDVKQALKTILGQKVIRTALFLPPFNKRQQ*
259 >lcl|NP_001000301.1|Plus110605763..10606746 NW_047657 olfactory receptor Olr472 Olr472 __SEG__ Chr3 {Rattus norvegicus} MKRNFTSVTEFILLGLTNYAELQILLFVLFLVVYVVTVAGNLGMILLIKANARLHTPMYFFLSHLSFVDMCFSSNVTPKMLQIFLSERKTISYSACLVQCYLFIALVHVE
IYILALMAFDRYMAICNPLLYGSKMSQNVCTSLVTVPYVYGALTGLMETMWTYNLAFCGHNEINHFYCADPPLIKLACSDTYHKETSMFVVAGFNLSLSLLIILTSYLYI
FPAVLKISSTEGKRKAFSTCGSHLTAVIIFYATLFFMYLRPTSRESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAISKELSHKKMYFSEKKRLNFLLYSWHIL*
260 >lcl|NP_001000302.1|Plus110619568..10620500 NW_047657 olfactory receptor Olr473 Olr473 __SEG__ Chr3 {Rattus norvegicus} MLNFTDVTEFILLGLTSRKELQVLFFIIFLVVYIVTMVGNIGMMILIKISPQLSSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSKTKTISYAGCLVQCFFFIALVHVEI
FILAVMAFDRYMAIGKALLYGSKMSRVVCIRLISFPYIYGFLTSLAATLWTYGLYFCGKTEINHFYYADPPLIKMACAGTFVKEYTMIILAGINFTYSLSVVIISYLFIL
IAILRMRSAEGRRKAFSTCGSHLTAVGIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMEKVISRKFLTK*
261 >lcl|NP_001000303.1|Plus1complement(10654496..10655461) NW_047657 olfactory receptor Olr476 Olr476 __SEG__ Chr3 {Rattus norvegicus} MAERNSTGVTEFILLGFAVHREVEIILFMLILVVYSLTLIGNVGMISLIRMDSRLHTPMYFFLSNLAFVDLCYSSSVAPKFLEILLSNKRSISFYACATQLGFFLNFLIS
EMFLLAVMAYDRYVAICNPLLYMVIMSQKVCLRLVVGPYFYSFAVALLHTVVTFKLIYCGPNIINHFYCDDVPLMALACSDTSLKEILIFIFAGFNMISSLTTVLISYLY
IVAAILRIRSTEGRYKAFSTCASHLTAVTIFYGTLIFMYLQPKSSHSLDTDKMASVFYTIVIPMLNPMIYSLRNQEVKSALRKALENCYLLPLMHLKKGIF*
262 >lcl|NP_001000304.1|Plus110680418..10681377 NW_047657 olfactory receptor Olr477 Olr477 __SEG__ Chr3 {Rattus norvegicus} MAEVNISYVSEFILKGITDRPELQVPCFVVFLTIYLVTVIGNIGLIVIIRVDSRLHTPMYFFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMIT
ECFLLASMAYDRYVAICSPLHYSTLMSKRVCIQLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCDDLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYLF
IIAAILRIRSTQGRRKAISTCGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDASKKALDKGYETLKLLKLNK*
263 >lcl|NP_001000305.1|Plus1complement(10710389..10711330) NW_047657 olfactory receptor Olr479 Olr479 __SEG__ Chr3 {Rattus norvegicus} MADGNISAVSQFIFVGLTDDPGLEIILFAVFLVIYLTTVSGNLGLIMLIHYSPQLHTPMYFFLSHLAFVDFCYTSSVTPNTIINFLRKVKSITFYACATQVCCFITFAVC
EMYLLSVMAYDRYVAIWNPLLYAVLMPRRLCLQVIASTYIYGFTVDLVQAVATFHLSFCGSNVVNHFYCDDVPLVALACSDTHVKELMLLIIAGFNTLCSLLIVIISYVF
IVFAILRMHSAEGRRKAFSTCASHLTSITIFYGTIIFMYLQPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKSALKRITDKLSLIIR*
264 >lcl|NP_001000306.1|Plus1complement(10780118..10781065) NW_047657 olfactory receptor Olr484 Olr484 __SEG__ Chr3 {Rattus norvegicus} MAPRNLSHITEFILVGVSDLPELQVPLFFVFLIIYLLTAAGNLGIITLTTVDSRLQTPMYFFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVA
EIFMLAVMAYDRYVAICNPLLYMVVVSRRVCLLLMSLTYFYGFCTAIVVSSCVFSVSYCSSKKINHFYCDNVPLLALSCSDTYLPETVVFISAATNLFFSMSIVLVSYFN
IVLSILRIRSSEGRKKAFSTCASHMMAVTVFYGTLLFMYLQPQTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALKKFITNPCDSFKSL*
265 >lcl|NP_001000307.1|Plus1complement(10795712..10796662) NW_047657 olfactory receptor Olr485 Olr485 __SEG__ Chr3 {Rattus norvegicus} MGKFNHTARTQVTEFILLGLTNNPDLKAPLFGLFLTIYLVTLMGNLGMVVLTHLDSKLHTPMYFFLRHLSITDLGYSTVIGPKMMVNFVMQQNIISYTECAVQLTFFEIF
IITELFILSAMAYDRYVAICKPLLYVIIMAGKVRWGLVLVPYLYSIFVSLLLTVKLFTLSFCDSNVISYFYCDCVPLLSLLCSDTHELELIILIFSGCNLLSSLLIVLVS
YMFIFVAILRMNSREGRSKAFSTCSSHLTVVVVFYGTLLFIYLQPKSSHTFEIDKMASVFYTLVIPMLNPLIYSLRNKEVKEALKRTLTHGLRIPT*
266 >lcl|NP_001000308.1|Plus1complement(10833242..10834168) NW_047657 olfactory receptor Olr488 Olr488 __SEG__ Chr3 {Rattus norvegicus} MAQPNVTMPTEFILMGVTQTAVLKLPLFAVFLAVYAITVVGNLGMIILTKLDSRLHTPMYFFIRHLAFIDLGNSTTICPKMLVNFVVDQNTITYYACATQMACFIMFIVS
ELTVLSSMAYDRYVAICNPLLYSAIMSQRRCQVLVGIPYLYSTFQALLFPIKYFTSSFCGANVISHFYCDVVPLLPLICSHVEETELLTILFSAFNLISSLLVILLSYML
ILLTICRMRSAEGRKKALSTCGSHLTVVVVFYGSLLFMYVQPKSAHSFEYDKMASVFYTLVIPMLNPLIYSLRNKEVKNAFHRICKNI*
267 >lcl|NP_001000309.1|Plus1complement(10916695..10917636) NW_047657 olfactory receptor Olr493 Olr493 __SEG__ Chr3 {Rattus norvegicus} MENQNLSVLSEFILLGITDRPELQAPFFVLFFLIYVASMVGNLGMIILTKLDERLQTPMYFFLRHLAFIDFGYSTAVGPKTLVNFVTNNNTIPYNWCAIQLSLFIFFIIS
ELFVLSAMAYDRYVAICNPLLYTVIMSQKVCWVLVTIPYLFSAFLSLITTIKIFISSFCGHNVISHFYCDSLPLLTLICSGTRDIELIILIFSAFNLVSSLSVVLVSYIF
ILVAILRMNSAEGRHKAFSTCGSHLTVVVILYGTLSFMYIQPKSSHSFENDKMASVFYTLIIPVLNPIIYSLRNKEVKGALQKLWKNFSKVCV*
268 >lcl|NP_001000310.1|Plus1complement(10932105..10933052) NW_047657 olfactory receptor Olr495 Olr495 __SEG__ Chr3 {Rattus norvegicus} MAPGNLTHVTEFILMGVSDRPELQVPLFFLFLVIYLLTAAGNLGIITLTTVDSRLQTPMYFFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVA
EIFMLAVMAYDRYVAICNPLLYMVVVSRRVCLLLVFFTYLFSFVTAIVVTPCVFSVSYCSSNVINHFYCDNVPLLALSCSDTHLPETVVFFFSATNLFFSMIIVLISYFN
IILAILRIRSSEGRKKAFSTCASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPVIYSFRNKDVKCALKEFLKNPCKRFNLI*
269 >lcl|NP_001000311.1|Plus1complement(11023872..11024813) NW_047657 olfactory receptor Olr502 Olr502 __SEG__ Chr3 {Rattus norvegicus} MESHNFTMVTEFILVGITDSSELQVPLFGLFLFIYLITLVGNLGMVILTMVESRLQTPMYFFLRYLATTDLGYSTAVGPKMLRNFLVEQNTISFYFCAVQLSFFNMFIVS
EFFILSAMSYDRYVAICKPLLYNVIMSPRMCWVLIAITYLYSIFVALIVTINIFSSPFCGHNIINHFYCDGLPLISLLCSYKKENEMIILILSTINLISSPLVILTTYLL
ILRAIFRMNSSEGRQKAFSTCGSHLTVVTVFYGTLIFMYVRPKSSPSLNNDKVASIFYALIIPMLNPLIYSLRNKDVKYVLRKTGKTLQNISS*
270 >lcl|NP_001000312.1|Plus1complement(11149812..11150744) NW_047657 olfactory receptor Olr510 Olr510 __SEG__ Chr3 {Rattus norvegicus} MENITEVTEFILKGFTDNADLEILSFFLFLAIYLFTLMGNIGLIALVIGDSRLHNPMYYFLSVLSSVDACYSSVITPQMVVDFLLEKKVISFIGCATQMFLAVTFGTTEC
FLLAAMAYDRYVAIHNPLLYVVSMSPRVYVPLIIASYAGGILHAVIHTVATFRLSFCGSNEVSHIFCDIPPLLAISCSDTHINQLLLFYCAGFIEVATILIVLLSYGFIL
SAILKTRSIEGKRKVFSTCGSHLTAVSTFHGTVLFMYVRPSASYALEHDMVVSIFYSIVIPMLNPLIYSLRNKDVKEAIKKVFGKRLICG*
271 >lcl|NP_001000313.1|Plus1complement(11204843..11205778) NW_047657 olfactory receptor Olr513 Olr513 __SEG__ Chr3 {Rattus norvegicus} MEKQNLTVVNDFILIGFTNHPDLKGPLFVLFLIIYLISFMGNMGMIILTIVDSRLQTPMYFFLKHLAVTDLGYSTAVGPKMLENFVVNQNTISYYLCATQLACFLLFVTC
ELFILSAMSYDRYVAICNPLLYTAIMSQKKCWLLVVIAYLYGLFLSLTITLKMFRLSFCSYNVINHFFCDCIPLIPLICSNTHELQLTILTFAIFDLISSLLVVLVSYLL
ILIAILRMNSTEGRRKAFATCGSHLTVVIVFYGTLISMYLQPNYSHSFDTDKLASIFYTMVIPMLNPLVYSLRNKDVKDARQRIWKKMCKI*
272 >lcl|NP_001000314.1|Plus1complement(11221222..11222163) NW_047657 olfactory receptor Olr514 Olr514 __SEG__ Chr3 {Rattus norvegicus} MKEHNFTVMTEFILLGITDRSDLEVPLFGLFLVIYMTSMVGNLGIIVLTKVDSRLQTPMYFFLRHLAITDLGYSTAVGPKMLENFVVDQNTISFHLCATQLAFFLVFIGS
ELFILSAMSYDRYVAICKPLLYTVLMSPKVCWVLMAMPYLYCTFVSLLITVNIFTSSFCGYNIINHFFCDCIPLLSLLCSHAEEIAFIVMIFAAFDLIVSLLIVLVSYMF
ILTAVLRMNSAEGRYKAFSTCGSHLTVVTVFYGTLIFMYVQPQSSHSTDTDKVSSIFYTLVIPMLNPLIYSLRNKDVKFALQRTWRNICKTFP*
273 >lcl|NP_001000315.1|Plus111259529..11260494 NW_047657 olfactory receptor Olr515 Olr515 __SEG__ Chr3 {Rattus norvegicus} MITSAVGVDKIPLENMTEATMFILLGFTDDFELQVFLFLLFLAIYLFTLIGNFGLVILVIGDCRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLNENKSISFLACATQ
MLLFVTLGTTECFLLAAMAYDRYVAIYNPLLYTVTMSPRVYLPLIIASYTGGVMHGAIHTVATFSLSFCGSNEIRHVFCDIPALLALSCSDTRTNELLLLYLVGLIEIVT
ILIVLVSYGFILFAILNMHSTEGRRKVFSTCGSHLTGVSIYHGTILFSYMRPSSSYASNHDMVVSIFYTIVIPMLNPIIYSLRNKDVKEAMKKLWRNVVHN*
274 >lcl|NP_001000316.1|Plus1complement(11284441..11285376) NW_047657 olfactory receptor Olr516 Olr516 __SEG__ Chr3 {Rattus norvegicus} MKNITEATSFILKGLTDNMELQIILFFLFLAIYLFTLIGNVGLIILVVGDPQLHNPMYCFLSVLSSVDACYSSDITPNMLVGFMSKSKIISIHGCATQMFLAVTFGTTEC
FLLAAMAYDRYVAIHNPLLYAVSMSPQIYVPLIIASYAGGIVHAIIHTVATFRLSFCQSNEIKHIFCDIPPLLAISCSETYINELLLFFFVSFIELVTILIVLISYAFIL
LSILKMNSSEGRRKVFSTCGAHLTAVSIFYGTILFMYVRPSSNYSLEHDMIVSTFYTIGIPMLNPIIYSLRNKDVKEAMKRLLRKHFHIKH*
275 >lcl|NP_001000317.1|Plus111330315..11331307 NW_047657 olfactory receptor Olr517 Olr517 __SEG__ Chr3 {Rattus norvegicus} MSRHPLGYSVQRIPVNNVTDITMFILTGFTDDADMQALLFILFFVIYLFTLIGNLGLVLLVIGDSRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLSKDKSISYPGCV
TEMFLFVTFGTTECFLLAAMAYDRYVAIYNPLLYAVKMSPTVYIPLIIACYSGGIMHATIHTVATFSLSFCASNEIRHVFCDIPPLLAISCSNTNINQLLLFYCVGVIEI
ITILIVLVSYSFILFAILKMRSAEGRRKIFSTCGSHLTGVSIYHGTILFMYVRPSSNYALEHDMIVSTFYTIVIPMLNPIIYSLRNKDVKEAMKKIFERNLFMNKVHLKF
*
276 >lcl|NP_001000318.1|Plus111399300..11400268 NW_047657 olfactory receptor Olr519 Olr519 __SEG__ Chr3 {Rattus norvegicus} MKRIISAVDVHKIPLENVTEVTTFILLGFTDDFELQVFLFLLFLDIYLFTLIGNFGLVVLVIGDCRLHNPMYYFLSVLSFLDACYSTAVTPKMLVNFLNENKSISLLGCA
TQMLLFVSLGTTESFLLAAMAYDRYVAIYNPLLYAVIMSPRVYLPLIIASYAGGVVHGVIHTVATFSLSFCGSNEIRHVFCDIPALLALSCSDTRTNELLLMYLVGLIEA
VTILIVLVSYGLILFAILNMHSAEGRRKVFSTCGSHLTGVSIYHGTILFSYMKSSSSYASNHDMVVSIFYTIVIPMLNPIIYSLRNKDVKEAMKKLWRKCSS*
277 >lcl|NP_001000319.1|Plus1complement(11680872..11681813) NW_047657 olfactory receptor Olr528 Olr528 __SEG__ Chr3 {Rattus norvegicus} MNAWNHTTETEFILMGLTDSKEVQLVLSVLFLLIYMLTVLGNIGMILIIHLDVQLHTPMYFFLTHLSFLDLSYSTVITPKTLQNLLTSIKNISFMGCFTQLYFFVLLAAT
ECFILSSMAYDRYVAICNPLHYPAIMSPRRCHALITVSYMIGALDSSVTVFCLSTLDFCNSKVIHHFFCDTFPILALSCSDTYGAEATIFYLAGSTLLLSLIIISSSYVS
VLSTILKINSSSGKHKAFSTCASHLLGVTVFYGTMIFTYLKPSKSYSLGKDQVASVFYTVVVPMLNPLIYSLRNKEVKSAAIRVVKKREYTQK*
278 >lcl|NP_001000320.1|Plus1complement(11839762..11840700) NW_047657 olfactory receptor Olr539 Olr539 __SEG__ Chr3 {Rattus norvegicus} MANVNFTFVTEFILLGLTDRGEIKVFLFILFLLIYVISLVGNLGLFMLIHITPKLHTPMYHFLRSLSFVDACYSSVFAPTLLLNFFVERERISFSACILQYFLFASLLTT
EGFLLAAMAFDRYMAIANPLTYTVAMTKLICVLLVLGSCLGGTITSLTHTIGLMNLCFCGPNVISHFFCDLPPLLKLSCSDTSMNELLLLVFSGVIAMTTLLTVVLSYIF
IVAAILRIRSAAGRHKAFSTCASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSIFYTLVIPMLNPLIYSLRNKDVKDAVKRVIEIKHSLH*
279 >lcl|NP_001000321.1|Plus1complement(11881336..11882274) NW_047657 olfactory receptor Olr540 Olr540 __SEG__ Chr3 {Rattus norvegicus} MRLWNHTGVKEFILVGLTENLNWQVGLLFLFSIIYFIILVGNWGMILLIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSKYKSSTFFGCVIQSFFFAVYITT
EGILLSMMAYDRYVAIANPLMYTVIMTHSICSQMVLVCYLGGLINSLTHTIGLLRLDFCGPNIVDHFFCDIPPLLKLSCSDAHINEMLLLVFSGVIAIFTFIIVMVSYIQ
IIIAILRIRSAEGRRKAFSTCASHLTAVTLFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAKRSVCRERSGP*
280 >lcl|NP_001000322.1|Plus1complement(12187515..12188453) NW_047657 olfactory receptor Olr550 Olr550 __SEG__ Chr3 {Rattus norvegicus} MRLWNHTGVEEFILVGLTENLNWQVGLFFLFSIVYFIILVGNWGMILLIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSEYKSSTFFGCVIQSFFFAVYITT
EVILLSMMAYDRYVAIANPLMYTVIMTHSICSQMVLACYLGGLINSLTHTIGLLRLDFCGPNIVDHFFCDIPPLLKLSCSDAHINEMLLLLFSGVIAIFTFIIVMVSYIQ
IIIAILRIRSAEGRRKAFSTCASHLTAVTLLYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAKRSICRESGGP*
281 >lcl|NP_001000323.1|Plus112275697..12276647 NW_047657 olfactory receptor Olr554 Olr554 __SEG__ Chr3 {Rattus norvegicus} MDPLYSLQQNHSTLVEFILLGFSDVPNLQEFLFWVFLIIYVIILMGNSLIIIITKVDLSLRTPMYFFLSNFSFLEMCYVSVTLPRLLTDLYRQHRIISFMACATQMYFFL
VFGATECFILTAMAYDRYVAICNPLLYPLIMNNSLCIQLAAGCWISGVPVHIGFTYWIFSLPFCGSNQLNHFFCDIPPVLTLACGDTFMIEMLIYVIALLVVTIPFMLIL
GSYVKIISNILKLPSAIGRAKAFSTCSSHVIVVALFFGSGIITYLRPKSSHSAGLDKFLSLFYTVVTPMFNPMIYCLRNKDVMIALKKFLLRWLML*
282 >lcl|NP_001000324.1|Plus112396511..12397431 NW_047657 olfactory receptor Olr558 Olr558 __SEG__ Chr3 {Rattus norvegicus} MDNATTVTQFLLLGFSDLHNLQTFLFGMFSIMYVVILIGNSFILVIVRIDPTLQKPMYYFLANFSFLEICYVSVTLPRILYNLWTQDRRICLLECAIQMFFFLILAATEC
FLLAVMSYDRYVAICNPLHYPLVMNPTKCTQLAVGSWLGGIPVQIGQTCRIFSLHFCNSNIIEHFFCDVPPILKLACGDTSMHELSVYLVAMVFVASPFMMILASYSKII
ATILKLPTATGRAKAFSTCSSHLMVVVLFFGSATINYLRPKSIHSVRTDELLSLFYTIVTPMFNPLIYSLRNKDVIAALRRLLLKI*
283 >lcl|NP_001000326.1|Plus1complement(12597218..12598144) NW_047657 olfactory receptor Olr567 Olr567 __SEG__ Chr3 {Rattus norvegicus} MVKRNCSSLDEFIFLGITNNPEMKVALFTTFLLVYLINLLANLGMIILIRMDTQLHTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAEEKSIPTVGCALQFFTLCAFVDS
EYLLLAVMAYDRYQAINNPLLYTVNMSSRLCSLMMAGVYLVGTADALIHTTLAFSLCFCRSNEINHFFCDVPTLLLRSCSDTEANELAIFTIFGFIELSTISGLLVSYCY
IISSVLKISSDEGRFKAFSTCASHLTAVAIFQGTLLFMYFWPSSSYSLDEDKMTSLFYTLVIPMLNPLIYSLRNKDVKEALEKLKTKR*
284 >lcl|NP_001000327.1|Plus112733386..12734315 NW_047657 olfactory receptor Olr575 Olr575 __SEG__ Chr3 {Rattus norvegicus} MDIGNCSLNEFIFVGVTNNPEMKGTLFTIFLLIYLINLLGNLGMIILIRMDPQLHTPMYFFLSHLSFCDLCYSTAIGPKMLVDMFGKNKSIPFWGCALQLFIFCTFADSE
CVLLAVMAFDRYQAISNPLLYTVNMSSRKCFMLMAGVYLVGTSDALIHTTLAFRLCFCGSNEINHFFCDLPPLYLLSCSDTQVNYLVLFTVYGFLELSTISGVLVSYCYI
IASVFKIRSTEGRLKAFSTCTSHLTAVAIFQGTLLFTYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEALEKIKRKSWF*
285 >lcl|NP_001000328.1|Plus1complement(12740276..12741202) NW_047657 olfactory receptor Olr576 Olr576 __SEG__ Chr3 {Rattus norvegicus} MDKKNCSSVGEFIFLGITNNPDMKVALFTTLLLVYLINLLANLGMIILIRVDTQLQTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAEEKSIPIVGCALQFFTFCVFADS
ECLLLAVMAYDRYQAINNPLLYTVNMSSRLCSLLMSGVYLVGTADALIHTTLAFRLCFCRSNEINHFFCDVPPLLLISCSDTEANELAIFTIFGFIELSTISGVLVSYSY
IILSVLKICSAEGRFKAFSTCASHLTAVAVFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEALAKLKNNW*
286 >lcl|NP_001000329.1|Plus112964180..12965124 NW_047657 olfactory receptor Olr588 Olr588 __SEG__ Chr3 {Rattus norvegicus} MEFTNGNYTLVTEFILLGFPTRPELQIILFLLFLMLYGMILIGNIGLMLLIRTDSHLQTPMYFFLSNLSFVDLCYSSVIVPNMLVNFLSSKKSISYLGCALQFYFFCTFA
DTESFILAAMAYDRYVAICNPLLYTVAMSKSLCTWLIVLSYVGGNMSSLVHTSFAFILKYCDKNIINHFFCDLPPLLKLSCTDTSINEWLLSTYGSSVEVICFFIIIISY
FFILLSVLKIRSTSGRKKTFSTCASHLTSVAIYQGTLLFIYSRPSSLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAAKKALRSKIQSS*
287 >lcl|NP_001000330.1|Plus112999631..13000566 NW_047657 olfactory receptor Olr592 Olr592 __SEG__ Chr3 {Rattus norvegicus} MKHEVEAEGNISTVMQFVLLGFSALPNLQGILSALFSLIYMIILTGNCLIILITRLDHTLQKPMYFFLANFSCLEICYVSVTVPRILFNIWTQDRNISVLACAVQMCFFL
MLGTDECFLLAVMSYDRYVAICNPLHYPVVMNSKKCTQLAAGSWISGIPIQIGQTCWIFSMHFCNSNEIDHFFCDIPPILKLACGDTSVHELSVYVVVMVVAAFPFILVL
TSYSKIIATILRLPTAKGRAKAFSTCSSHLLVVVLFYGSGTITYLRPKSMHNPGTDKLLSLFYTIVTPMFNPLIYTLRNKEVIVALRKLIV*
288 >lcl|NP_001000331.1|Plus113075771..13076703 NW_047657 olfactory receptor Olr597 Olr597 __SEG__ Chr3 {Rattus norvegicus} MEVGNCSATEFLFLGITNNPVIKVILFTIFLIVYLIILIENVGMIILIRVDHQLHMPMYFFLSHLSFSDVCYSTAVGPKMLLDLLAKSSNSITFLGCVLQFFIFCIFTDV
ECMLLAMMAFDRYKAISNPLLYAVDMSSKVCYQLLAVVYVVGIVDAVVHTTLTFRLCFCGSNEINHFFCDLPPLYLLSCSDIQVNELALFTVFGFIELSTISGVLVSYCY
IILSVLKIRSAEGRFKAFSTCTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEALQKLKTKTWF*
289 >lcl|NP_001000332.1|Plus113083506..13084438 NW_047657 olfactory receptor Olr598 Olr598 __SEG__ Chr3 {Rattus norvegicus} MEVGNCSATEFLLLGITNNPVIKVILFSTFLIVYLMILIENLGMIILIKMNPQLHTPMYFFLSHLSFSDICYSTAVGPKMLVGLMTKSNAIPFIGCAVQFFIFCIFTDAE
CVLLAVMAFDRYKAISNPLLYAVDMSGVVCYQLLAVVYLVGMVDALTHTTLTFCLCFCRSNEINHFFCDVPPLLLLSCSDTEVNELVIFTLFGFIELSTISGVLISYCYI
ISSVLKIRSTEGRFKAFSTCTSHLTAVAIFQGTMLFMYFRPSSAYSLDQDKMTSLFYTLVIPLLNPLIYSLRNKDVKASVKKSLRNRISI*
290 >lcl|NP_001000333.1|Plus1complement(13133088..13134026) NW_047657 olfactory receptor Olr602 Olr602 __SEG__ Chr3 {Rattus norvegicus} MVEENCSTVAQFILLGFSDVPELSGFLSSIVLLIYGVTVLANLGMTTLIQFSSQLHTPMYFFLSHLSFVDFCYSSVIVPKMLANIFNMDKAISFLACMVQFCLFCTCVIS
EIFLLTVMAYDRFVAICNPLLYTAIMSSDLCIILVSGCYLCASMCSLVHLCLALEIPSFKSNVINHFFCDLPPLLGLACSDVTINKVLLFVVATFNESVSIVVIFTSYLF
ILITILRMRSVEGRRKAFSTCASHLTVIIVFHGTILSIYCSSTSDNSGDADKVATVFYTVVIPMLNPLIYSLRNKDVKDALRKFVNNKIYSQ*
291 >lcl|NP_001000334.1|Plus1complement(13283967..13284917) NW_047657 olfactory receptor Olr607 Olr607 __SEG__ Chr3 {Rattus norvegicus} MVPMERNVSVEIIFVLVGFTDYPELQIPLFLVFLFMYIITVVGNLGMIVLINIDPKFHTPMYFFLSHLSFVDFCYPTIIMPKLLENLILADKTILYFSCMLQYFLSCVAV
VAESYLLAVMAYDRFVAICNPLLYTVAMSQRLCILLVTGSYIWSTLATLILLCYALQLKFSRFTVINHFFCEYTALIAVSSSDIHIPSLLLFCFATFNEVSTLLIILTSY
VFIFVTVLKIKSASGRRKAFSTCASHLTAITIFHGTILSLYCVPNPQNSRNAVKVASVFYAVVNPLLNPLIYSLRNKDVKEVLQKVVSTSLKFPLH*
292 >lcl|NP_001000335.1|Plus1complement(13316968..13317918) NW_047657 olfactory receptor Olr609 Olr609 __SEG__ Chr3 {Rattus norvegicus} MMLDLGNESTVTMFILLGFSEYPHLHAPLFLLFFMIYAVTLFGNMGIIVARKINPKLHTPMYFFLSHLSFLDICYSTVFTPKLLEILIVENKTISFKGCMTQFFFICAFV
ITEMFMLAVMAYDRFVAVCNPLLYTVSMSPKLCAFLVAGTYMWGILCSMTITYSLLQLSYCGPNIINHFGCEYSAILSLSCSDPTFSQVICLIISIFNETCSLLIILASY
AFIVVTIIKMPSKGGLQKAFSTCSSHLTAISIFHGIILLLYCVPNSKNSWLVVKVATVLFTVMIPMLNPLIYSLRNKDVKGTISRLMRLKLQAHTT*
293 >lcl|NP_001000336.1|Plus1complement(13343674..13344624) NW_047657 olfactory receptor Olr610 Olr610 __SEG__ Chr3 {Rattus norvegicus} MASEVTNQSSVTTFILVGFSEYPQLQIPLFLLFLAIYSVTLMGNLGILVVIKINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLQILIMEDRTISFTGCMIQFFFICTFV
ITEMFMLAVMAYDRFVAVCNPLLYTVVMPFQFCALLVAGTYMIGGLCAVILIYTLLQLSYCEYGIINHFGCEYSAVISVSCSDSSFSQITCLVISIVSESSSVLITLASY
VFIVVTIIKMPSKGGLRKAFSTCTSHLTAITIFHGIILLLYCVPNSNSSRLFVKVATALYTVMIPMLNPLIYSLRNKDVKDTVRRLISSKLHSHLT*
294 >lcl|NP_001000337.1|Plus1complement(13386186..13387136) NW_047657 olfactory receptor Olr614 Olr614 __SEG__ Chr3 {Rattus norvegicus} MIHAMINQSSVTTFILVGFSEYPHLQLPLFLMILTIYTITLVGNVGIIVIRRINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLEILIVENRTIFLKDCMTQFFFGCACV
ITEMFMLAVMAYDRFVAVCNPLLYTVAMSHQLCGLLIAGSYMWGGLCAVIITYTLLELSYCEPGIINHFGCEYSAIISVSCSDPSFSQMTCLVISILSEGSSLLITMASY
VFIVVTIIKMPSKGGLRKAFSTCTSHLTAISIFHGIILLLYCVPNAKSSQLLVKIATVLYTVLIPMLNPLIYSLRNKDVKDTVKRLIGSKLHRHSM*
295 >lcl|NP_001000338.1|Plus113490357..13491328 NW_047657 olfactory receptor Olr619 Olr619 __SEG__ Chr3 {Rattus norvegicus} MDYRTNITEFLLLGFSQTKEIQIICFVLFLLCYIAILFGNLLIIISVTCSHLLNQPMYFFLSYLALSDLCYTSTVTPNLIKNLVATRKSISYNGCMTQLFTMHFFGGIEV
FILTGMAYDRYVAICKPLHYTIIMNRQKCDAVIVASCAGGFLHSFGQFLLAVFLPYCGPNVIDHYFCDVYPLLKLACTDTRKIGFLVIANSGLMGLVTFLVLLISYAVIL
YTVRSYSTENRRKALSTCSSHVTVVVLFFAPLLFIYIRPATTLPEDKVFALFYTIIAPMLNPLIYTLRNKEMKNAIKRLCYHITGSEGSRMNGFTVFHHHTVS*
296 >lcl|NP_001000341.1|Plus1complement(14131116..14132042) NW_047657 olfactory receptor Olr651 Olr651 __SEG__ Chr3 {Rattus norvegicus} MQLNINVTEFILLGLTQDPSRKKIVLAIFVFFYMGTLIGNLLIIVTIKTSQALGSPMYFFLFYLSLSDTCFSTTVAPRTIVDSLLKTASISFNECIIQVFTFHLFGSLEI
FILILMAVDRYVAICKPLHYMTIMNRQVCGMLVAIVCGGSCVHSLVQIFLALSLPFCGPNEIDHYFCDLQPLLKLACSDTYVINLLLVSNSGTLCTVSFLMLMVSYIIIL
YSLRNHSAEGRRKALFTCVSHIIVVILFFVPCIFIYTRPATTFPMDKMISVFYTICTPFLNPLIYTLRNAEVKNAMRKLWTRKISDDI*
297 >lcl|NP_001000342.1|Plus114217103..14218032 NW_047657 olfactory receptor Olr655 Olr655 __SEG__ Chr3 {Rattus norvegicus} METSNNVTEFVLLGLTQNLHMQKIIFVVFLVIYVFSVVGNLLILITITNSQLLGSPMYYFLAYLSFIDACYSSVNTPKLIFDSLHKKKSIKFNGCMTQVFAEHFFGGAEV
ILLTVMAYDRYVAICKPLHYATIMNRQLCNILVGVSWFGGFLHGGIQILFMIGLPFCGPNVIDHFMCDLNPLLALACVDTHILGLFVAANSGFICLLNFLLLLVSYLVIL
HSLKNHSAEGRRKALSTCVSHITVVVLFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLRNAQMKNAIWKLFSTKVQSDDI*
298 >lcl|NP_001000343.1|Plus1complement(14271370..14272302) NW_047657 olfactory receptor Olr657 Olr657 __SEG__ Chr3 {Rattus norvegicus} MQLNINVTEIILLGLTQDPSRKNIVFAIFLFFYMGILLGNLLIIVTIKTSQALGSPMYFFLFYLSLSDTCFSTTVAPRTIVDSLLKEASISFTECIIQVFTFHFFGCLGI
FILILMAVDRYVAICKPLHYMTIMSHRVCGVLVALAWVGSCVHSLVQIFLALSLPFCGPNVIDHNFCDLQPLLKLACSDTYMINLLLVSNSGAICTVSFLMLMVSYVIIL
HSLRNHSAEGRRKALSTCISHIIVVIIFFGPCIFIYTRPATTFPLDKMVSIFYSIGTPFLNPLIYTLRNAEVKNAMKKLWRRKVVSDDRK*
299 >lcl|NP_001000344.1|Plus1complement(14285777..14286706) NW_047657 olfactory receptor Olr658 Olr658 __SEG__ Chr3 {Rattus norvegicus} MENHKNVTEFIFMGLWENRQIELLFFLLFLLCYLAVLMGNSVILVTITCSHLIEQPMYYFLCHLSLMDLCYTSTVIPRLIRDLAATRKNISYNECMTQLFTAHLLAGVEI
FILVSMALDRYVAIVKPLHYMVIMRRKRCDMLIVTAWIVGFWHSIALLLMVLSLPFCGPNHINHYFCDVKPLLKLVCKDVHVVSVLAMANSGMVLVAIFTVLLASYILIL
YSLRTRSSAGLLKALSTCSSHIMVVVLFFGPCIYTYALPAGSENKDKEISVFYTVLAPMLNPLIYTLRNSEMKSAMHKVWSWLSNSELK*
300 >lcl|NP_001000345.1|Plus114299339..14300268 NW_047657 olfactory receptor Olr659 Olr659 __SEG__ Chr3 {Rattus norvegicus} MEIRNNVSEFVLLGLTQNPHMQKIVFVVFLVIYVFSVVGNLLILITITNSQLLGSPMYYFLAYLSFIDACYSSVNTPKLIADSLHEKKSIKFNGCMTQVFAEHFFGGAEV
ILLTVMAYDRYVAICKPLHYATIMNRQLCNILVGVSWVGGFLHGGIQILFIIGLPFCGPNVIDHFMCDLNPLLALACVDTHILGLFVAANSGFICLLNFLLLLVSYLVIL
HSLKNHSAEGRRKALSTCVSHITVVVLFFVPCIFVYMRPAATLPIDKAVAMFYTMITPMLNPLIYTLRNAQMKNAIWKLFSTKVHSDDK*
301 >lcl|NP_001000346.1|Plus1complement(14418252..14419187) NW_047657 olfactory receptor Olr663 Olr663 __SEG__ Chr3 {Rattus norvegicus} MQNQSLVTEFIFLGLSQNPKFQKIVFIVFLFVYIATVGGNMIIVVTIVCSPALIDCPMYFFLAFLSLLDACFSSVITPKMVVDSLYEKKTISFEGCMIQLFAEHFLAAVE
VIVLTAMSYDRYVAICKPLHYSSIMNWRLCGTLMGIAWTGGFLHSIIQIIFTLQLPFCGPNVIDHFMCDLFPLLELACTDTHIFGLLVVANSGSICIIIFSILLVSYGVI
LFSLRAHSSEGRWKALSTCGSHIAVVVLFFVPCIFIYARPPSAFSFDKMVAIFYTILTPLLNPVIYTFRNKDMKNAMKKVWKRLMVVSDGK*
302 >lcl|NP_001000347.1|Plus114493957..14494892 NW_047657 olfactory receptor Olr664 Olr664 __SEG__ Chr3 {Rattus norvegicus} MPNQTIVTEFILLGLSENPKVQKIVFVVFSFVYMATIGGNIIIAVTILCTPALLGSPMYFFLAFLSFLDACITSVITPKMIVDSINDSKTISFEGCMTQIFAEHFFAAVE
VIVLISMAYDRYVAICKPLHYSSIMNWRLCGTLVGIAWAGGFLHSIIQIIFTLQLPFCGPNVIDHFMCDLFPLLELACTNTYVYGLLVFANSGSICIIIFSMLLISYGVI
LFSLRSHSSEGRWKALSTCGSHIAVVVSFFVPCIFIYARSTSASSFEKKVAVFDGIMTPLLNPLIYTFRNKEMKNAIRKMWNRFRMVSDKF*
303 >lcl|NP_001000348.1|Plus1complement(14570634..14571569) NW_047657 olfactory receptor Olr668 Olr668 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFLLLGLSQNPKVHKIIFIAFLFVYIATFGGNMIIVVTIINSHALLGSPMYFFLAFLSFLDACISSVITPKITVDLLYERRTISFDGCMAQVFAVHFFTGVE
VIILITMAYDRYVAICKPLLYSSIMNRRLCAILVGIAWTGGFLHSIIQIIFILYLPFCGPNVIDHFLCDLFPLLKLACTDTHIFVILVFANSGSICIIIFSLLLVSYGVI
LFSLRAHSSEGRHKALSTCGSHITVVVLFFVPCILIYARPASAFFSEKNVFLFATILTPLLNPMIYTFRNKEMKNAIRKMWKRLILDYGLS*
304 >lcl|NP_001000349.1|Plus1complement(14586028..14586963) NW_047657 olfactory receptor Olr669 Olr669 __SEG__ Chr3 {Rattus norvegicus} MYNQSFVNEFILLGLSQNPQIKKISFVIFLLVYIATLVGNMMIVVTIAYSPALLGSPMYFFLAVLSFLDACVSSVVTPKMIVDMVYERKSISFECCMTQVFAVHFLTAVE
VIVLAAMAYDRYVAICKPLHYSSIMNRRLCGTLVGVAWAGGFLHSIIQIAFTLPLPFCGPNVIDHFICDLFPLLKLACTDTHIFIILVFANSGSICIIIFSFLLISYGVI
LFALRAHSSEGRRKALSTCGSHITVVVFFFVPCILIYARPTSAFSFEKNVFVFTDVLTPLLNPMVYTFRNKEMINAIRKMWKRLIVVSDKY*
305 >lcl|NP_001000350.1|Plus1complement(14634516..14635430) NW_047657 olfactory receptor Olr672 Olr672 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNLNVEKMLFVLFLFIYLATIGGNMIIVITIMYSPTLLGSPMYFFLAFLSFLDACTSSTVTPKIIIDCFYERKIMSFDCCMIQLFAVHFFTGAE
VIVLASMAYDRYVAICKPLHYSSIMTQRLCEVLVVVSWAGGFLHSIIQIIFTLQLPLCGPNVIDHYMCDLFPLLKLACTDTHIFVFLIFANSGAICIIIFSLLLVSYGVI
LFSLRAHSSEGRRKALSTCGSHIIVVLLFFVPCILIYARPTSAFSFEKNMLIFVNVLTPLLNPMVYTFRNKEMINAIRKMWKRL*
306 >lcl|NP_001000351.1|Plus1complement(14710628..14711563) NW_047657 olfactory receptor Olr673 Olr673 __SEG__ Chr3 {Rattus norvegicus} MQNQSSVTEFVILGLSQNPKVEKILFFVLLLVYLATVGGNMIIVVTIMYSPALLSCPMYFFLAFLSFLDLCVSSTVTPKMIVDFLHEKKTISFGWCMTQLFSVHFFSGTE
MIVLAAMAYDRSVAICKPLHYSSILTRRLCSILVAISWAGGFLHSIIQIIFTLQLPLCGPNIIDHYTCDLFPLLKLACTDTHIFVILVFANSGAICIIIFSMLLVSYGVI
LFTLRAHSYEGRRKALSTCGAHITVVVLFLVPCILIYARDTSAFSFEKDTLLFVNVLTPLLNPMVYTFRNKEMINAIRKMWKRLIVVFVRY*
307 >lcl|NP_001000352.1|Plus1complement(14719534..14720469) NW_047657 olfactory receptor Olr674 Olr674 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNVNVEKMLLVLFLFIYLSTIVGNMIIVVTIIYSPILLGSPMYFFLIFLSLLDAFTSSTVTPKIIIDCFYERKTICFECCMTQLFAVHFFTGAE
VIVLSAMAYDRYVAICKPLHYSSIMTQRLCRILVVVSWAGGFLHSIIQIIFTLQLPFCGPNIIDHYMCDLFPLLKLACTDTHIYVFMIFANSGAICIIIFSLLLVSYGVI
LFSLRAHSSEGRRKALSTCGSHIIVVILCFVPCLLIYARPTSAFSFEKNMLIFINVLTPLLNPMVYTFRNKEMKNAIRKMWMRLIVVSDEF*
308 >lcl|NP_001000353.1|Plus1complement(14817553..14818488) NW_047657 olfactory receptor Olr678 Olr678 __SEG__ Chr3 {Rattus norvegicus} MQNQSLVSEFILLGLSQNTKVEKILFLLFLLIYLATIGGNMIIVATIIYSPALLGSPMYFFLVFLSLLDACTSTVVTPKMIIGFFYEMKTISFEGCMTQLFAIHFFTAVE
VIVLSAMAYDRYVAICKPLHYSSIMSRRLCGVLVGIAWFGGLLHSIIQIIFTLQLPFCGPNVIDHYMCDLFPLLKLACTDTHIFVILVFANSGSICIIIFSLLLVSYGVI
LFSLRTHSSEGRHKALSTCGSHITVVVLFFVPCILIYARPSSAFSFEKNTLIFANILTPLLNPMVYTFRNKEMKNAIRKMWKRLIVVSDKQ*
309 >lcl|NP_001000354.1|Plus1complement(14835467..14836402) NW_047657 olfactory receptor Olr679 Olr679 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVNEFILLGLSQNPKVEKILFVVFLLVYIATIGGNIMIVVTIIYSPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCITQLFTSHFFAGVE
VIILTSMAYDRYVAICKPLHYSSIMTRRLCGTLVGVAWTGGFLHSITQVIFTLQLPFCGPNFIDHFICDLFPLLQLACTDTHIFVILVFANSGSFCIIIFSLLIISYGVI
LFSLRGHSSEGRRKALSTCGSHITVMILFFVPCMLIYARPSSAFSFEKNTLIFASVLTPLLNPMVYTFRNKEMKNAIRKMSRKLIVVSNTF*
310 >lcl|NP_001000355.1|Plus114935720..14936655 NW_047657 olfactory receptor Olr686 Olr686 __SEG__ Chr3 {Rattus norvegicus} MKNQSCVTEFLLLGISQNSKVEKILFVIFLLIYLVTIGGNMIIVVTIIYSPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCMIQLFAVHFFTGME
VIVLSAMAYDRYVAICKPLHYSSIMNRRLCVNLVMVSWAGGFLHSIIQIIFMLQLPFCGPNVIDHYMCDLFPLLKLACTDTHLFVVLVFANSGSICIIIFSILLVSYGVI
LFSLRAHSSEGKYKALSTCGSHITVVILFFVPCILTYARPISAFSFEKNAVVFTTVLTPLLNPIVYTFRNKEMKNAIRKMWKKRIIVSNKY*
311 >lcl|NP_001000356.1|Plus1complement(14942196..14943128) NW_047657 olfactory receptor Olr687 Olr687 __SEG__ Chr3 {Rattus norvegicus} MLNQSYINEFILLGLSQNSKVEKILFVIFLLIYLATIGGNMIIVVTIIYSPALLGSPMYFFLIFLSFLDACTSSTVTPKMMVDFFHERKTISFECCMTQLFAVHFFTGME
VIVLSAMAYDRYVAICKPLHYSSIMTRRLCGILVLLSWAGGFLHSIIQIIFTLQLPFCGPNIIDHYMCDLFPLLKLACTDTHIFVILVFANSGSICIIIFSILLVSYGVI
LFSLRAHSSEGRRKALSTCGSHITVVLLFFVSCILIYARPTAFSSEKNALVFATIITPLLNPMVYTFRNKDMKNAIRKMWKRLIVVSGDY*
312 >lcl|NP_001000357.1|Plus1complement(15037112..15038038) NW_047657 olfactory receptor Olr694 Olr694 __SEG__ Chr3 {Rattus norvegicus} MELHSPTSNVTEFVLLGLTQNPSLQKILFIVFLFVFLFTVLANLLIVLTISFSPTLSAPMYFFLTYLSFIDAFYTSVTTPKMIIDLLYQRRTISLAGCLTQLFVEHFLGG
SEIILLIVMAYDRYVAICKPLHYMTIMGQGLCRILVVVAWTGGILHATMQIFFMINLPFCGPNIIDHFMCDLFPLLKLACRDTHRLGIIVAANSGAMCLLIFTMLLISYI
VILQSLKSHXSEGRRKALSTCGSHFTVVVLFFVPCVFTYMRPVTTYPVDKLVTVFFAILTPMLNPIIYTARNTEVKNAMKNLLKKRVT*
313 >lcl|NP_001000359.1|Plus1complement(15256037..15256984) NW_047657 olfactory receptor Olr703 Olr703 __SEG__ Chr3 {Rattus norvegicus} MGQRNNVTEFILLGLTQDPTGQKALFVMFLLIYIVTMVGNLLIVATVIASSSLDSPMYFFLAYLSIMDSVYSTSTSPKLIMDLLSDKKTISFTACMGQLFTEHLFGGAEV
FLLVVMAYDRYVAICKPLHYLTIMNRQICILLLVIAWVGGFAHSVIQLAFVSNLPFCGPNVIDHFICDMYPLLRLACSDTYFIGLTVVANGGAICMVIFILLLISYAFIL
NSLKNYSQEGRRKALSTCSSHITVVVLFFVPCIFIYVRPVSNFPIDKSISVVFTVITPMLNPLIYTLRNAEMKNAMQKLWCKTSTTGRVRVHSTH*
314 >lcl|NP_001000360.1|Plus1complement(15502746..15503690) NW_047657 olfactory receptor Olr713 Olr713 __SEG__ Chr3 {Rattus norvegicus} MGQKNNVTEFILLGLTQDPAGQKALFVMFLLIYIVTMVGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEV
FILVVMAYDRYVAICKPLHYLTIMNRQVCILLLVVSWAGGFAHALLQVISAYLLPFCGPNVIDHFICDMYPLLGLACTDTFFLGLSVIGNNGAMSIVVFILLLVSYGIIL
NSFKTHSPEGRRKALSTCSSHIMVVILFFVPCIFTYVRPVSNFPIDKYITVFYTIFTPMLNPLIYTLRNLEIRNCMAKLWGKMFTKDIKRASPH*
315 >lcl|NP_001000361.1|Plus1complement(15615524..15616468) NW_047657 olfactory receptor Olr718 Olr718 __SEG__ Chr3 {Rattus norvegicus} MGKNNNVTEFILLGLTQDPVGQKALFILFLLMYVVTMAGNLLIMVTIIASPSLSSPMYFFLAYLSLMDAVYSTAISPKLIMDLLCNKKTISFRACMGQLFVEHLFGATEI
FLLVAMAYDRYVAICKPLHYLTIMNHQVCILLLVATWVGGFAHSVAQVLFVYDLPFCGPNVIDHFACDMYPLLVLVCSDTYFLGLTVIANDGAICMVVFIILLASYGIIL
NSLKTHSQEGKRKALSTCSSHIMVVVLFFVPCIFMYVRPVSNFPIDKSVTIFYTVVTPMLNPLIYTLRNSEIKSSMLKLWSKTLHSDTLRKSCF*
316 >lcl|NP_001000362.1|Plus1complement(15678716..15679627) NW_047657 olfactory receptor Olr721 Olr721 __SEG__ Chr3 {Rattus norvegicus} MNNITEFILVGLTQNMELQIFSFVVFFIVYLLTLAGNLLIMVTISSSRALGSPMYFFLSFLSLIDGCCSSSMTPKMLVDSLSAKKTISFTGCMTQVFAEHFFGAAEIILL
TVMAYDRYVAICKPLRYTIIMNRFVCGLLVGVAWAGGFVHATIQILFTVWLPFCGPNVIDHFMCDLTPLLKLVCMDTRNLGLFVAANSGFICLLNFLLLMISYVVILDAL
KSHSKEGRRKALSTCVSHITVVILFFVPCIFVYLRPVMTFSIDKAVAVFYTMITPMLNPLIYTLRNTEVKNAMKKLCVQVDLN*
317 >lcl|NP_001000363.1|Plus115837344..15838273 NW_047657 olfactory receptor Olr728 Olr728 __SEG__ Chr3 {Rattus norvegicus} MERMSNVTEFILLGLTQDPDLQKLLFIVCLIIYLITLAGNMLISVTIFISPSLATPMYFFLSYLSIIDGFYSSSIAPKMIYDLISEKSTISFNGCMTQLFAEHFFAADEI
ILLIAMAYDRYVAICKPLHYMTIMSRPVCIFLVGAAVILGFIHGAIQTLFMAQLPFCGPNIINHFMCDLIPLLELACTDTHTLGPLIAANSGSLCLLTFSMLVVSYVVIL
RSLRNHSSEGRRKALSTCASHVTVVVLFFVPCSYLYLRPMTSFPTDKAVTVFCTLVTPMLNPLIYTLRNEEVKRVMKKLWGQMRKVHDK*
318 >lcl|NP_001000364.1|Plus1complement(15901006..15901914) NW_047657 olfactory receptor Olr731 Olr731 __SEG__ Chr3 {Rattus norvegicus} MDSPRNVTEFFMLGLSQNPQVQRMLFVLFLLVFLVSVGGNVLIIITVAFSPTLGSPMYFFLSYLSFIDTCYSSCMTPKLIADSLHEGRAISFEGCLAQFFVAHLLGGTEI
ILLTVMAYDRYVAICKPLHYTTTMTRNVCVVLVAVAWLGGFLHSSAQLFLVLQLPFCGPNVINHFVCDLYPLLELACTDTYVIGLLVVANSGVICLLNFLMLAASYIVIL
RTLRSHSAEGRRKALSTCGAHFTVVALFFVPCIFIYMRPSSTLSIDKIVAVFYCILTPMFNPLIYTLRNAEVKNAMKNLWRK*
319 >lcl|NP_001000365.1|Plus138222034..38222972 NW_047657 olfactory receptor Olr748 Olr748 __SEG__ Chr3 {Rattus norvegicus} MNEINYTKVSEFVFLGLSTSKQIRHFFLAFSMVLYVAIVLGNTLVVFTLAFDQHLHSPMYFLLGNLSFIDLCLSTLTVPKMISDLSSGHNTISFHSCVFQIFVLHVLGAS
EMVLLVAMAWDRYVAICKPLHYLTIMNPRMCLLLLSGAWIIGFLHSVAQLGFVVHLRFCGPNEIDSFYCDLPRFIKLACMDNYRMEFMVAANSGIISIGTFFLLIISYIV
ILLTVRKHSSGDLSKALSTLSAHISVVVLFFGPCIFVYMWPFPTVPVDKFLAILDFMITPILNPAIYTLRNKDMKVAMRKLCVQLLHFRKMS*
320 >lcl|NP_001000366.1|Plus1complement(38249180..38250091) NW_047657 olfactory receptor Olr750 Olr750 __SEG__ Chr3 {Rattus norvegicus} MEKTNQSEGSEFIILGLCDSWELQAFFLVIFSSLYLTTILGNIFIVLIIITDLRLHSPMYFLLANLSFIDFCLSSVTTPKMIIDFLKEKKTISFGGCMCQIFFGHFFGGG
EMVLLVSMAYDRYVAICKPLHYSSIMNRHMCIGLVVASWIIGFVHSISQLVIIVNLPFCGSRVLDSFFCDIPLVIKLACLDIYVLEILINADSGVLAAVCFILLLMSYSH
ILTTVCLHSKDGASKALSTCTAHIIVVVLFFGPCIFIYLWPVSITWVDKFLAVFYAVITPLLNPAIYTLRNKEIKNAMKRLQC*
321 >lcl|NP_001000367.1|Plus138295466..38296398 NW_047657 olfactory receptor Olr752 Olr752 __SEG__ Chr3 {Rattus norvegicus} MDQLNASRVSEFVLLGLSSSWEMKVFLMVTFSMLYIGIILGNLFIVILVIADSHLHSPMYFLLANLSLNDVWVSSTTVPKMISDLLKEHKVISFHNCMSQICFIHIMGGV
EMVLLIAMAFDRYIAICKPLRYLSIMSPRICISFVIAGWVTGVIHALSQFSFVVNLPFCGPNKVDSFYCDFPRIIQLACTDGDKFEFVVAANSGFMSMGTFFLLLLSYVF
ILVTVWQRSSGDLSKALVTLSAHITVVVLFFTPCMFLYVWPFPTSSIDKYLFIADFAITPALNPVIYTLRNKDIRISIQRLCKRANCSRF*
322 >lcl|NP_001000368.1|Plus138359920..38360837 NW_047657 olfactory receptor Olr754 Olr754 __SEG__ Chr3 {Rattus norvegicus} MEDSNHTGVSQFIFQGLCTTRELEIFLLLPFSTLYLMTIVGNLFVVILIIIDHHLHSPMYFLLANLSFVDFCLSSVNTPKLAIDLLKENKTISFGGCMSQILCVHFFGGS
EMVLLVTMAYDRCVAICRPLHYSTIMDRQKCIWLVVISWIIGFVHAISQILLILDLPFCGPRVIDSFFCDIPLVMKLACVNTDTLEILINADSGILATTCFILLLISYTY
ILLTVKLHSKDGSSKALSTCTSHIIVVVLFFGPIIFIYLWPVNITWVDKFLAVFYTVITPFLNPAIYTLRNKDIKNAIRKLINHM*
323 >lcl|NP_001000369.1|Plus138439276..38440214 NW_047657 olfactory receptor Olr758 Olr758 __SEG__ Chr3 {Rattus norvegicus} MDQVNASIVTEFLLLGLAQSFGTQIFFGLLFSLFYVGILFGNLFIVFIVIFDSHLHSPMYILLANLSLIDLGLSSTTIPRTISDIFTGCKVISFHSCMIQMFFIHVMGGV
EMVLLIAMAYDRYIAICKPLHYLMIMNPKTCIILVVAAWVIGMIHAVSQFMFVINLPFCAPYNVGSFYCDFPRVIKLACMDTYKLEFVVSANSGFISMCTFFFLITSYIF
ILVNVRQHSSTDLSKAFFTLSAHITVVVLFFIPCMFLYVWPFPTKSLDNFFAIVDFVLTPILNPTIYTLRNKDMRLAIRRLSRQVLSSNEFT*
324 >lcl|NP_001000371.1|Plus1complement(38605064..38606002) NW_047657 olfactory receptor Olr769 Olr769 __SEG__ Chr3 {Rattus norvegicus} MDGENQTVVSEFIFWGLANSKNLQLLLFLIFLMLYLLIVSGNIVILILITTDPHLHSPMYFLLANLSFIDMWLSSNTTPKMITDFLWENKTISFAGCMSQVFFSHCIVGA
EMVLLVVMAYDRYVAICKPLHYFTIMNLKRCTGLVLASWTVGFIHGISYVLVVMQLPFCGPNKIDSFFCDMPLVIKLACMDSHDLNTLMNAECGVLAVTCFVVLLISYTY
ILITVRQSSKAGALKALSTCSAHITVVMLFFVPCIFIYVWPLSITWLDKFLAVFYSVFTPLLNPAIYTLRNKEMKNAMKRFIGKFLGAAGNS*
325 >lcl|NP_001000372.1|Plus138621240..38622178 NW_047657 olfactory receptor Olr770 Olr770 __SEG__ Chr3 {Rattus norvegicus} MNGGNQSELSEFVLLGLFRSQNLQVVLFVIFLIFYLLIVSGNIVIMFLITIDRHLHSPMYFLLANLSFVDIWLSSVTTPKMITDFLREHKTISFAGCMSQVFFAHCIAAG
EMVLLLVMAYDRYVAICKPLHYFTIMNLRRCTGLVLTSWTVGFVHALSQLVAVLQLPLCGPLEIDSFFCDMPLVIKLACIDSHDLDMLMNADCGIVVVSCFILLLISYTY
ILVTVHRSAKAGASKALSTCTAHITVVMLLFLPCIFIYVWPLNITWLDKFLAVFYSVVTPLLNPAIYTLRNKEIKNALKRFKSYVINHKVNT*
326 >lcl|NP_001000373.1|Plus138725805..38726743 NW_047657 olfactory receptor Olr773 Olr773 __SEG__ Chr3 {Rattus norvegicus} MDGGNQSLVSEFVLLGLAHSQNIQALLFMMFLMLYLLIVSGNIVIMVLITFDPHLHSPMYFLLANLSFVDMWLSSVTTPKMITDFFRENKTISFAGCMCQVFFAHCIAAG
EMVLLVVMAYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTIGIVHALSHLVVIVELPFCSPKEIDSFFCDMPLVIKLACMDSHNLDILMYADCGVVGVTCFILLLISYTY
ILITVHQSSKAGASKALSTCTAHITVVMIFFVPCIFIYVWPLNITWLDKFLAVFYSVFTPLLNPAIYTLRNKEMKNAMKRFINTYRDFQGKS*
327 >lcl|NP_001000374.1|Plus1complement(38826110..38827048) NW_047657 olfactory receptor Olr775 Olr775 __SEG__ Chr3 {Rattus norvegicus} MHGENQTVVSEFIFWGLANSKNLQILLFLIFLMLYLLIVSGNIVILILITTDPYLHSPMYFLLANLSFIDMWLSSNTTPKMITDILRENKTISFAGCMSQVFFSHCIVGA
EMVLLVVMAYDRYVAICKPLHYFTTMNLKRCTGLVLVSWTVGFIHGISYVLVVMQLPFCGPNKIDSFFSDMPLVIKLACMDSHDLNTLMNVECGVLAVTFFVVLLISYTY
ILILVHQSSNVGALKALSTCSAHITVVMVFFVPCFFIYVWPISITWLDKFFAVFYSVFTPLLNPAIYTLRNKEMKNAMKRFIGKFLGVMGNS*
328 >lcl|NP_001000375.1|Plus1complement(38934397..38935359) NW_047657 olfactory receptor Olr781 Olr781 __SEG__ Chr3 {Rattus norvegicus} MEGVNQSMVSEFVFLGLTNSWDIQLFLFVFSSIFYVASMTGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKHKVISFRGCVTQIFFIHFIGGV
EMVLLVAMAFDRYVAICKPLHYLTIMSPRMCILFSVASWLVGLMHSLVQLAFVVSLPFCGRNVLDSFYCDFPRFIKLACIDTYSLKLLVSVNSGFMSVGSFFILTISYIV
IIFTVQKHSSSGSSKALSTLSAHVMVVVLFFGPVMFIYTWPSSFTHLDKFLSIFDAIVTPFLNPVIYTLRNQEMKMAMMRVLNQIMGYRQLIKHLHSDQS*
329 >lcl|NP_001000376.1|Plus1complement(38985120..38986058) NW_047657 olfactory receptor Olr783 Olr783 __SEG__ Chr3 {Rattus norvegicus} MGEANCSVVSEFVFLGLSNSWAIQLFLFFFSCIFYVASLLGNFLIVLTVTSDPQLQSPMYFLLGNLSIIDLIFCSSTTPKMIYDLLRKHKTISFGGCITQIFFIHAVGGT
EMVLLIAMAFDRYVAICKPLHYLIIMSPQKCILILVASWIIGYIHSVTQLSFVVDLPFCGPNELDSFFCDLPRFIKLACVDTYTLGFMVTANSGFISVASFLILIISYIF
ILVTVQKKSLGSLCKALSTLSAHVMVVILFFGPLIFFYTWPFPTSHLDKFLAIFDAVITPFLNPVIYTLRNKEMKVAMRRLCSQFVNYNKIS*
330 >lcl|NP_001000377.1|Plus1complement(39135659..39136597) NW_047657 olfactory receptor Olr789 Olr789 __SEG__ Chr3 {Rattus norvegicus} MEGKNHSIVSEFMFVGLTNSWKMEILLFVFASVFYMGSMMGNSLIIFTVASDPHLHSPMYFLLANLSFIDLGVSCVTCPKMIYDLFRKQKVISFNGCITQIFFIHVIGGV
EVVLLIGMAYDRYVAICKPLHYLTIMNAKMCIFILVASWVVGLMHSLVQFVYIVNLPFCGPNILDSFYCDLPRFIRLACVDTNQLELMVSANSGFISVGSFFILVISYIV
IIVTVQKHSSSGSSKALSTLSAHISVVVLSFGPLIFVYTWPSPSTHLDKYLAIFDAVGTPFLNPVIYTLRNQDMKMAMKRVCRQLLKYGKIS*
331 >lcl|NP_001000378.1|Plus139300731..39301681 NW_047657 olfactory receptor Olr792 Olr792 __SEG__ Chr3 {Rattus norvegicus} MDGGNHSVVSEFLLLGLTNSWRIQILLFLFFTVFYVASMLGNLLIVLTIISDHHLHSPMYFLLANLSFIDTGVSSIATPKMISDLFRKHKAISLNGCITQMFFIHTVGGT
EMVLLIVMAYDRYTAICKPLHYLTIMSLRMCIVLVALAWTIGLIHSVAQLAFVVSLPFCGANKMDSFYCDFPRFIKLACTDTYRLEFLVTANSGFISMATFFILIVSYLF
ILVTVHKHSSGASSKALSTLSAHITVVILFFGPCIIVYVWPFPTLPIDKFLAIFDAIITPSMNPVIYTLRNNEMKVAIRKLFVRALSIIGSLRASD*
332 >lcl|NP_001000379.1|Plus11826215..1827144 NW_047653 olfactory receptor Olr400 Olr400 __SEG__ Chr3 {Rattus norvegicus} MRMDNESTVSEFILLGLPIRAEDQAVYSAMFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTVPKMLMNMLTHSQSISYTGCVSQVYFFIVFASI
DSFLLTSMAYDRYVAICYPLHYTLIMNMTLCVLLVVISWTLSSANALVQTLLLAHLSHFRNNTIPHYFCDLSTLLKLSSSDTTINDLIILILGNAVITLPFICILVSYGY
IGVTILKTPSIKGICKALSTCGSHLCVVSLYYGAIIGLYFVPSSKNANEKNVIVAIMYTVVTPMFNPFIYSLRNRDMKGALRNILSRIK*
333 >lcl|NP_001000380.1|Plus11719788..1720717 NW_047653 olfactory receptor Olr397 Olr397 __SEG__ Chr3 {Rattus norvegicus} MRRDNESTVSEFILLGLPIPVEDQAAYSALFFAVYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTAPKMLMNMLTNSHSISYTGCISQVYFFLFFGSI
DSFLLTSMAYDRYVAICHPLHYTRIMNQNLCVLLVIVSWILSNACGLVHTLLLTRLSHFRDNTIPHYFCDLSALLKLSSSDTTINELVILPVGTVVITVPFICILVSYGH
IGVTILKTPSIKGICKALSTCGSHLCVVSLYYGAIIGLYLVPSYNNTNDKDAIVAVMYSLVTPMLNPFIYSLRNRDMKGALRNILSRTK*
334 >lcl|NP_001000381.1|Plus12060970..2061893 NW_047653 olfactory receptor Olr403 Olr403 __SEG__ Chr3 {Rattus norvegicus} MDNESTVSEFILLGLPIQAEDQNMYSALILTMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTVPKMLVNMLTHSQSISYTGCVSQVYFFIVFGTIDS
FLLTSMAYDRYVAICHPLHYTLIMNLSLCVLLVVISWALSSANALVQTLLLARLSHFRNNTIPHYFCDLSTLLKLSSSDTTINDLIILVLGNAVITLPFICILVSYGYIG
VTILKTPSIKGIRKALSTCGSHLCVVSLYYGAIIGLYCVPSSNTNNDKNAIVAMMYTVVTPMLNPFIYSLRNRDMKGALRNILSRTK*
335 >lcl|NP_001000382.1|Plus12141072..2142010 NW_047653 olfactory receptor Olr404 Olr404 __SEG__ Chr3 {Rattus norvegicus} MRMDNESTVSEFILLGLPIRAEDQGMYFALFLTMYLTTVLGNLLIILLIRLDSHLHNPMYFFLSHLAFTDISFSSVTAPKMLMNMLTHFQSISYAGCIFQVYFFAIFADL
DSFLLTSMAYDRYVAICHPLHYSQTMSQSLCVLLVVVSWALSTVNALVHTLLLARLSHFRDNTIPHYFCDLSALLKLSSSDTTINELVILVLGNVVITLPFICILVSYGH
IGVTILKTPSIKGICKALSTCGSHLCVVSLYYGAIIGLYFVPSSNNTNDKDAIVAVMYTVVTPMLNPFIYSLRNQDMKGALKHILSGRLCSQ*
336 >lcl|NP_001000383.1|Plus12208819..2209754 NW_047653 olfactory receptor Olr406 Olr406 __SEG__ Chr3 {Rattus norvegicus} MRRDNESTVYEFILLGLPIQAKNQGMHSALFLTMYVTTLLANLLIIVLIKLNSHLHTPMYFFLSHLAFTDISFASVASPKMVINMLTHSQSISYAGCIMQVYFFSFFADL
ESFLLTSMAYDRYVAICHPLQYSHIMNENLCFLLVVVSWVLSTANSFVHTLLLAQLTHFRDNSIPHYFCDLSTLLKHSSSDTTINELVILVSGNVVITLPFICILVSYGH
IGVTILKTPSIKGICKALSTCGSHLCVVSLYYGAIIGLYFVPSPKNTNDKNAIVSMMYTVVTPMVNPFIYSLRNRDMKGALRNILSRRICS*
337 >lcl|NP_001000384.1|Plus12312156..2313094 NW_047653 olfactory receptor Olr408 Olr408 __SEG__ Chr3 {Rattus norvegicus} MTQDNESTVSDFNLLGLPIRAEDQGVYSVLFLIMYLTTVLGNLLIILLIRLDPHLHTPMYFFLSHLALTDISFSSVTAPKMLMNMLTHSQSISYAGCVSQVYFYIAFSDL
DSFLLTSMAYDRYVAICHPLHYNTIMSQNLCVLLLVMSWALSSANALVHTLLLARLSHFRNNTISHYFCELSALLKLSSSDTTINKMVILPLGTVVITLPFVLILVSYGC
IGVTILKIPSINGIYKTLSTCGSHLCVVSLYYGAIIGLYFVPSSNNTNDQDAIVAVIYTVVTPMLNPFIYSLRNRDMKGALKNILSRRLCSQ*
338 >lcl|NP_001000385.1|Plus1complement(2381217..2382158) NW_047653 olfactory receptor Olr411 Olr411 __SEG__ Chr3 {Rattus norvegicus} MRLKNHSSVSEFLLLGLPIRAEQSGIFFSMFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTVPKMLTKVPNQNIPITYEGCVSQTYFFIFFADL
DSFLITSMAYDRYMAICHPLNYTTIMNQSRCATLVAISWIIASACALLHTLLLDQLSFCADHTIPHFFCDLGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGH
IGFTILQVPSTKGICKALSTCGSHLSVVALYYGSIIGLYFLPPSNSTINNNIVASVMYTVVTPMLNPFIYSLRNKDMKGALRKLLSKKVEFSN*
339 >lcl|NP_001000386.1|Plus12421675..2422622 NW_047653 olfactory receptor Olr415 Olr415 __SEG__ Chr3 {Rattus norvegicus} MSCIRRNNHSITSEFILLGLPINPELNDMYSALFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTAPKMLVNMLTHSQSISYTGCISQMYFFLFF
GDLDSFLLTSMAYDRYVAICHPLHYTTIMSQSLCVLLLIMCWVLSFASAILHTLLLTCLSFCGDNTLPHFFCDLSALLKLLSSDTTINELVIFTVGVVIITVPLICILVS
YGYIGATILRTPSTKGIFKALSTCGSHLSVVSLYYGAIIGLYSFPSPKDNNNKDVIVAVMYTVVTPMLNPFIYSLRNRDIKGALRNMLSKRASSQ*
340 >lcl|NP_001000387.1|Plus1complement(2442128..2443063) NW_047653 olfactory receptor Olr416 Olr416 __SEG__ Chr3 {Rattus norvegicus} MENQSSVSEFFLRGISGFPEQQQLLYGLFLCMYLVTLTGNVLIILAIGSDPHLHTPMYFFLANLSFADMGLISSTVTKMLFNVQTQCHTISYTGCLTQMYLFMMFGDLDS
FFLAVMAYDRYVAICHPLHYSTIMNARICVLMLILCWILTNVVALTHTLLMARLSFCVVGEIAHFFCDVTSVMKLSCSDTHVNELVLSGFGGTVLMVPFVSIVISYVHIV
FAVLRIQSSGGSSKAFSTCSSHLCVVCVFYGTLFSVYLFPSSVETTEKDVAAAAMYTVVTPMLNPFIYSLRNKDIKGALKRLLSHRRILSS*
341 >lcl|NP_001000388.1|Plus12454241..2455194 NW_047653 olfactory receptor Olr417 Olr417 __SEG__ Chr3 {Rattus norvegicus} MGKPSRLNQSVASDFLLLGLSEQPGEQSLLFGIFLGMYLVTMVGNLLIILVISSDAHLHTPMYFFLANLSLTDACFTSASVPKMLANIYTQRQTISYSGCLTQLYFLLMF
GGLDNCLLAVMAYDRYVAICQPLHYSTAMSPQFCALMLCMCWVLTNCPALMHTLLLTHVAFCAHTAIPHFYCDPSALLKLACSDTHINELMIISMGLVFLAVPLMLIVIS
YVCISWAVLDIPSPGGRWKAFSTCGSHLTVVLLFYGSLMGVYLLPPSTHSTERESRAAVLYMIVIPMLNPFIYSLRNRDMKEALGKLFGARKAVFLL*
342 >lcl|NP_001000389.1|Plus12505391..2506317 NW_047653 olfactory receptor Olr420 Olr420 __SEG__ Chr3 {Rattus norvegicus} MDNSSLTSVSYFVLLGISTNPVEQIPLFLLFLLMYIINISGNFLIITLIISAPHLHTPMYIFLSNLALADICFTSTTVPKMLQNIFSSTKAIPYVDCLAQTYFFICFAAM
ENFLLAAMAYDRYIAICYPLRYSSILTGMLCAQMLALCHVLSHLHALLHTFLMGRLIFCADNRIPHFFCDLYPLMKISCTSIELNTLMIHTEGVIVINGAMVFIIASYAF
IISAVLQIPSANGKWRSFSTCGSHLTVVAIFYGTLTWVYFRPFSSYSVAKSRIVTVMYTVVTPMLNPFIYSLRNGDVKKAFRKLVRRL*
343 >lcl|NP_001000390.1|Plus1complement(2552647..2553600) NW_047653 olfactory receptor Olr422 Olr422 __SEG__ Chr3 {Rattus norvegicus} MATKNKTEVTEFVLLGLSSRPEMQPVIFGVVLIMYLIAVLGNTLLVLVACSDPKLQTPMYFLLSQLSLIDISLTTITVPQMLVHTLSVDRSISYNCCMTQLFFFMAVGSM
EGHLLAAMAYDRYVAICDPLRYSAIISHSLCLRITLTSWVVVSLNSLLYSVLVTRLTFCGNQVTHFFCDITPLLKLSCTRPVVNEMLIFTEGVAVVGSPFLFIWGSYIRI
GIAIAHMHSFAALRKALSTCGSHILVVLLLFGSLARMYLKPSSSYDLDQDRQVAVFYTLISPMLNPIIYSLRNKDVKGAIWKLFRKLCTSEWLSDKE*
344 >lcl|NP_001000391.1|Plus12610238..2611224 NW_047653 olfactory receptor Olr423 Olr423 __SEG__ Chr3 {Rattus norvegicus} MATKNKTEVTEFVLLGLSSRPEIQPIIFGVVLIMYLMTVLGNILLVVVACSDPMLQTPMYFLLSQLSIIDISLTTITVPQMLVHTLSMDRSISYNCCMTQLFFFMAVGSM
EVYLLGTMAYDRYVAICDPLRYSAIVSHSLCLRITLTSWVIVSLNSLLYSVLVTRLTFCGNQVTHFFCDITPLLKLSCTRPVVNEMLIFTEGVVVVGSPFFFIWGSYIRI
GITIAHMHSFAALRKALSTCSSHILVVLLLFGSLARMYLKPSSSYDLDQDRQVAVFYTLITPMLNPLIYSLRNQDVKGALWRLFRKLHTSDWLSDKQRIKNKLVRTKG*
345 >lcl|NP_001000392.1|Plus1complement(2625884..2626876) NW_047653 olfactory receptor Olr424 Olr424 __SEG__ Chr3 {Rattus norvegicus} MATKNRTEVTEFVLMGLSSQPEMQPVIFGVVLIMYLMAVLGNTLLVLVACSDPKLQTPMYFLLSQLSLIDISLTTIIVPQMLVHTLSVSRTISYNCCMTQLFSFMTVGSM
EVHLLGAMAYDRYVAICDPLRYSAIVSHSLCLRITLTSLGVVSLNSLLYSVLVTRLTFCGNKVTHFFCDITPLLKLSCTRPVVNEMLIFTEGVAVVVSPFFFIFGSYVRI
GIAIAHMHSVAALQKALSTCGSHVLVVMFLFGSLVHMYLKPSSSYNLEQDRQVAIFYTLISPMLNPLIYSLRNQEVKGALWRLFRKLHPQAVSSLDFRQRMSVNLLRSKG
*
346 >lcl|NP_001000393.1|Plus1complement(2643331..2644284) NW_047653 olfactory receptor Olr425 Olr425 __SEG__ Chr3 {Rattus norvegicus} MNCAPNASHSPIFLLLGFSRAGLPDSLLFLLFLFIYLTTILGNVTLVLLISWDSRLHSPMYYLLRGLSMIDLGLSTVTLPQLLVHLASDSPAIPAARCLTQFFFFYAFGV
TDTLVIAVMALDRYVAICDPLHYALVMSRQICARLLALSWAVSIVHTMLHVGLILPLCWAGDAGGNVKLPHFFCDHRPLLRASCSDTHSNELAIFLEGGFLMLVPCSLIV
LSYARIAATILQLPSAAGRRRAVSTCGSHLTMVGFLYGTIIWVYFQPPSQNSRNQDMVASVMYTAITPLANPFVYSLRNKDVKGALHRLLRKGRVES*
347 >lcl|NP_001000394.1|Plus12772658..2773593 NW_047653 olfactory receptor Olr428 Olr428 __SEG__ Chr3 {Rattus norvegicus} MNNQSISRSTSDFILLGLSSNPWMQKPLFAIFIVMYLVTVVGNVLIILAIHSDSRMHTPMYFFLSNLSFMDICFTTVIVPKMLVNLLSETKTISYVGCLVQMYFFMALGN
TDSYLLASMAIDRLVAICNPLHYDVVMRPQRCLLMLLGSCTISHLHALFRVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTSSSQIVVMTETLAVIVTPFLCILFSYL
RIIVTVLRIPSAAGKWKAFSTCGSHLTVVALFYGSIIYVYFRPLSMYSVVKDRIATVMYTVVTPMMNPFIYSLRNKDMKGGLRKLMDRVHA*
348 >lcl|NP_001000395.1|Plus12795628..2796557 NW_047653 olfactory receptor Olr429 Olr429 __SEG__ Chr3 {Rattus norvegicus} MPQENQSHMTEFLLLGLTSNPKQQVWLFAIFLAMYLVNVIGNSVIIAAIQRDARLHTPMYFFLSNLSLVDICFTTVIVPQMLVNLLTQRKTILFVQCLTQMYFFVAFGIT
DSFLLAVMAIDRYVAICNPLHYNTTMSPRRCRLLVMTSWAVSHLHSLTHTILMGRLSFCGPNVIHHFFCDVQPLLTLSCSDTFINELLAFTEGSVVIMSPFIFIVVSYAY
ITRTVLRVPSGEGRYKVFSTCGSHLTVVALFYGTIISVYIRPSSTYSVTKDRVVTVIYTVITPMLNPFIYSLRNKDMKQALRKLANKTE*
349 >lcl|NP_001000397.1|Plus12878941..2879924 NW_047653 olfactory receptor Olr434 Olr434 __SEG__ Chr3 {Rattus norvegicus} MSSENFTWSRVTPAEFILLGITNRWDLRVTLFLIFLPIYLMSLLGNVGMVLLIRIDARLHTPMYFFLANLSLLDAFYSSAIGPKMLVDLLLSRATIPYAACALQMFVFAG
LADAECCLLAVMAYDRYVAIGNPLLYTTVMSPRLCLALLGASGLGGAVSAFVHTTFTFRLSFCGSLEVNSFFCDIPPLLAISCNDTSLNELLLFAVCGFIQTATVLAIAV
SYGFIAGAVIRMQSVEGRRRAASTCGSHLTAVAILYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKEVKEAFRRTCHRFCCSGRSTSDWPQEAP*
350 >lcl|NP_001000398.1|Plus17362944..7363882 NW_047713 olfactory receptor Olr853 Olr853 __SEG__ Chr5 {Rattus norvegicus} MGNDSAVTEFFLVGLSQYPELQLSLFVLCLIMYLIILLGNSLLIIISVVDSRLHTPMYFFLGNLSFLDICYTSSSIPQMLVMFMSEKKSISFLGCALQMVISLGLGSTEC
VLLAVMAYDRYAAICNPLRYPIIMNKVLYVHMAVWSWVIGCLNSLVQTVLTMVLPFCGNNVIDHLTCEILALLKLVCSDITMNVLVMTVGSIVLLMIPLLLIFVSYIFIL
SSILRINSAEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKHTTASDEIIGLSYGVVTPMLNPIIYSLRNKEVKEAVKKVLSKHVYLQKI*
351 >lcl|NP_001000399.1|Plus1complement(7329360..7330310) NW_047713 olfactory receptor Olr852 Olr852 __SEG__ Chr5 {Rattus norvegicus} MEWENQTYLEEFFLKGLSGYPGLEHLFFVLILIMYAVILVGNGTLIIIIIFDSHLHTPMYFFLGNLSFLDICFTTSSIPFTLVSFLSERKTISFLGCAVQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYPLIMSKSSYVTMATGSWFSGVANSAVQTAFVMRLPFCGNVIDHFLCEILAVMKMACTDISGNEFIMLVATTLFTLMPLLLIVISYSLI
ISSILNIRSAEGRSKAFSTCSAHFTVVIIFYGTILFMYMKPKSKDKLGTDDLDATDKLISMFYGVMTPLMNPLIYSLRNKDVKEAIKNLKQRLLGK*
352 >lcl|NP_001000400.1|Plus1complement(7288722..7289681) NW_047713 olfactory receptor Olr851 Olr851 __SEG__ Chr5 {Rattus norvegicus} MARTNDSMLTEFLLVGLSDHPKLQTVLFALVLCMYLMILLGNGILISVVIYDIHLHTPMYFFLCNLSFLDICYTSSSVPLILSSFLSVKKRVSFPECLIQMFFSFAMGAT
ECVLLGTMALDRFMAICYPLRYPVIMSKGTYVPMAVGCWVAGIVDSLVQTSLAVQLPFCTDNVIHHFVCEILGILELVCADISINVISLTGSNLLFLAVPLLVIAVSYVF
IIVTILRIPSAEGKRKAFSTCSAHLTVVIIFYGTIFSMYAKPKVKDTAGAGHQSVMEALISLFYGVMTPMLNPLIYSLRNKDVKAAVQNMLGRRTLDRT*
353 >lcl|NP_001000401.1|Plus1complement(7224276..7225226) NW_047713 olfactory receptor Olr850 Olr850 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLLGLSGYPKTEILYFVIMLVMYLVILTGNGVLIIASIFDSHLHTPMYFFLGNLSFLDICYTTSFVPSTLVNLISKKGNISFSGCAVQMFVAFAMGST
ECLLLGMMAFDRYVAICNPLRYSIIMSKEVYVSMTSASWFSGGINSVVQTSLAMRLPFCGNNVINDFTCEVLAVLKLACADISLNIVTMAISNMAFLVLPVLLIFFSYVF
ILYTILRMNSATGRRKAFSTCSAHLTVVGIFYGTLFSMYAKPKSQDLTGEDKFGISDKVIALFYGVVTPMLNPIIYSLRNKDVKAAVKYILKRKIP*
354 >lcl|NP_001000402.1|Plus17175187..7176140 NW_047713 olfactory receptor Olr848 Olr848 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLLGLSGYPKTETIYFVIILVMYLVILTGNGVLIIASIFDPHLHTPMYFFLGNLSFLDICYTTSSVPSTLVSQISKKRNISFSGCAVQMFVAFAMGST
ECLLLGMMAFDRYVAICNPLRYSIIMSKEVYVSMASASGFSGGINSVVQTSLVMRLPFCGYNVINDFTCEVLAVLKLACADISLNIVTIAISNMAFLVLPLLLIFFSYVF
ILYTILRMNSASGRRKAFSTCSAHLTVVGIFYGTLFIMYTKPKSQDLTGEDKFGISDKVISLFYGLVTPMLNPIIYSLRNKDVKAAIKYILKQKYIP*
355 >lcl|NP_001000403.1|Plus1complement(7144348..7145301) NW_047713 olfactory receptor Olr847 Olr847 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLLGLSGYPKTEILYFVIILVMYLVILTGNGVLIIASIFDSHLHTPMYFFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGST
ECLLLGMMAFDRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINHFTCDVLAVLMLACADISLNIVTMVISNMAFLVLPLLLIFFSYVF
ILYTILRMNSASGRRKAFSTCSAHLTVVVIFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSLRNKDVKAAVKYILKQKYIP*
356 >lcl|NP_001000404.1|Plus1complement(7080137..7081090) NW_047713 olfactory receptor Olr845 Olr845 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLMGLSGYPKAKIVYFVIILVMYLVILTGNGVLIIASIFDSHLHTPMYFFLGNLSFLDICYTTSSVPSTLVSLISKKGNISFSGCAVQMFVGFAMGST
ECLLLGMMAFDRYVAICNPLRYSIIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINDFTCEVLAVLKLACADISLNIVTMAISNMAFLVLPLLLIFFSYVF
ILYTILRMNSATGRRKAFSTCSAHLTVVGIFYGTVFFMYGKPKSQNLTGEDKSRISDKVISLFYGVVTPMLNPIIYSLRNKDVKAAVKYILKQKYIP*
357 >lcl|NP_001000405.1|Plus16970566..6971525 NW_047713 olfactory receptor Olr841 Olr841 __SEG__ Chr5 {Rattus norvegicus} MVQGNWSSVTVFFFLGFSQYPRIEVTIFVLCLLMYLITLLGNTILISITILDSHLHTPMYFFLSNLSFLDIWYTSSALTPMLANFVSGENTISFSGCALQMYFSLAMGST
ECVLLSMMAYDRYVAICNPLRYPIIMNRRVCVQIASSSWATGCLTALVETGPVIHLSLCGNNIINHFTCEILALLKMACGDTAMVQLIMLVISILLLPLPMLLICVSYAS
ILSNILRISSVDGRSKAFSTCAAHLTVVVLFYGTALSMYLKPSSVNSQEIDKFMALIYAGLTPMLNPIIYSLRNKEVKMAVKKLLIRNPFSTILTSVLK*
358 >lcl|NP_001000406.1|Plus1complement(343118..344077) NW_047712 olfactory receptor Olr836 Olr836 __SEG__ Chr5 {Rattus norvegicus} MDRSNETSLVSYFILLGLSAHPRLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAMQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAAGSWAGGSITATVQTSLAMRLPFCGDNVINHFTCEILAVLKLACADISINVISMAVGNAVFLGVPVLFIFVSYI
FILSTILRIPSAEGRKKAFSTCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVLTPMLNPIIYSLRNKDVRAAVRNLLHQKHFKW*
359 >lcl|NP_001000407.1|Plus1complement(279860..280798) NW_047712 olfactory receptor Olr834 Olr834 __SEG__ Chr5 {Rattus norvegicus} MEPSNRTAFSEFILKGFSGYPALEHLLFPLCSVMYLVTLLGNTAIVVVSILDARLHTPMYFFLGNLSILDICYTSTFVPLMLVHLLSSRKTISFSGCAIQMCLSLSTGST
ECLLLAVMAYDRYLAICQPLRYPVLMSHRLCLMLAGTSWVLCLFKSVTETVIAMRLPFCGRHVIRHFTCEILAVLKLACGDTSVSDAFLLVGAILLLPVPLTLICLSYML
ILATILRVPSATGRRKAFSTCSAHLAVVLLFYSTIIFMYMKPKSKEARISDQVFTVLYAVVTPMLNPIIYSLRNKEVKEAARKAWGSRWVCR*
360 >lcl|NP_001000408.1|Plus1complement(267579..268529) NW_047712 olfactory receptor Olr833 Olr833 __SEG__ Chr5 {Rattus norvegicus} MDRTNHTAATEYILLGLQDHHSLEIALFVLCLGIYCITLLGNAFLVGLIVMDPHLHSPMYFFISNLSLIDICGTSSFTPMMLLNFLDVQRTISFPSCALQMYLTLALGTT
ECLLLVVMAYDRYVAICQPLRYLELMNGQLCTQMAATIWGTGFANSLLHSILAWRLPFCGHHIINHFFCEILAVLKLACGDISLNALLLMVATVVLTVTPLLLICLSYIF
ILTAILRIPSATGRSKAFSTCSAHLTVVVIFYGTISFMYFKPKDQDPSVGKIITLLYAIVAPSLNAFIYSLRNTEVRAAVTALVWGGLLTRKTSHF*
361 >lcl|NP_001000409.1|Plus1292481..293428 NW_047719 olfactory receptor Olr855 Olr855 __SEG__ Chr5 {Rattus norvegicus} MQDFLWRNRSSLTEFVLLGFSSDTRINGTLFGVFLLLYLSTLLGNGLIITLIHMDSRLHTPMYFFLSILSILDMGYVTTTVPQMLVHLVCEKKTISYVGCVAQMYIFLML
GITESWLFAIMAYDRYVAICHPLRYKVIMSPLLRGSLVAFCGFWGITCALIYTVSAMILPYCGPNEINHFFCEVPAVLKLACTDTSLNDQVDFILGFILLLVPLSLIIVV
YINIFAAILRIRSTQGRIKAFSTCVSHITVVTMFSIPCMVMYMRPGSESSPEEDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKVVGSSKGSG*
362 >lcl|NP_001000410.1|Plus1complement(504821..505768) NW_047719 olfactory receptor Olr865 Olr865 __SEG__ Chr5 {Rattus norvegicus} MWVIPGQNQSWVSEFILIGFSSDPTTNSILFIVFLLIYLSSVLGNGLIIMLVCLDTQLHTPMYFFLCTLSLLDMGYVTTTVPQMLMHLLAHSKTISFAGCWVQMYVFGAL
GIAEGTFFVVMAYDRYVAICYPLRYSVILNWGLCIRLAAGSWICGFFSSLLHTYFTMSLPYCGPNRVNHYFCEGPSVWSLACMDTHLIEMVDFVLSVFVVVTPISLIVAS
YIHIVKAILKIKSTQGRCKAFSTCASHLTVVTFFYAPATYIYMRPNSSLSPDRDKQISLFYNVFTALLNPVVYSLRNRDIKRAFLKVIGHGRVNW*
363 >lcl|NP_001000411.1|Plus1complement(538544..539491) NW_047719 olfactory receptor Olr866 Olr866 __SEG__ Chr5 {Rattus norvegicus} MWMIPGKNQSWVSEFILIGFSSDPTTKSILFIVFLLIYQSSVLGNGLIIMLVCLDTQLHTPMYFFLCTLSLLDMSYVTTTVPQMLVHLLAHSQTISFAGCWVQMYVFGAL
GITECTFFVVMAYDRYVAICYPLRYTVILSWGLCIRLAAGSWICGFFSSLLHTFFTMSLPYCGPNRVNHYFCEGPSVRSLACMDTHLIEIVDFVLSVFVVVTPISLIVAS
YIHIAKAILKIKSTQGRCKAFSTCASHLTVVTLFYIPATYVYMRPNSSYSPEQDKQISLFYNVFTALLNPVVYSLRNRDIKRAFLKVMVHGRVHW*
364 >lcl|NP_001000412.1|Plus1complement(566800..567747) NW_047719 olfactory receptor Olr867 Olr867 __SEG__ Chr5 {Rattus norvegicus} MQVIPGQNQSWVSEFILIGFSSDPMTNSILFLVFLLLYLSSVLGNGLIIVLVCLDTQLHTPMYFFLCTLSLLDMGYVTTTVPQMLVHLLAHSKTISFAGCWMQMYVFGAL
GMTECTFFVVMAYDRYVAICYPLRYTVILNGGLCIRLVSGSWICGLFSSLLHTYFTMNLPYCGPNRVNHYFCEGPSVRSLACMDTHLIEMVDFVLSVFVVVIPISLIVAS
YIHIAKAILKIKSTQGRCKAFSTCASHLTVVTFFYAPATYIYMRPNSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDIKRAFLKVMGHGRMDW*
365 >lcl|NP_001000413.1|Plus1complement(620080..621027) NW_047719 olfactory receptor Olr869 Olr869 __SEG__ Chr5 {Rattus norvegicus} MWMIPVHNQSWVSEFILIGFSSDPMTNSILFIVFLLIYLSSVLGNGLIIMLVCLDTQLHTPMYFFLCTLSLLDMSYVTTTVPQMLVHLLAHSQTISFAGCWVQMYVFGAL
GITECTFFVVMAYDRYVAICYPLRYTVILSWGLCIRMAAGSWICGFSSSLLHTFFTMSLPYCGPNRVNHYFCEGPSVRSLACMDTHLIEMVDFVLSVFVVVTPISLIVAS
YIRIAKAILKINSTQGRCKAFSTCASHLTVVTFFYAPATYIYMRPSSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDIKRAFLKVMGHGRVDW*
366 >lcl|NP_001000414.1|Plus1404775..405734 NW_047712 olfactory receptor Olr840 Olr840 __SEG__ Chr5 {Rattus norvegicus} MDRFNETSPVSHFILLGLSAHPRLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMYFFLRNLSFLDICYTTSSVPLILDSFLTPRKTISLSGCAVQMFLSFAMGA
TECVLLSMMAFDRYVAICNPLRYPVVMSKAAYVPMAAGSWAGGITNSVVQTSLAMRLPFCGDNVINHFTCEILAVLKLACADISINIISMGVANVIFLGVPVLFIFVSYI
FILSTILRIPSAEGRKKAFSTCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLRNKDVRAAVRNLVVQKHLTE*
367 >lcl|NP_001000415.1|Plus1complement(390818..391774) NW_047712 olfactory receptor Olr839 Olr839 __SEG__ Chr5 {Rattus norvegicus} MEVSNQSTVTEFVLLGLSAHPTLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMYFFLGNLSFLDICYTTSSVPLVLDGFLTPRKTISFSGCAVQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAVSSWVAGGANSMVQISLAVQLPFCGDNVINHFICEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIF
ILSTILRIPSAEGRKKAFSTCSAHLTVVIIFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGLLTPMLNPIIYSLRNKDVKTAVRDLASHRCLTQ*
368 >lcl|NP_001000416.1|Plus1complement(14451419..14452375) NW_047773 olfactory receptor Olr1095 Olr1095 __SEG__ Chr7 {Rattus norvegicus} MAVTLGRNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATIWSEHSLHTPMYRFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFMF
GFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTVVTTAIFNLTFCGPSEIHHFACHVPPLLKLACGKNVLAVAKGVGMVCITALLGCFLLILL
SYAFIVATILKIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPKSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKNAMKKAFLSKLYPEKM*
369 >lcl|NP_001000418.1|Plus112543995..12544936 NW_047773 olfactory receptor Olr1087 Olr1087 __SEG__ Chr7 {Rattus norvegicus} MASENQTAVSEFHLMGLSEDPGLQTVLFGLFLSMYLVTVFGNLLIILAIISDCHLHTPMYFFLCNLSLVDIFFCSTTVPKMLVNIQTHSRAIPFAGCLIQMYAFHLFGTI
DSFLLAAMAIDRLVAIAYPLRYSVLMNPRVCALLVGGTWAITNLQSLVHTCLMARLTFCAGLEIPHFFCDLMPLLKLSCSDTHINELVIFAFGIVMGLSPLSCILLSYIC
IFRAVLRIPSAQGKWKAFSTCGSHLTVVSLFYGTIFTGYLLPASPSSSQKDKAAALMFGVVIPTLNPFIYSLRNKDMKAALRKLRSKAVSFQS*
370 >lcl|NP_001000419.1|Plus112362119..12363081 NW_047773 olfactory receptor Olr1086 Olr1086 __SEG__ Chr7 {Rattus norvegicus} MERENQTGDRKFLLLGFTEDSDLQSFFFGLLLSMYLVSITGNLLIVLAIVSDHHLHTPMYFFLSNLSIADIGFTSTTIPKALQNIHTQSKLISFTGCITQIFFFIVFGCL
DNLLLTVMAYDRFMAICHPLHYVVIMNSCFCVMLALGSWIVSVMSSLPETLTVLRLSFCTNMEIPHFFCDLPEVLKLACSDTLVNNIVIYSITIVIAGFPFSGILLSYSR
IFSSILRIPSAGGKYKAVSTCGSHLLVVFLFYSNGLGVYLSSAATSSSRMSLVASLMYTMVTPMLNPFIYSLRNKDMQKALGKLLRKIMLLGEGSIAGFP*
371 >lcl|NP_001000420.1|Plus112337405..12338337 NW_047773 olfactory receptor Olr1085 Olr1085 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFILLGFSETPQLQFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFVDICFTSTTIPKMLVNTHTQSKTITYVHCISQMCVFLVFGE
LDNFLLAVMAYDRYVAICHPLCYTVIVNHRLCILLLLLSWVVSIFHALLQSLMVLQLTFCGDVKIPNFFCELNQLSQLTCSDNFPSHLIMNLVPVMLGAISLSGILYSYF
KIVSSVRSISSVQGKHKAFSTCASHLSIVSLFYSTGIGVYISSAVVQSSHSAARASIMYTVVIPMLNPFIYSLRNKDVKRALERLLEGKL*
372 >lcl|NP_001000421.1|Plus1complement(12042578..12043537) NW_047773 olfactory receptor Olr1075 Olr1075 __SEG__ Chr7 {Rattus norvegicus} MESGNDTQLSEFFLLGFSEKQPEIQPLIFGLFLSMYLVTVTGNLLIIVAIIVDAHLHTPMYIFLSNLSFVDICFTSTTVPQMLVNIHTQSKVITYAGCITQMYFLLLFSG
LDIFLLTVMAYDRYVAICHPLHYMIIMNTRRCGLLILACWIIGVLNSLLHSFLVLRLSFCTNLEIPHFFCELNQVVHQACSDTFINDMVIYITAMLLAVGPLSGILYSYS
KIVSSIRAISSAQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNSHATATASLMYTVVTPMLNPFIYSLRNKDIKTALKILLGSVTRSRLMDSPS*
373 >lcl|NP_001000423.1|Plus1complement(3837206..3838135) NW_047784 olfactory receptor Olr1106 Olr1106 __SEG__ Chr7 {Rattus norvegicus} MRNRSTVPEFFLLGLSADTQIQIPLFVLFLVIYLLTLVGNLLLLLVVKVDRHLHTPMYFFLGQLSFLDLCHSSVTVPKLLENLLSVKKTISVEGCLAQVFFVFATGGTES
CLLAVMAYDRYVAISSPLLYGQVMSRQLCAGLVWGSWSLAFLDAFINILVALSLDFCEAQNIHHFVCELPSLYPLSCSDVSASFTTLLCSSVIHFFGNFLLILLSYIRIL
LTILGISSASGRSKAFSTCSSHLTAVSFFYGSGLLRYLMPNSGSTQELIFSLQYSVITPMLNPLIYSLKNKEVKAAVRKMVRKYVQCLK*
374 >lcl|NP_001000424.1|Plus13891764..3892690 NW_047784 olfactory receptor Olr1107 Olr1107 __SEG__ Chr7 {Rattus norvegicus} MAWSNHSSITEFVLTGLSDDPLIQALLFTLFLGIYILTMTGNLMMLLVIGADSHLHTPMYYFLSNLSFVDLCFSTVTVPKLLKDLLSVKKSISIEGCLAQVFFVFFSSGT
EACLLSVMAYDRYAAICHPLLYGQVMRNELCVRLVLVSWGVASLNATIIVLLAVNLDFCEAQTIHHYTCELPALFPLSCSDISITVDVLLCSSLLHGLGTFIPIFFSYAR
IVSAILSISSTTGRSKAFSTCSSHLAAVTLFFGSGFLCYLMPPSGSSLDLLLSLQYSAVTPMLNPLIYSLKNKEVKAAVKRTLRKYLL*
375 >lcl|NP_001000425.1|Plus13968209..3969141 NW_047784 olfactory receptor Olr1111 Olr1111 __SEG__ Chr7 {Rattus norvegicus} MSAESGNQTSWLTLVGFGRLKQLGFLPFALFLAIYMATVGGNILLVLAVVSSRTLHTPMYFFLCHFSMLEIGYTTNIVPRLLQSFLEGGVVISLVSCLAQFYVFASLAAA
ECLMLSAMSYDRYLAICHPLHYPVLMSTWYCGCLATGAWFSGFFFSAFTLALAAPLSLCPGPRVIDHYFCDFAPVVRLFCGEVWVMWGAGVSISGCLTLTPFLLIVTSYV
FILRAVLRIPSGHGRQKAFSTCSSHLSVVAVFYGTLIVVYVAPTDHMAPLLRKAFSVLYTVLTPMVNPIIYSLKNQEVKWALRRLWRRLL*
376 >lcl|NP_001000426.1|Plus113602935..13603873 NW_047798 olfactory receptor Olr1124 Olr1124 __SEG__ Chr8 {Rattus norvegicus} MEVKNKSVVLDIFLRGLTDDTELQPLIFVFFLCMYLITISGNLLIMLAINCDRHLHTPMYFFLCHLSFNDIYLISITVPKMLVNIQTQDQRITYAGCLSQVCFVVVCTIF
ECFLLGVMAYDRYIAICNPLRYTVLMNPCFCIILVLISLTISIVNGLVHSLMVLHLSFCTDLEILHFFCEIAQVLKLACSDSLINNILIFVSASIFAGVPLYGIIFSYTH
IVFTVLKMPSSEGKYKAFSTCGSHLLVVALFYGTGFGVYIISNVIDSPKKIAVASVMYSIIPPMMNPFVYSLRNKDMKEALKKVVGRIASLL*
377 >lcl|NP_001000427.1|Plus1complement(13988468..13989442) NW_047798 olfactory receptor Olr1139 Olr1139 __SEG__ Chr8 {Rattus norvegicus} MWPLISPPLLIFFRNTEYRNQTFASGFILLGLTDDPELQLILFGIFLFMYLVTVLGNLIIILAVILDSHLHTPMYFFLSNLSFTDICFITSTVPKMLVNIQRESNAISYT
DCLTQMYFVVFLGGMENFLLAAMAYDRYVAICHPLRYTVMMNPSICIVLTLLSILSSMIDALLHSLLVLRLSFCTYFEIPHFFCELAHVIKLSCSDTLINNIVIYMATFI
FGGLPFWGIILSYVKIVSSVLKQPSKRHSYKALSTCGSHLLVVSLFYGSVIGVYISFAVTDSTRKTAVASVLYTVVPQMLNPFVYSLRNKDMKEAMRKLSVGIV*
378 >lcl|NP_001000428.1|Plus1complement(13788103..13789041) NW_047798 olfactory receptor Olr1130 Olr1130 __SEG__ Chr8 {Rattus norvegicus} MEVKNKSVVLDIFLRGLTDDTELQPFIFGFFLCMYLITIFGNLPIMLVINCDSHLHTPMYFFLCHLSFNDMYLISVTVPKMLLNIQTHDQKITFAGCLSQGCFVAVCTIF
ECFLLGVMAYDRYIAICYPLRYTVLMNPHFCVILVLISLSISIVNGLLHSLMVLHLSFCTDLEILHFFCEIAQILKLACSYSLINNILIFATASIFAGVPLFGIILSYFH
IISTVLKMPSSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSNVIDAPQKIAVASVMYSIVPPMMNPFIYSMRNRDIKEALKKVIGRPVSLL*
379 >lcl|NP_001000429.1|Plus1complement(14225015..14225932) NW_047798 olfactory receptor 1145 Olr1145 __SEG__ Chr8 {Rattus norvegicus} MELENQTRVIEFFLLGFSEDPELQPILFGLFLLIYLVTICGNLLIILAIVSDSHLHIPMYFFLSNLSFTDICFSTTTVPKMLINLQKQSKAISYTGCITQLSCVLLFAGM
ENFLLAAMAYDRYVAICKPLHYTAIMKAHLCLVMILLSLYISIVDALLHGLMILRLSFCTFLEIPHYFCELYQVIKLSCSDTLINNILVYTMTSTLGGVPLGGIIFSYFK
IISSILRMPSSGSRHRAFSTCGSHLSVVSLFYGTAFGVYISSAFTESYRKTSAASLMYTVLPPMLNPFIYSLRNKDMKNALKKII*
380 >lcl|NP_001000431.1|Plus1complement(14371564..14372502) NW_047798 olfactory receptor Olr1147 Olr1147 __SEG__ Chr8 {Rattus norvegicus} MELGNKTTTSYFILMRLTHDPTMEPFIFGFFLFTYLVTILGNLLIIIAVSSDAHLQTPMYLFLSKLSFTDICLSTTTVPNMLKNIHTQDQSISYTGCVTQACFVLSFAVL
ESCVLAAMAYDRYAAICHPLNYTVIMNPYFCGLLILLSLIISIVNSLLQCLMILRLSFCTNIELPIFFCELAQVIKLACSDTLINYILIYFATFVFGGIPISGIIFSYTR
IVSSILKISSLRGRYKAFSTCGSHFLVVSLFYGAAVGVYICSAITVSPRITTVSYMMYTVLPQMLNPFIYSLRNRDMKKALGKLITKVSCFL*
381 >lcl|NP_001000432.1|Plus1complement(14528980..14529897) NW_047798 olfactory receptor Olr1151 Olr1151 __SEG__ Chr8 {Rattus norvegicus} MELKNQTTVIEFFLLRLSENPELQPILFGLFLLMYLLTVSGNLLIILAIVSDSHLHTPMYFFLSNLSFNDICFSTTTVPKMLINLQKQSKAISYTGCVTQLSFVLLFAGM
EDFLLAAMAYDRYVAICKPLHYTAIMKTHLCLVMILLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELDQVIKLACSDTLINNILVYTMTIALGGVPLVGIIFSYFK
IISSILRMPSSGGRHKTFSTCGSHLSVVSLFYGTAFGIYISSAFTESYRQTSVASLMYTVIPPMLNPFIYSLRSKDMKKALRKII*
382 >lcl|NP_001000433.1|Plus1complement(14631737..14632675) NW_047798 olfactory receptor Olr1155 Olr1155 __SEG__ Chr8 {Rattus norvegicus} MEKRNQTAFPGFFLLGLTEDPKLQPILVSLFFSIYLVTLMGNLLIILFVISDSHLHTPMYLFLSNLSLNDICLSTSTIPKMLVNIQENSQSITFKGCLTQMSFVLIFGGM
ENCLLAVMAYDRYMAICHPLRYLVIMEPCFCVLLVLLSLLISLVDSLMHSLMVLRLSFCRHLEIPNFFCELPKMLKLACSDTLIDNILIYISSCIFAGIPLFGIVFSYIH
IMSSIFRMPSSEGKHKAFTTCGSHLSVVSLFYGTGFGVYITSIIMDSSRKTAVASVMYSVVPQMLNPFIYSLRNREMKHAMRKFFSRMASFL*
383 >lcl|NP_001000434.1|Plus115228563..15229519 NW_047798 olfactory receptor Olr1169 Olr1169 __SEG__ Chr8 {Rattus norvegicus} MELYNLTGTLEFLLLGLSEDPEMQPILFVLFLLIYLFTVLGNVLIILAIGSDSHLHSPMYFFLYYLSLSDMGFSSTTIPKMLINLQTYKKSITYVACLSQVSFFFLFGCM
DSLLLTVMAYDRWVAICHPLHYQVFLNPRLCRCLVIVSFFFSLMDSQVHYLMVSQLKFCTNLEIPHFFCDVTELLKLACTDTTISKIVIFLASIIIGFLPASGILYSYYK
IISSIVRVTSSSGKYKAFSTCGSHLSVVCLFYGTGIGVYLSSSISSSSKQSVIASVMYTTIVPMMNPFIYSLRNKDIKRALQKIFTQITHLTVKSINV*
384 >lcl|NP_001000435.1|Plus18663962..8664894 NW_047799 olfactory receptor Olr1196 Olr1196 __SEG__ Chr8 {Rattus norvegicus} MTVKNSSVTEFILEGLTDQPGLRMPLFFLFLGFYMVTVVGNLGLIFLIGLNSHLHTPMYFFLFNLSVVDFCYSSTIIPKMLMSFISKKNIISHSGCMTQLFFFCFFVVSE
SFILSAMAYDRYVAICNPLMYTVTMSPQVYLLLLLGVYVMGFSGAMAHTGNLMNLTFCADNLVNHFMCDILPLLELSCNSTFTNELVVFIVVAFDIGVPIVTIFISYALI
LSSVLRMHSTEGRSKAFSTCSSHLIVVCLFFGSGAFMYLKPPSILPLDQGKVSSLFYMIVVPMLNPLIYSLRNKDVKVALRKTLGKKILS*
385 >lcl|NP_001000436.1|Plus18730043..8730972 NW_047799 olfactory receptor Olr1198 Olr1198 __SEG__ Chr8 {Rattus norvegicus} MTVKNSSVTEFILAGLTDQPGLRLPLFFLFLGFYMVTVVGNLGLIFLIGLNSHLHTPMYFFLFNLSVVDFCFSSTIIPKMLMSFISKKNIISHSGCMTQLFFFCFFVVSE
TFILSAMAYDRYVAICNPLMYTVTMSPQVCLLLLLGAYVMGFSEAMAHTGNLMNLTFCADNLVNHFMCDILPLLELSCNSTFINELVVFIVVAIDIAVPIVSIFISYALI
LSSILRMHSTEGRSKAFSTCSSHLIVVCLLFGSGAFMYLKPPSILPLDQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLGKIIL*
386 >lcl|NP_001000437.1|Plus19004678..9005622 NW_047799 olfactory receptor Olr1204 Olr1204 __SEG__ Chr8 {Rattus norvegicus} MTRERMALGNDSSVKEFILLGLTQQPELQLPLFFLFLGIYVCSVVGNLGLLVLIVLNPHLHTPMYYFLFNLSFVDFCYSTVITPKMLVSFVKQNIISHAECMTQLFFFCF
FVINECYILTAMAYDRYAAICKPLLYQVTMSHQVCLLMTVGVYVLGFVEAIAHTGSMVHLTFCDGNIIDHYMCEINALLKLSCTSTSINELVVFIVVGFNVTMPTLTIFI
SYTLILSNIHSIHSTEGRSKAFSTCGSHIIAVSLFFGAAAFMYLNPSSASEDEDKVSTIFYTIMGPMLNPFIYSIRNKDVHIALRKTLKKSMFI*
387 >lcl|NP_001000438.1|Plus19226681..9227613 NW_047799 olfactory receptor Olr1214 Olr1214 __SEG__ Chr8 {Rattus norvegicus} MALGNVSSVKEFILLGLTQEPELQLPLFFLFLGIYVVSVVGNLGLIVLIVLNPHLHTPMYYFLFNLSFVDFCYSSVITPKMLVGFVKQNIISHAECMTQLFFFCFFVIDE
CYILTAMAYDRYAAICKPLLYQVTMSHQVCLLMTVGVCVMGLVGALAHIVCMLRLTFCDGNIINHYMCDIPPLLKLSCTSTSINELVVFIVVGVNVIVPTLTIFISYTLI
LSNILSIHSAEGRSKAFSTCGSHVIAVSLFFGAAAFMYLKPPSASVDDEDKLSTIFYTIVGPMLNPFIYSIRNKDVHVALRKTLRKSIFT*
388 >lcl|NP_001000439.1|Plus19291284..9292216 NW_047799 olfactory receptor Olr1217 Olr1217 __SEG__ Chr8 {Rattus norvegicus} MAVGNVSSVKEFILLGLTQKPELQLPLFFLFLGIYVVSVIGNLGLIVLIVLNPHLHTPMYYFLFNLSFIDFCYSSVITPKMLVGFVKQNIISYSECMTQLFLFAFFVIDE
CYILTAMAYDRFAAICRPLMYQVTMSHQVCQLMMMGVYVMGFVCAMAHTGCMLSLTFCDGNIINHYMCDIPPLLKLSCTSTSINELVVFIAVGVNVIIPSLTLFVSYTLI
LSNILSIHSAEGRSKAFSTCGSHVISVSFFFGAAAFMYFKPPNASVDDDKVSTIFYTIVGPMMNPFIYSIRNKDVHIALRKTLKKIFLLK*
389 >lcl|NP_001000440.1|Plus19983295..9984233 NW_047799 olfactory receptor Olr1222 Olr1222 __SEG__ Chr8 {Rattus norvegicus} MQMAVENDSSVTEFVFRGLTDQPEFQLPLFFVFLLNYTATVMGNLSLMFLIGLNSHLHTPMYFFLFNLSLVDFCYSFVCTPKMLMGFVSEKSIISYTGCMTQLFFFCFFV
NSECYVLTAMAYDRYVAICKPLIYAILMSPRMCSLLMIGSYLMGFASAMAHTGCMIRLSFCDSNIINHYMCEIFPLLQLSCSSTYANELVSSLIACIVVIVSGLVILTSY
VSILLNIVHMSSATGWSKAMGTCGSHIITVSIFYGSGLLTYVKPASADSVGQGKFFSVFYTLMVPMLNPLIYSLRNKDVKLAVKRTMRRITM*
390 >lcl|NP_001000441.1|Plus110001600..10002541 NW_047799 olfactory receptor Olr1223 Olr1223 __SEG__ Chr8 {Rattus norvegicus} MIEKTMENKSSVSEFILMGLTEQPELQLPLFVLFLMNYTATVMGNLSLMSLISLNSNLHTPVYFFIFNLSFIDFCYSMVSTPKMLMSFVLEKNTISFSGCMTQLFFFCVF
INAESYVLTAMAYDRYVAIGQPLMYQVVMSPKICCLLIFGSYLMGFVSAMAHTGCMVRLTFCDSNIINHYMCDIFPLLQLSCSSTYVNELMSYVAVGTAIILCSLIILVS
YALILFNIIHMSSGKGWSKALGTCGSHIITVSLFYGSGLLAYVKPSSAETVGQAKFFSVFYTLLVPMLNPLIYSLRNKDVKLAMQKSWKRITS*
391 >lcl|NP_001000442.1|Plus110051402..10052343 NW_047799 olfactory receptor Olr1226 Olr1226 __SEG__ Chr8 {Rattus norvegicus} MKKIIMENDSFVSEFILMGLTDQPGLQLPLFALFLMNYTATVMGNLSLMSLIFLNSNLHTPMYFFIFNLSFIDFCYSYVFTPKMLMSFILERNTISFRGCITQLFFFCFF
VNSESYVLTAMAYDRYVAICKPLLYKAIMVPRICCLLIFVSYLIGFVCAMILTGLMFRLKFCNISIINHYMCDIFPVIRISCSNTYVNELVSSAVVGTGIILCSLLILIS
YAMILSNILYMSSGKGWSKALGTCGSHIITVSFFYGSGLLAYVKPSSAETVGQGKIFSVFYTFLVPMLNPLIYSLQNKDVKIAVKKTLKRITS*
392 >lcl|NP_001000443.1|Plus110059312..10060244 NW_047799 olfactory receptor Olr1227 Olr1227 __SEG__ Chr8 {Rattus norvegicus} MATENDSSVSEFILMGLTDQPELQLPLFALFLMNYTATMVGNLSLMSLIFLNSNLHTPMYFFIFNLSFIDFWYSFVFTPKMLMKFFLEKNTISFKGCMTQLFFFCFFVNS
ESYVLTAMAYDRYVAICKPLLYKAIMLPRICCLLMFMSYLMGFASAMILTGFMFRLNFCRSNIINHYMCDIFPLLRISCTNTYVNELVSSAVVGTAIILCSLLILISYAL
ILFNILHMSSGKGWSKALGTCGSHIITASLFYGSGLLAYVKPSSAKTVGQGKFLTVFYTCLVPVLNPLIYSLQNKDVKIAVKKTLKRITS*
393 >lcl|NP_001000444.1|Plus110095883..10096824 NW_047799 olfactory receptor Olr1229 Olr1229 __SEG__ Chr8 {Rattus norvegicus} MKQMVMENHSSVSEFILMGLTEQPDLQCPLFVLFLVNYTATVVGNLTLMTLICLNSHLHTPMYFFILNLSFIDFCYSFVFTPKMLMGFVSEQNTISFTGCMTQLFFFCLF
VNSECYVLTAMAYDRYVAICRPLLYTVVMSPRACCLLMLAAHLMGVSSAFVHTGCIIHLRFCGSKVINHYMCDTFPLLEISCGSNHANELVSSVSVAVVILLSGLIIISS
YALIIVNIIYSSSSKGWSKAVSTCSSHIITVALFYGFGLLAHIKPSSSESVVQRKFFSVVYTFVLPLLNPLIYSLRNKDVKLAVKRILKRVTI*
394 >lcl|NP_001000445.1|Plus110131833..10132765 NW_047799 olfactory receptor Olr1232 Olr1232 __SEG__ Chr8 {Rattus norvegicus} MALENASLVTEFILVGLTNQPDLQIPLFLLFLVIYMISTMGNLALIILIFLNSHLHTPMYFFLLNLSCIDLCYCSVGTPKMLMNFVLKENAISYEGCMTQFYFFCFFIIS
ECYVLTAMAYDRYVAICNPLLYNIVMSPKVCSYLMIASYLVGFSDGMIHTGCVLRLTFCDGNTINHYFCDLLPLLQLSCTSTYVNEIEVLIISGINIIVPTLIVFTSYGF
ILSSILKINSTAGRSKAFSTCSSHIIAVSLFFGSGAYMYLKPSSSGSLDQGKISSVFYNIVVPMMNPLIYSLRNKDVKTALKKTLTKRNF*
395 >lcl|NP_001000446.1|Plus110163667..10164608 NW_047799 olfactory receptor Olr1234 Olr1234 __SEG__ Chr8 {Rattus norvegicus} MKQTVIASNSSVTEFILMGLTVQQELQVPLFVLFLLNYMVTVVGNLSLMNLICLNSCLHTPMYFFIFNLSCIDFCYSFVCNPTMLRSFISEENTISYDGCMSQLFFFCFF
VNSECYVLTAMAYDRYVAICHPLQYITVMSPMICCLLVFGSYLMGFAGALAHTGFMIRLTFCDSNIINHYMCDIFPLLQLSCTSTYVNELVSSAVVGAIIILSSIIILVS
YAMILSNILHMSSGKGWSKALGTCGSHIITVSLFYGSGLLAYVKPTSADTVGQGKLLSIFYTLVVPTLNPLIYSLRNKDVKLAVKRTMQRITS*
396 >lcl|NP_001000447.1|Plus110174790..10175731 NW_047799 olfactory receptor Olr1235 Olr1235 __SEG__ Chr8 {Rattus norvegicus} MLAGNGSFVTEFVLAGLTDCPELQLPLFFLFLIIYIITVAGNIGLIILIGLNPHLHTPMYYFLFNLSFIDLSYSSVFSPKMLMNFVSEKNSISFEGCMTQLFLFLFFVIS
ECYMLTSMAYDRYVAICNPLLYKVTMSPQVCSILSFAAYGMGFAGASVHTGCMLRLTFCNANLINHYLCDILPLLQLSCTSTYVNEVVVLVVVGINITVPSCTILISYVF
ILANILNIKSTQGRSKAFSTCSSHIMAISLFFGSAAFMYLRYSSGSMEQGKISSVFYTNVGPMLNPLIYSLRNKDVKVALRKSFIKFQREYKF*
397 >lcl|NP_001000448.1|Plus110225313..10226245 NW_047799 olfactory receptor Olr1240 Olr1240 __SEG__ Chr8 {Rattus norvegicus} MASANVSLVTEFILVGLTNQPDLQIPLFFVFLIMYIVTALGNLCLIILIVLNSHLHTPMYFFLFNLSFIDLCYSTVFTPKMLMNFILSKNAISYMGCLTKLYFFCFFVIS
ECYVLTSMAYDRFVAISNPLLYTVAMSPKLCLNLMLGTYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDILPVMQLSCTSTYVNELVVFIVVGINIIVPSITIFISYGF
ILSSIFHIKSNEGRSKAFSTCSSHIIAVCLFFGSGAFMYLKPSSSSSMDQGKTSSVFYTNVVPMMNPLIYSLRNKDVKMALRKTLSRRKF*
398 >lcl|NP_001000449.1|Plus110239172..10240104 NW_047799 olfactory receptor Olr1241 Olr1241 __SEG__ Chr8 {Rattus norvegicus} MGSANGSSVTEFILMGLTKQPDLQCPLFILFLVMYVVTVLGNLGLISLIELNSHLHTPMYFFLLNLSFVDLWYSSVFTPKMLVNFRSEKNIISYRGCMAQLFFFCFLSIS
ECYVLTSMAYDRYVAICNPLLYNIVMSPKLCLSLMFGSYMMAFSGAMAHTGCMLRLTFCDANTINHYFCDIPPLLQLSCTSTYVNELEVFVVVGINILVPSITIFISYGF
ILSNIFHISSKEGRSKAFSTCSSHIIAISLFFGSGAFMYLKPSSAESMNEGKISSVFYTNTVPLLNPLIYSLRNKDVKTALIKTLSTRKC*
399 >lcl|NP_001000450.1|Plus110261671..10262606 NW_047799 olfactory receptor Olr1242 Olr1242 __SEG__ Chr8 {Rattus norvegicus} MALGNWSFVTEFILIGLTEQPNLQLPLFFLFLVMYMVTITGNLGLVILIGLNSHLHTPMYFFLFNLSLIDLCYSSVFTPKMLLNFILTKNIISYMGCMTQLYFYSFFVIS
ECYVLMTMAYDRYVAICNPLLYNIAMSPKICSYLLLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDILPVMQLSCTSTYVNELEVLIVVGINILVPSITIFISYGF
ILSSIFHINSNEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSVGSMDEGKISSVFYTNVVPMMNPLIYSLRNKDVKVALRKTLSRWKLW*
400 >lcl|NP_001000451.1|Plus110270520..10271452 NW_047799 olfactory receptor Olr1243 Olr1243 __SEG__ Chr8 {Rattus norvegicus} MALENASLVTEFILMGLTNQPELKIALFLLFLGMYMITTLGNLALIVLIVLNSQLHTPMYFFLLNLSCIDLCYCSVITPKMLMSFIVKRNVISYEGCMTQFYFFAFFVIS
ECYVLTAMAYDRYVAICKPLLYNIVMSPKVCSYLMTGSYLVGFSGAMIHTGCILRLNFCDGNTINHYFCDILPLLQLSCTSTYVNEIELFIVAGKDIIVPTVIIFTSYGF
ILSSILKIRSTEGMSKAFSTCSSHIIAVSLFFGSCTFMYLKPSSVGSMDQGKISSVFYNIVVPMMNPLIYSLRNKDVKIALKKTITKRKF*
401 >lcl|NP_001000452.1|Plus110329686..10330618 NW_047799 olfactory receptor Olr1248 Olr1248 __SEG__ Chr8 {Rattus norvegicus} MVLTNGSLVTEFILLGLTDNPDLQIPLFLVFLVMYTITAFGNLTLILLTVLNSHLHTPMYFFLFNLSFIDLCYSSVVTPKMLMNFVLKKNIISFAGCMTQLYFFCFFVIS
ECYVLTAMAYDRYVAICNPLMYNVAMSPKVCSYLMLGSYLMGFSDAMIHTGCILRLTFCDGNTINHYFCDLLPLMQLSCTSTYVNEVEIFIVGGKDITVPSIIIFISYGF
ILSNILQIKSNVGRSKAFNTCSSHIIAVSLFYGSCAFMYLKPSSAGSLNEGKVSSVFYTIVVPMMNPLIYSLRNKDVKLALRKTLSTKIF*
402 >lcl|NP_001000453.1|Plus110375632..10376561 NW_047799 olfactory receptor Olr1251 Olr1251 __SEG__ Chr8 {Rattus norvegicus} MALANGSSVTEFILLGLTDQPDLQMPLFLIFLVMYLITALGNLTLIILIMLNSHLHTPMYFFLFNLSFIDLCYSSLITPKMLMNFVLEKNIISYMGCITQFYFFGFFAIS
ECYVLTAMAYDRFVAICNPLFYSVAMSPKKCFYLIFGSYFMGFSGAIIHTGCVMRLTFCDGNTINHYFCDLLPLLQLSCTSIYVNEIELFIVTGKDIIVPTVIIFASYGF
ILSSILKIRSTSGRSKAFSTCSSHIIAVSMFFGSSAFMYLKPSSAVSMNEAKFSSIFYSIVVPMMNPLIYSLRNKDVKVALKKTLSRMF*
403 >lcl|NP_001000454.1|Plus1complement(10390276..10391208) NW_047799 olfactory receptor Olr1252 Olr1252 __SEG__ Chr8 {Rattus norvegicus} MGSENGSSVTEFILVGLTKQPDLQCPLFILFLVMYVVTVLGNLGLITLIALNSHLHTPMYFFLFNLSFVDLWYSSVFTPKMLMSFISEKNIITYKGCMTQLFFFSFFCIS
ECYVLTVMAYDRYVAICNPLLYNIVMSPKLCLNLVLASYIMAFSGAMAHTGCMLRLTFCDANTINHYFCDIPPLLQLSCTSTYVNELEVFVVIGINILVPSITIFISYGF
ILSSIFHISSKEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSAESMNEGKISSVFYTNTVPLLNPLIYSLRNKDVKIALIKTLSKRKC*
404 >lcl|NP_001000455.1|Plus110539208..10540155 NW_047799 olfactory receptor Olr1259 Olr1259 __SEG__ Chr8 {Rattus norvegicus} MALLNGSVVTEFILLGLTDQPDLQIPLFLIFLLLYIITALGNLSLIILIVLNSHLHTPMYFFLFNLSFVDFCFSSVITPKMLMNFILTKNHISYVGCMTQFYLFCFCVIS
ECYILTSMAYDRYVAICNPLLYNIVMSPKVCSYLMLASYLMGFSGAMIHTGCILRLTFCDGNTINHYFCDLLSLLQLSCTSTYVNEIELLIVAGKDIILPTVVIFISYGF
ILFNIFQMKSTESMSKAFSTCSSHIIAVSLFFGSGAFMYLKPNSAGKMNNGNTSSIIYTTLIPMINPLIYSLRNKDVKVALRKTLRKKIFNWNLI*
405 >lcl|NP_001000456.1|Plus110687737..10688672 NW_047799 olfactory receptor Olr1264 Olr1264 __SEG__ Chr8 {Rattus norvegicus} MDTKNISFITEFILVGLTEYTETHFPFFFLFLGIYVITVAGNLGLLTLIGMNSPLHTPMYYFLFNLSFIDLCYSTVITPKLLVNFVSEKNTISYEGCMTQLYFYCFFVSA
ECYVLTVMAYDRYVAICKPLLYTVTMSPQVCSLLTLTVYVGAFIGAWAHTGCMLRLTFCKDNTVNHYMCDILPLLELSCSSTYINELVVFIVVGFDVGVPSITIIVSYTF
ILSSILHIHSTEGRSKAFSTCSSHIIVVSVFFGSGAFMYLHPSSVLSMDQGKVSTVFYTIVVPMLNPLIYSFRNKEVKVALRKTLSMKIFS*
406 >lcl|NP_001000457.1|Plus110700919..10701872 NW_047799 olfactory receptor Olr1265 Olr1265 __SEG__ Chr8 {Rattus norvegicus} MNTNRRMIHGNYSLVTEFILEGLTNRPELQIPLFFLFLGIYVVTIVANLGLITLISLNSHLHTPMYYFLFNLSFVDICYSSVFTPKMLINFVVEKNTISYTGCLTQLYFF
CFFVITECYILTAMAYDRYVAICKPLLYNVILSPRICAVFVFGAYVMGCWGSLAHTLCMARLTFCDANLVNHYLCDILPVLQLSCTSTYNNEVVVFVLVGMNIVVSTSTT
FVSYGFIIANILRISSTQGRAKAFNTCSSHIMTVSLFFGAAAFMYMQPSDVESMDKGKVASVFYTNVGPMLNPLIYSLRNKDVKLALKKTLKRNLFS*
407 >lcl|NP_001000458.1|Plus1complement(10801590..10802525) NW_047799 olfactory receptor Olr1273 Olr1273 __SEG__ Chr8 {Rattus norvegicus} MSNLSIVTQFILLGIPHTEGVETMLFVLFLSFYIFTLVGNVLILLTIVSSNRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNSRAISYAGCVCQLFFYHFLGCTEC
FLYTVMAYDRFIAICFPLRYSIIMNHRVCAILAVGTLFFGCIQATFLTALTFQLPYCGPNEVEYYFCDIPVMLKLACADTSALEMVGLISVGLMPLSCFLLILTSYSFIL
CSILQIRSTEGRHRAFSTCSAHLAAILLAFMPVVLIYLQPTPNPWLNAAVQVLNNLVTPMLNPLIYSLRNKEVKCSLKKVLQQALILSKRR*
408 >lcl|NP_001000459.1|Plus1complement(11049647..11050591) NW_047799 olfactory receptor Olr1285 Olr1285 __SEG__ Chr8 {Rattus norvegicus} MEKMAAGNHCTVTVFFLAGLSEKAELQLPLLLLFIGIYLITVAGNLCIILLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLMSFVTEKNIISYPGCLAQLYFAIIF
GTAESYTLAAMAYDRYVAICNPLLYNATMSYHIYCSLISGVYIFAVFCASVNIGFMFRIQFCKLDVIEHYFCDLLPLLKLACSNTYINEMLILFFGTLNICVPMLIVIAS
YIFIIASILHIRSSEGVSKAFSTCSSHISAVAIFYGSVAFMYLQPSSVNAMGQAKVSSVFYTTVVPMLNPLIYSLRNKDVTVALKKILERRKIM*
409 >lcl|NP_001000460.1|Plus1complement(11262348..11263292) NW_047799 olfactory receptor Olr1293 Olr1293 __SEG__ Chr8 {Rattus norvegicus} MEDNTARNHSTVTEFFLAGLSQTPELQLPLFFLFTGIYLITVAGNLGIITLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNLISYPGCMTQLYFFITF
GIAECYTLAAMAYDRYVAICNPLLYNITMSSQIYTSLISGVYIFAVICASVNTGFMIRIKFCKLDVINHYFCDFLPLLKLGCSNIYINEMLILSFGTVNIFVPMMTIIIS
YILIIASILHIHSSEGRSKAFSTCSSHISAVAVFYGSAAFTYLQPSSVILKDQGKVSSVFYTTVVPMLNPLIYSLRNKDVTVALKKILETKKFM*
410 >lcl|NP_001000461.1|Plus1complement(11329971..11330915) NW_047799 olfactory receptor Olr1297 Olr1297 __SEG__ Chr8 {Rattus norvegicus} MEEVNQTSVAEFILAGLTENPELQLPLFLIFLAVYLITVVGNLGMIILILFSSQLHTPMYYLLSSLSFIDYCQSTVIIPKMLLNFMTEKNFISYPECIVQFYFFCVFVVA
ECHMLGAMAYDRFVAISNPLLYNVSMSFQVCLLMVAVVYGVGLLSATAHTVFLLRVFFCKADKINHYFCDLFSLLELSCSSTFINEVLGHSISAFNIIVPSMTIISSYIF
IIVRILHIKSSGGRIKAFSTCSSHILAVALFFGSTTFMYLQPSSSSSMDQAKMSSVFYTIVVPMLNPVIYSLRNKEVKVALKRLLRKMFPQNKE*
411 >lcl|NP_001000462.1|Plus1complement(11915320..11916264) NW_047799 olfactory receptor Olr1301 Olr1301 __SEG__ Chr8 {Rattus norvegicus} MEEVNQTSVAEFILAGLTENPELQLPLFLIFLAVYLITVVGNLGMIILILFSSQLHTPMYYFLSSLSFIDYCQSTVIIPKMLLNFVTEKNFISYPECIAQFYFFCVFVVA
ECHMLGAMAYDRFVAISNPLLYNVSMSFQVCLLMVAMVYGVGLLSATTHTVFLLRVFFCKTDKINHYFCDLFPLLELSCSSAFINEVLGHSISAFNIIVPVMTIISSYIF
IIVSILHIKSSGGRVKAFSTCSSHILAVALFFGSTTFMYLQPSSISSMDQGKVSSVFYTIVVPMLNPMIYSLRNKEVKIALKRLLRKMFPQNKE*
412 >lcl|NP_001000463.1|Plus1complement(11941347..11942291) NW_047799 olfactory receptor Olr1302 Olr1302 __SEG__ Chr8 {Rattus norvegicus} MEDMAAGNHCTVTEFFLAGLSEKPGLQLPLFLLFIGIYLITVAGNLGMILLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNIISYPGCMTQLYFFLIF
AIAECYILAAMAYDRYVAICNPLLYNVTMSYQIYISLISGVYIIGVICASAHTGLMVRIRFCKLDVINHYFCDLLPLLKLACSSTYINEMLILFFGTLNIFVPILTIITS
YIFIIASILRIRSTEGRSKAFSTCSSHILAVAVFFGSLAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVSIALKKILERKTFM*
413 >lcl|NP_001000464.1|Plus1complement(11987108..11988043) NW_047799 olfactory receptor Olr1304 Olr1304 __SEG__ Chr8 {Rattus norvegicus} MAEGNYSTMTEFVLTGLTEKPGLQLPLFFLFLGIYVVTVLGNLGMVMLILFSPHLHTPMYFFLSNLSLVDLCQSSVIMPKMLENFVMVKSVISYAECMAQFYLFDVFAVS
ECHMLAAMAYDRYVAICNPLLYNVTMSYNVCSWMVVAVYSVGLICATGETVCLLRLLFCKAEDINHYFCDLLPLLEQSCSSTFINEVLGLSFGSFNIIVPALNILSSYIF
IMATILRIPSTEGRSKAFSTCSSHILAVAVFFGSLTFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYNLRNKDVKVAFYKIVGKRQFL*
414 >lcl|NP_001000465.1|Plus1complement(12035663..12036601) NW_047799 olfactory receptor Olr1306 Olr1306 __SEG__ Chr8 {Rattus norvegicus} METKNCSMVTEFILLGIPHTEGLETMLFVLFLPFYACTLVGNVCILVAVISSTRLHTPMYFFLGNLSVFDMGFSSVTCPKMLLYLMGLSRLISYQDCVSQLFFFHFLGSI
ECFLYTVMAYDRFAAICHPLRYSIVMSSRICVALAVGTWLLGCLHSSVLTSLTFTLSYCGPNEVDHFFCDIPAILPLASGDTSLAQRVSFTNVGLVSLVCFLLILVSYTR
ITISILSIHSTEGRQRAFSTCSAHLIAILCAYGPIITVYLQPTPNPMLGTAVQILMNLVGPMLNPLIYTLRNKEVKIALKKILHGKGSISEV*
415 >lcl|NP_001000466.1|Plus112107384..12108328 NW_047799 olfactory receptor Olr1309 Olr1309 __SEG__ Chr8 {Rattus norvegicus} MTNNTMVTEFTLLGIPETEGLESVLLFLFSTLYACALLGNLLLLTAVTSSPRLHTPMYFFLSNLSIYDMGFCSTTSPKMLSYLSGWGGGISFQGCVVQHFFYHCIGCILC
FLYTVMAYDCFVAICFPLRYTIIMNHRVCCALATGTWMSGCVHSTILTSLTFQLPYCGPSKVGYYFCDMPAVLLLACEDSSLAQRVGFTNVGLLSLICFFLIVVSYTRIG
ISISKIRSTEGRQRAFSTCSAHLTAIMCVYGPVIVIYLQPNPSPLLSAIIQIFNNLVTPTINPLIYSLRNKDVKAALRHVFLKRCLSLEVNENI*
416 >lcl|NP_001000467.1|Plus112136506..12137450 NW_047799 olfactory receptor Olr1311 Olr1311 __SEG__ Chr8 {Rattus norvegicus} MTNHTMVTEFTLLGIPETEGLENVLLFFFATMYACALLGNFLILTAITTSPRLHTPMYFFLGNLSIFDLCFCSTTAPKMLSYLSGWGGGISFKGCVVQHFFYHCLGCTLC
FLYTVMAYDRFVAICFPLRYTIIMNHRVCCALATGTWMSGCIHSTILTSLTFQLPYCGPSEVSYYFCDMPAVLLLACEDSSLAQRVGFTNVGLLSLICFFLIVVSYTRIG
ISISKIRSTEGRQRAFSTCSAHLTAIMCVYGPVIIIYLQPNPSPQLSAIIQILHNLVTPTINPLIYSLRNKDVKAALRHVFLKKCLSLEVNEHT*
417 >lcl|NP_001000468.1|Plus1complement(12198106..12199023) NW_047799 olfactory receptor Olr1314 Olr1314 __SEG__ Chr8 {Rattus norvegicus} MANRTLLDEFILLGIPQTQGLETLLFVVFLFIYFFTLLGNSLIFTAIVSSSSLHTPMYFFLGLLSIFDIMFPSVTCPKMLFYLSGQSPAISYKGCVAQLFFYHFLGSTEG
CLYSVMAYDRYVAICHPLRYMLIMKPGVCLSLVTVSWLVGCLQSSILTFFTFQLTYCGPNHVHHFFCDIPAVLPLACTDNKLAQKVGSINVGFLALMLLFSVCVSYVHIG
VAILRIRSAEGRQKAFSTCSAHLTAILCAYGPVIIIYLQRTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRSLRRVFHTLA*
418 >lcl|NP_001000469.1|Plus1complement(12224934..12225869) NW_047799 olfactory receptor Olr1315 Olr1315 __SEG__ Chr8 {Rattus norvegicus} MKNLSVVTQFILLGIPHTEGLETMLFVLFLSFYIFTLVGNLLILLAIVSSTRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTEC
FLYTVMAYDRFVAICYPLRYSVIISHRVCAILAIGTLVFGCIHSTFLTTLTFQLPYCGPKDVNYYFCDIPVVMKLACADTSALEMVGFISVGLMPLSCFFFILTSYSCIL
RSILQIRSTEGRHRAFSTCSAHFTAILLFYMPVIFIYLRPTPSPWLDATVQILNNLVTPMLNPLIYSLRNKEVKSSLWIVLRPLCFLSKHL*
419 >lcl|NP_001000470.1|Plus112311524..12312462 NW_047799 olfactory receptor Olr1319 Olr1319 __SEG__ Chr8 {Rattus norvegicus} MPEGNHSRVTEFILTGLTDKPELQLPLFLLFLGIYLLTVLGNLGMIILILLSSHLQTPMYFFLSGLSFIDLGYSTVIIPKMLVNFVTEKNVISYPGCMTQLYCFIAFVLC
ECYMLSAMAFDRYVAICNPLRYNVTMSYQVCFWMIGGVYSIGFIEATIHTVCMLQVFFCKANVVNHFFCDLLPLFQLACSSTFVNETVLLCLSTLNFCVPTLTILSSYSF
IIARIIRIKSTESRFKAFSTCSSHFSSVAVFFGSLGFVYFQPSSVSSKDQGKVSSVFYTIIVPMLNPLIYSLRNKDVKLALNKLFQKKIFHM*
420 >lcl|NP_001000471.1|Plus112333015..12333953 NW_047799 olfactory receptor Olr1320 Olr1320 __SEG__ Chr8 {Rattus norvegicus} MAKDNQSRVTEFILAGLTDKAELQLPMFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMYFFLSSLSFIDLCYSTIITPKMLVNFVTTKNVISYQECMTQLYFFIAFVIS
ECHMLAAMAYDRYVAICNPLLYNVTMSYQVCARMVGGVYGMGFIGAAIHTLCMLRVVFCKNNIINHYFCDLFPLMELACSSTYVNEVVLLCLSAFNIFIPTLTILGSYVF
IIASILRIKSTEGRFKAFSTCSSHFCAVSVFFGSLAFMYLQPFSVSSKDKGKVSSVFYTTVVPMLNPMIYSLRNRDVKLALNKIFQKRKLHV*
421 >lcl|NP_001000472.1|Plus112382633..12383568 NW_047799 olfactory receptor Olr1323 Olr1323 __SEG__ Chr8 {Rattus norvegicus} MFKGNVSDVTEFILAGLTDKPELQLPLFLLFLGIYVLTVVGNLGMITLILFSSQLHTPMYYFLSSLSFIDLCQSTVIIPKMLVNFLAVKNIISYPECMTQLYFFIIFAIA
ECHTLAVMAYDRYVAICNPLLYNTVMSYQVWSWMVFGVYSLALIGTTIHTVCILKMHFCEADTINHYFCDLYPLLELSCSDTFITEVVVLCFGVFNIFVPTLTILSSYIF
IIASILRIKSTEGRSKAFSTCSSHISAVTIFFGSLAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPFIYSLRNKDVQVALNKFLERKFFL*
422 >lcl|NP_001000473.1|Plus112432167..12433090 NW_047799 olfactory receptor Olr1325 Olr1325 __SEG__ Chr8 {Rattus norvegicus} MESGNHSMVIEFILAGFSTKPELRLPLFLLFLGIYLLTVLGNLGMIILIILTSHLHTPMYFFLSSLSFIDLCHSTVITPKMMLNFLTEQNIISYPECMTQLYFFSLFAIA
ECHMLATMAYDRYVAICNPLLYNVVMSHHLCFWLTVGVYTLGVIGSSVHTGFMLKLLFCKTNKINHYFCDLFPLLELSCSSIYINELLVLFLSALNILTPAFAILTSYIF
IIVSILRIRSTEGRSKAFSTCSSHISAVAIFYGSAAFTYLQPSSVSSMNQGKVSSVFYTTVVPMLNPLIYSLRNKDVKTAVKKILNR*
423 >lcl|NP_001000474.1|Plus112443484..12444422 NW_047799 olfactory receptor Olr1326 Olr1326 __SEG__ Chr8 {Rattus norvegicus} MRNYTPVTEIIFLGIANSEGLESVLFILFLVFYVFALLGNLLIFLTILASPNLHTPMYFFLGNLAVFDIFFPSVNSPKMMDSLVGQSRTISYQGCASQIFFYHTLGCTEC
FLYTVMAYDRFVAICHPMRYTIIMNHRVCTGLTVGTWVGGFVHGSILTFLIFKLPYCGPNEVDSFFCDIPIVLSLACADTSLARTVSFTNVGVVALVSLLLILTSYTRIV
ISILKIRSSEGRRRAFSTCSAHFTSILLFYGPVILIYLRPASSPWLDSVIQVFNNIVTPSLNPLIYSLRNKEVKLALRKVLSQVMQPLGHKE*
424 >lcl|NP_001000475.1|Plus112457487..12458422 NW_047799 olfactory receptor Olr1327 Olr1327 __SEG__ Chr8 {Rattus norvegicus} MLQGNLSGVTEFILAGLTDKPELQLPLFLLFLGIYVVTVVGNLGMIILILFSSQLHTPMYYFLCSLSFVDLCQSTVITPKMLENFLVMQNIISYPECMIQFFFFATFAIA
ECHMLAVMAYDRYVAICNPLLYNVVMSYQVCSWMIFGVYCMALIGATAHTVCMLGVHFCKDNVINHYFCDLSPLLQLSCSDTFTNEVVALSLSIFNIFIPTLTILSSYIF
IIASILRIKSTEGRSKAFSTCSSHISAVAIFFSSLAFMYLQPSSVSSMDQGKLSSIFYTIVVPMLNPLIYSLRNKDVKVALNKFLKRKFFL*
425 >lcl|NP_001000476.1|Plus1complement(12505234..12506163) NW_047799 olfactory receptor Olr1330 Olr1330 __SEG__ Chr8 {Rattus norvegicus} MRNCTLVTEFLLMGIPHTAGLERMLFVLFLAFYLLTLPGNLLILLAILTSTNLHTPMYFFLGNLSVLDIFFPSVSSPKMMRYLTGHSHTISYQGCASQLFYHFLGCAECF
LYTVMAYDCFAAICHPLRYTVIMNPWVCGSMTVATWMGSCLHASVLTFLIFKLPYCGPNEVDNFFCDIPVVLALACADTSLAQAVSFINVGLVALVCFLLILISYSRIVV
SILKIRSSEGRHRAFSTCSAHLTSILLFYGPVVLIYLRPASTPWLDSVVQVLNNIVTPSLNPLIYSLRNKEVKVALRKALTRGMHTSGE*
426 >lcl|NP_001000477.1|Plus1complement(12525454..12526392) NW_047799 olfactory receptor Olr1332 Olr1332 __SEG__ Chr8 {Rattus norvegicus} MRNDTSVTEFILLGISNSEGLESMLFILFLVFYVFALLGNLLIFLTILASPNLHTPMYFFLGNLAVFDIFFPSVNSPKMMDSLVGQSRTISYQGCASQVFFYHTLGGTEC
FLYTLMAYDRFVAICHPMRYTIIMNHRVCTCLTVGTWVGGFVHGSILTFLIFKLPYCGPNEVDSFFCDIPVVLSLACADTSLARTVSFTNVGVIALTCFLLILTSYTRIV
ISILQIHSSEGRHRAFSTCSAHLTSIILVYGPVILVYLRPASSPWLDSVVQVFNNVVTPSLNPLIYTLRNKDVKLALKKALSQEAQPLGYKE*
427 >lcl|NP_001000478.1|Plus1complement(12558810..12559745) NW_047799 olfactory receptor Olr1334 Olr1334 __SEG__ Chr8 {Rattus norvegicus} MSNVTLVTTFFLSGIPHAPALDTMLFVTFLMIYFLTVLGNFLILMVIRVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLVSPGGGAISFHSCVAQLYCFHFLGSTE
CFLYTVMSYDRYLAISYPLRYSSLMSGRVCALLAAGTWLTGSLHSAVQTTLTFRLPYCGPNQIQHYFCDAPPILKLACADTSANEMVIFVNIGVVASGCFFLISLSYVSI
VWSILRIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALFKLKDKVAHSQNQ*
428 >lcl|NP_001000479.1|Plus1complement(12564585..12565517) NW_047799 olfactory receptor Olr1335 Olr1335 __SEG__ Chr8 {Rattus norvegicus} MLNGSVVTTFFLTGLPHPPVLDTMLFGLFLVIYVLTVLGNLLILMVIREDSHLHTPMYYFLTNLSFIDMWFSTVTVPKLLMTLLIPGGGAISFHSCVAQFYSFHFLGSTE
CFLYTVMSYDRYLAISYPLRYSSLMSGRVCALLAAGTWLTGSLHSAVQTTLIFHLPYCGPNQIQHYFCDGPPILKLACADTSAIEMVIFVNIGVVASGCFLLISLSYVSI
VCSILRIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVTVFYTVLTPLLNPVVYTLRNKEVKKALFKLKDKVTFSQR*
429 >lcl|NP_001000480.1|Plus112585471..12586424 NW_047799 olfactory receptor Olr1337 Olr1337 __SEG__ Chr8 {Rattus norvegicus} MQSLNQSVVSHFLLEGLTYTAEHPGLFFLLFLLIYSITVSGNLLILLTVGCDPHLRSPMYHFLGHLSFLDACLSTVTVPKVMAGLLALDGKVISFQGCALQLYCFHFLAS
TECFLYTVMAYDRYLAICQPLHYPVVMNKRLCAGLAGSTWAIGALHSTIQTSLTFRLLYCGPQKIAYFFCDIPPVLKLACADTSINEIVMLANIGVVAAGCLILIVISYV
FIVAAVLRIRTAEGRQRAFSTCTAHLTVVLLYYMPPVCIYLQPSSTGTGAGAPAVFYTIVTPMLNPFIYTLRNKEVKRALRRLVFSSRESPASSPAP*
430 >lcl|NP_001000481.1|Plus1complement(12639514..12640458) NW_047799 olfactory receptor Olr1339 Olr1339 __SEG__ Chr8 {Rattus norvegicus} MNPANHSQVATFVLLGLSQVWELRLLFFTVFSAVYLLTVAGNLLIVAIVTSDPRLHTTMYFLLGNLSFLDFCYSSITAPRMLVDLLSHNPTISFGACLTQLFFFHFIGGI
KIFLLTVMAYDRYIAICQPLRYTVIMNQTVCGLFMGASWVGGFIHSIVQIGLTIHLPFCGPDKLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGPYTA
LLVMLRSHSKEGRSKALSTCASHIAVVTIIFVPCIYIYARPFRTFPMDKAVSVLYTMVTPMLNPAIYTLRNKEVIAAMKKLWRRQKDFLGPSDH*
431 >lcl|NP_001000482.1|Plus112758763..12759701 NW_047799 olfactory receptor Olr1341 Olr1341 __SEG__ Chr8 {Rattus norvegicus} MRNGTAITEFVLLGFPGIQGWEALLFISIFLIYVLTLSGNGLIIVIVWVEPRLQTPMYFFLCNLAFLEIWYTTTVIPKLLETFVVSKTIICTACCLLQAFFHFFLGTTEF
LILGSMSFDRYLAICKPLRYPTIMTSNLCLQLALSSWLAGFTIVFCQTMLLVQLPFCGNNVINHFYCDVGPILKAACADTSILELLGLLATIIVIPGSLLFTIISYIYIL
STILRISSASGRQKAFSTCASHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKGALRKAITCANTHHAK*
432 >lcl|NP_001000483.1|Plus1complement(7814438..7815373) NW_047817 olfactory receptor Olr1344 Olr1344 __SEG__ Chr9 {Rattus norvegicus} MRGENITKVSTFILLGFPTGPELQYLLFLLFLLAYLFVLVENLAIILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFAGCMTQLYFFISLVCT
ECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASAFTVSVIKVYFISSATFCGSNILNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGH
ITLAVLRIPSATGRWRAFSTCASHLTVVTFFYVAMLFIYVRPQAIDTRSSNKLISAVYTVLTPILNPLIYCLRNKEFKDAVRRTLGLGHTL*
433 >lcl|NP_001000484.1|Plus17899994..7900953 NW_047817 olfactory receptor Olr1349 Olr1349 __SEG__ Chr9 {Rattus norvegicus} MATAVHRNGSLSTVPLQGFILVGFGGGAETQALLFAVFLVLYLVTVLGNLTMIVVITLDARLHSPMYFFLKNLSFVDLCYSSTIAPKAMANFYSSKVIGVAGCAAQLFFF
SFLGTSEALLLAVMAYDRFMAICSPLHYSVTMSPTVCACLVLAAYGGGCLNSIVETSLTFQLPFCSSNHIDHFFCDVPPLLQLACANTSVNELVMFAICGFILMGATLVI
LVSYGYITVTILSMHSGSRKHKVFSTCGSHLTAVSLFYGTGIAIYGQPGGVASKEQSKVVSIFYTLVIPMLNPLIYSLRNKDVKDALWRLRHRQRHAAM*
434 >lcl|NP_001000485.1|Plus1complement(16550153..16551103) NW_047773 olfactory receptor Olr1096 Olr1096 __SEG__ Chr7 {Rattus norvegicus} MKHVNQSEFSNFILVSLFSRSGSPELLFSLVAAMFIIGLLGNTILLLLIQIDSKLHTPMYFLLSQLSLLDVCFPLITIPKMVSDFPKKKSFISFEGCAAQLFFLTMMGVA
EGVLLALMSYDRYVAVCHPLQYPILMRHQVCLVMLASSWLAGVLNALIQTSITLNFSYCASRIVDHFFCEVPALLKLSCSDTSTYEFALSISGVLILMFPLLLIIASYGH
VLRAVLHMHSQKARNKTFTTCSSHITVVGLFYGAAVFMYMVPGSYHSPHQDNMISLFYSLVTPTLNPLIYSLRNREVRIALLKVISRFGHKRVTII*
435 >lcl|NP_001000486.1|Plus1complement(5103339..5104280) NW_047773 olfactory receptor Olr959 Olr959 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEILFILLGLTDDPQLQILIFLFMFFNYIFSLMGNLIIIFLTLLDLRLKTPMYFFLRNFSLLEIAFTTARIPRFLMSIITGDKTITYNACVAQLFFFVLLLITEF
YLLAAMSYDRYVAICRPLHYPIIMNSKVCHLLVISSWVTGFLSIFPPLMLGLKLEFCASKTVDHFLCDTSPVLQLSCTDTRFIEWIAFVVAVLTLIITLILVILSYTLIL
KTILKFPSAQQRRKAFSTCSSHMVVVSITYGSCIFMYIKTSAKERVTLNKGVAVLNTSVAPLLNPFIYTLRNQQVKDAFKQVINRLCYSQTVS*
436 >lcl|NP_001000487.1|Plus1complement(5158603..5159547) NW_047773 olfactory receptor Olr962 Olr962 __SEG__ Chr7 {Rattus norvegicus} MKNQSMELDFILLGLTDDPGLQIVVFLFLFLNYMASLLGNLVIVLLTLLDPCLKTPMYFFPRNFSFLEIMFTTVCIPRFLTTIVTGDKTISYNSCASQLFFYLLLGVTEF
YLLAAMSYDRYVAICRPLHYPIIMNSRVCHQLVLSSWVTGFLIIFPPVAMGLKLDFCDSRVIDHFMCETSPILQISCTDTHVLEMMSFVLAVVTLVVTLVLVSLSYSFII
KTTMNFPSAQQRTKAFSTCTSHMIVVSTMYGSCIFMYIKPSARERVTMSKNVALLYTSIAPLLNPFIYTLRNRQVKEFFWDVLRKTMGFLNNKV*
437 >lcl|NP_001000488.1|Plus19942023..9942955 NW_047799 olfactory receptor Olr1218 Olr1218 __SEG__ Chr8 {Rattus norvegicus} MTLGNVSSVKEFILLGLTQKPELQLPLFFLFLGIYVVSVVGNLGLIVLIVLSPHLHTAMYYFLFNLSFTDLCYSSVITPRMLVGFVKQNIISHAECMTQLFFFAFFIIDE
CYILTAMAYDRYAAICKPLLYQVTMSHQVCHLMIVAVYVMGFVGAMAHTGSVLNMTFCDGNIINHYMCDVPPLRKLSCTSTSSNELVVFIFVGVNVIIPTLTLFVSYTLI
LSNILSIHSAEGRSKAFSTCGSHVAAVSLFFGAVAFMYFKPSSAPVDEEKISTIFYTIVGPMLNPFIYSIRNKDVHIALRKVLKRILLPK*
438 >lcl|NP_001000490.1|Plus1complement(7533639..7534571) NW_048048 olfactory receptor Olr1766 Olr1766 __SEG__ ChrX {Rattus norvegicus} MTQISEIILLGFGDLHGLQFVLFGLFLAIYVTTLLGNIIILIVVSADCSLHTPMYFFLGHFSFLEIGYTTTIEPIMLRTLLSAHVPISFPACACQFYFFASLVATECFFL
AVMSYDRYIAICNPLHYSSIMDSWGCFQLAVASWLAGFLAPILLMIFIFRLTFCSANEIDHFFCDLKPIMKLACTNTQVAEMTSFICTSLFALAPFLLTLASYIHIICTI
LRIPSTTGKQRAFSTCSSHLIVVSLYYGTLGIVYGFPSVPRYERILKLLSLLYTVFTPAANPIIYTLRNKDVKVALRKLTQWHTYLVKES*
439 >lcl|NP_001000491.1|Plus1complement(7657136..7658059) NW_048048 olfactory receptor Olr1767 Olr1767 __SEG__ ChrX {Rattus norvegicus} MENSSAGTKFILLGMTDNHQLAVLLFGLFFIIYFITVLGNLGLVVLIQVSHRLHTPMYFFLSNLSFLDVCFSSITTPKTLVNLLSQLQEVSFFACMAQMGLFIIFASAEC
NILASMAYDRYTAVCRPLLYHITMSKVRCILLVAGCYLGGLFNMVAVTTSITQLSFCQPHVISHFFCDIPPLLALACSDAWITQFLVVGCGGFTLVTSVVVILVSYMSIF
MTIMGIPSVSGKQKAFSTCTSHLTAVALYYGTTMYTYLQPSRHGSQAGNQMISVFYTVVIPMLNPLIYSLRNQEVKAAVQKILRHSQ*
440 >lcl|NP_001000492.1|Plus1complement(8135038..8135976) NW_048048 olfactory receptor Olr1751 Olr1751 __SEG__ ChrX {Rattus norvegicus} MHQGNRTAFAGFILLGLTVGSEQQLLLFTLFLCMYLVTMVGNSLIILAIISDTHLHSPMYFFLANLSFTDICFTTTTVPKMLADIQSQNPAISLAGCFTQMYFFMFLVDL
DNFLLAAMAYDRYIAICHPLHYAALLNPKRCALLVVIPWIISNLVSVLHLSLLSRLPFCDQRVIPHFFCDLEPILRLACSDTQINNLLILVVGGTVIFIPFVFILVSYAL
IGTAVLAVPSAKGKWKTFSTCGSHLSAVSLFYGSIVGVYFLPPSSYSPERDKVAAVMYTVVTPMMNPFIYSLRNKVMKRALRRLFSQRSFCL*
441 >lcl|NP_001000493.1|Plus1complement(4653762..4654700) NW_047333 olfactory receptor Olr1356 Olr1356 __SEG__ Chr10 {Rattus norvegicus} MEVGSNISSGSFILMGISNHPQLEIIFFVVILSSYLLTLVGNLTIILLSRLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLKNLWGPDKTISYGGCVTQLYVFLWLGAT
ECILLVVMAFDRYVAVCRPLHYMTVMNPRLCWVLAAISWLGGLGNSVIQSTFTLQLPFCGHRKVDNFLCEVPAMIKLACGDTSLNEAVLNGVCTFFTAVPLSIILVSYCF
IAQAVMKIRSVEGRRKAFNTCVSHLVVVFLFYGSAIYGYLLPAKSSNQDQGKFISLFYSVVTPMVNPLIYTLRNKEVKGALGRLLGKGRGAS*
442 >lcl|NP_001000494.1|Plus1complement(5078407..5079348) NW_047333 olfactory receptor Olr1369 Olr1369 __SEG__ Chr10 {Rattus norvegicus} MSSTNESSISEFLLLGLSRQPQQQQHLFLLFLTMYLATVLGNLLIILAIGTESRLHTPMYFFLSNLSFVDVCFSSTIVPKVLAIYILGSQIISFSGCLTQLYFLCVFADM
DNFLLALMAYDRFVAICHPLHYRTKITHQLCALLVVGSWIIANLNCLLHILLMAPLSFCGNNMIPHFFCDATPLLKLSCSDTHLNELMIHTEGAVIMVTPFVCILISYMH
ITCAVLRFSSLRGGWKAFSTCGSHLAAVCLFYGTIIAEYFSSSSSHSAGRDIVGAIMYTVVTPMLNPFIYSLRNRDMKGALRKVLTMRFPSRQ*
443 >lcl|NP_001000496.1|Plus1complement(4520658..4521578) NW_047355 olfactory receptor Olr1533 Olr1533 __SEG__ Chr11 {Rattus norvegicus} MELNRTLVTEFVLRGITDLPELQVPLFLVFFLIYVTTMVGNLGLILLIWKYSHLHTPMYFFLGSLAFADACTSSSVTPRMLVNILDNGKMISLFECMAQYYVFGSSATTE
CFLLVAMAYDRYVAICNPLLYLVVMSNRVCTCLISGSYIIGFLHPLVHVGLLFRLTFCKSNVIDHFYCEILPLYTISCTDPSINAFVVFIFAAVIQAITFMSVAVSYAHV
LFSILKTKSQKSRRKAFSTCSAHLLSVSLFYGTLFFMYVSPGSGPSKYKNKMYSLFYTIVIPLLNPFIYSLRNKEVLGALRKIIKP*
444 >lcl|NP_001000497.1|Plus1complement(2388620..2389549) NW_047773 olfactory receptor Olr878 Olr878 __SEG__ Chr7 {Rattus norvegicus} MNNKTLLTEFILLGLTDVPELQVAVFTFLFLAYIFSMIGNLTILILTLLDSHLHTPMYFFLRNFSFLEISFTNIFIPRVLVSITTGNKSISFAGCFAQYFFAIFLGATEF
YLLAAMSYDRYVAICKPLHYMTIMSNKICTQLVLCSWLSGLMVIIPPITLMSQQDFCASNRLNHYFCDFEPLRELSCSDTNLIEKVVFLVASVTLVVTLMLVTLSYTFII
KTILKLPSVQQRTKAFSTCSSHMIVISLSYGSCFFMYVKPSAKEGGTFNKGVALLITSVAPLLNPFIYTLRNQQVRQAFKDTVKKLLNH*
445 >lcl|NP_001000498.1|Plus18119953..8120891 NW_047773 olfactory receptor Olr1065 Olr1065 __SEG__ Chr7 {Rattus norvegicus} MANHSSVTKFILLGLTNDVNLQAVLFLFLLLTYILSVMGNSAIILLTLLDYRLQTPMYFFLRNFAFLEISFTSVFVPKMLINIGTGDKTISFAGCFTQYFFAILLGATEF
YLLAVMSYDRYVAICRPLHYTTVMNRKLCFQLVLSSWLSGFIIVAVSHGMTLQLPFCASNIINHYCCDYTILLHLSCSDTHFIEVIQSLLATVTLIFTLLLVVLSYTYII
KTILRIPCIQQRKKAFSTCSSHMVVVSLSYGSCIFMYINPSFKDAANFNKRVAVLNTSVAPLLNPFIYTLRNKQVKIAFKDMVRKVISFFKK*
446 >lcl|NP_001000499.1|Plus16460074..6461003 NW_047399 olfactory receptor Olr1576 Olr1576 __SEG__ Chr13 {Rattus norvegicus} MQRMNFTEVTEFIFLGFSSFGKHQITLFVVFLTIYILTLAGNFIIVTITYMDRHLHTPMYFFLSMLASSETVYTLVIVPRMLSSLIFYDLPISLAGCATQMFFFVTLATN
NCFLLTAMGYDRYVAICEPLRYTVIMSKGLCAWLVCGSLGTGLVMAVLHVPAMFHLPFCGTVVEHFFCDIYPVMKLSCVDTTVNEIINYGVSSFVILVPIGLIFISYVLI
VSSILKIVSTEGQKKAFATCASHLTVVIVHYGCASIAYLKPKSESSVEKDLLLSVTYIIITPLLNPVVYSLRNKEVKDALCRAVGRNIS*
447 >lcl|NP_001000500.1|Plus17218686..7219633 NW_047399 olfactory receptor Olr1595 Olr1595 __SEG__ Chr13 {Rattus norvegicus} MENGNLSSVTVFVFTGFPQLKNGGLLYFFPLLFIYIFIVTGNLMIFFAVRLDTRLHNPMYNFISIFSFLEMWYTTATIPKMLSNLISEQKTISFIGCLLQMYFFHSLGNS
EGTLLTVMAIDRYIAICNPLRYSNIMTPRLCAQLTTGSCIFGFLILLPEIVWISTLPFCGPNQISQIFCDFTPLLKLACTDASVILVQDVIHALAILITSLIISLSYLRI
IVVILSISSTEGRKKAFSTCAAHIAVFLLFFGSVALMYLRFSATYTPFWDNTIALTFSVFAPLFNPIIYSLRNKDMKDAINKLFCCQKVSSESGR*
448 >lcl|NP_001000501.1|Plus17227139..7228104 NW_047399 olfactory receptor Olr1596 Olr1596 __SEG__ Chr13 {Rattus norvegicus} MEFSNWTTAQEFIFSAFPCSWGDSVICFIPLLFIYAFIIVGNLVIITVVQLNAHLHTPMYFFISALSFLEIWYTTATIPKMLSSLLSEQRSITLNGCVLQMYFFHSTGIS
EVCLLTAMAFDRYLAICSPLHYPTIMTSRLCAQLTLGCCVCGFLTPLPEIAWISTLPFCGSNRLEHIFCDFLPVLRLACTDTHTIVMIQVVDIVHAVEIITAVMLIFMSY
VGIVAVILRIRSAEGRRKAFSTCVSHLTVFLLFFGSVALMYLRFSATYSLFWDTAIALAFAVLSPFFNPIIYSLRNKEIKEAIKKHIGQAGVLIVKSRNLP*
449 >lcl|NP_001000503.1|Plus1complement(2626162..2627157) NW_047453 olfactory receptor Olr1637 Olr1637 __SEG__ Chr15 {Rattus norvegicus} MVPSGNQSDGTTEFVLAGFPNLNGTGVEVFSVFLFIYLLTLTGNMLIVGVVGADHRLQTPMYFFLGNLSCLEILITSVIIPKMLSNFLSRRHTISFAACITQFYFYFFLG
ASEFLLLAVMSVDRYLAVCRPLHYPLLMNGAVCFRVAWACWMGGLLPVLGPTVAVALLPFCKQGAVVRHFFCDSGPLLHLACTNTTRLEEADFVLAFLVIVSSLTVTAAS
YGFIVLAVLRIPSASGRQKAFSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVDTNWSVTVITTFVTPLLNPFIYALRNDQVKEALKEMFRKVAAKLFEQTLLGDSLRKKTV
S*
450 >lcl|NP_001000504.1|Plus116009156..16010121 NW_047561 olfactory receptor Olr37 Olr37 __SEG__ Chr1 {Rattus norvegicus} MENIACNGSGDSQTSFYLIGIPSLQKSLFLPVFFIFLLLYLLILMGNTLILVAVVAEPSLHKPMYFFLINLSALDILFTTTTVPKMLSLLLLGDRLLSFPACFLQMYLFH
SFSCSEAFILVVMAYDRYVAICRPLHYPVHMTPQTNTALAASAWITALLLPIPAVVQTSHMAFDNIAYIYHCFCDHLAVVQASCSDTSPQTLMGFCIAMVVSFLPLLLVL
LSYVRILISVLRINSKEGRSKAFSTCSSHLLVVGTYYSSIAISYVAYRADLPVDFHIMGNVVYAILTPVLNPIIYTLRNKDVKAAITKIVCHQDPKSIGKP*
451 >lcl|NP_001000505.1|Plus1complement(23198856..23199812) NW_047563 olfactory receptor Olr318 Olr318 __SEG__ Chr1 {Rattus norvegicus} MEKGNQTGMVLFHFRPFSKLPEVQMLIFVLFLMMYLISIGGNMSIVLTIWINRCLHTPMYFFLANLASLEIFYSSTIAPLTLASILSTERTVVSLVGCGAQMFFFIFLGS
ADCILLAVMAYDRFVAICHPLRYTLIMSWHLCVQLALGSLLLGFILAMQLTVLIFQLPFCSSKEISLFYCDVLPVMRLACADTHVHEATLFVVSVIVLTIPFLLITLSYV
FIVNAIVKIRSAEGRHKAFSTCSSHLTVVLLQYGCTSLIYLCPSSSYSPERGQVVSVVYTFITPMLNPLIYSMRNRELKDALRRVIMKLVLIQTQETL*
452 >lcl|NP_001000506.1|Plus123251480..23252409 NW_047563 olfactory receptor Olr319 Olr319 __SEG__ Chr1 {Rattus norvegicus} METINKTAKINFFFRPFSSDPGVQMVIFVTFLVMYLTSLSGNATIAVIVHINHALHTPMYFFLANLAVLEIFYTSSIAPLALANLLSMGKTPVSITGCGTQMFFFVFLGG
ADCVLLAVMAYDRFVAICYPLRYTLIMSWSLCVEMMVGSLVLGCLLSLPLTILIFHLPFCHNNEIYHFYCDMPAVIRLACGDTHVHRTALYIISFIVLSIPLTLISISYV
FIITAILRIRSAEGRHRAFSTCSSHIVVVLLQYGCTSFIYLSPSSSYSPEMGRMVSVVYTFITPILNPLIYSMRNKELKDALRKALKKF*
453 >lcl|NP_001000507.1|Plus123859747..23860703 NW_047563 olfactory receptor Olr337 Olr337 __SEG__ Chr1 {Rattus norvegicus} MAVGRNISMVTNFILLGFLEHPQLQIVLFVLFLGIYLVTLTGNLGLIVLIRMDSHLHSPMYFFLSNLSFIDVSYTSTIAPKMLCDFFREQKSISFIGCAIQLFFFIGMGG
TECCLLAAMAYDRYAAISNPLLYPSLMSPTIRVRMAITVYTGGFLTGLIQTSSIFQLHFCGSRVINHFFCDLPPLMSLSCSSTFFSQVVNFLVVCVVGGASALVVLVSYS
YIIAAVMRIHSTRGQMKAFNTCASHLTTVILFYGSGLFSYLHSNVGYSQDKNKVVSMFYGAVIPMLNPIIYSLRNKEIREALKKLKKRKKQMSCLCAM*
454 >lcl|NP_001000508.1|Plus1428930..429895 NW_047596 olfactory receptor Olr1687 Olr1687 __SEG__ Chr20 {Rattus norvegicus} MTVNCSLWQENSVSVKRFAFAKFSEVPGECFLLFTLILLMFLVSLTGNALIALTICTSPSLHTPMYFFLANLSLLEIGYTFSVIPKMLQSLVSEARGISREGCATQMFFF
TLFGISECCLLAAMAFDRCIAICSPLHYATRMSRGVCAHLAIVSWGTGCIVGLGQTNFIFSLNFCGPCEIDHFFCDLPPLLALACGDTSQNEAAIFVVAILCISSPFLLI
IYSYVRILVAVLVMPSPEGRHKAFSTCSSHLLVVTLFYGSGSINYLRPKSSHSPGIDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRKTLGLKKVLIMNR*
455 >lcl|NP_001000509.1|Plus1844022..844960 NW_047596 olfactory receptor Olr1709 Olr1709 __SEG__ Chr20 {Rattus norvegicus} MIVKNITTMSGFLFMRFSDNHELQILEALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPLYIDNSLVGSGYISYGQCMLQIFFFTGFAWG
EVAILTVMSYDRYVAVCLPLHYEVIMCPRKCRWAVTAVWLSSGIPGTLYVATIFSIKFCRAKIIHQFFCDVPQLLKLSCSNDHLVVMGVADFLSTMAFACFIGIIISYVH
IFSTVLRMPSAESRSKVFSTCLPHLFVVSLFLSTGSFAYLNPTSDSPTALEFLFSVFYAVIPPTLNPLIYSLRNETIKSVVRKLLFSMKFAG*
456 >lcl|NP_001000510.1|Plus1complement(1290419..1291348) NW_047596 olfactory receptor Olr1733 Olr1733 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPGFILLGLSRDSEKGHLLFSIFLALYLLGILGNLLLLLAICADVHLHTPMYFFLSQLSLMDLCFITTTAPKMLQTLWTGDGSISFSGCLIQFYFFAVFADMDNL
LLAVMAIDRYAAICHPLLYPLLMTPHRCGVLVSGSWGVTNCLSLTHTLLLSQLYFHTNQEIPHFFCDFGPLLLLSCSDTHLNEILMIVLVGILGIGSFLCIVSSYSCIFY
AVARVPSAQGKRKALSTCSSHLSVVLLFYSTVFAAYLKPPSSSHSSGEVVAAVMYTLVTPTLNPFIYSLRNRDVKSSLRRILNMEKSQN*
457 >lcl|NP_001000512.1|Plus1complement(13115720..13116673) NW_047657 olfactory receptor Olr601 Olr601 __SEG__ Chr3 {Rattus norvegicus} MDEVNCTSLAEFVLLGFSDVPELAIFLFLMFLLIYGVTVIANLGMTVLIQVSSRLHTPMYFFLSHLSFVDFCYASIIVPKMFTDIINKDKVISYRECLIQFYLFCTFAIT
EVFLLAVMAYDRFVAICNPLLYMVVMSPKLRLVLVSCCYFYASVCSLIHLCLALEIPSFKSNVINHFFCDLPPLLSLACSDVTTSEFFLFTIVNFNEILTIVIIFTSYLF
ILITILKMRSAEGRRKAFSTCASHLTVIVVFHGTILFIYCQPNSGNTLDVDKVTTVFYTVVIPMLNPLIYSLQNKDVKEALRKVLGSKKLSLLSFYF*
458 >lcl|NP_001000513.1|Plus1complement(15175206..15176153) NW_047657 olfactory receptor Olr698 Olr698 __SEG__ Chr3 {Rattus norvegicus} MEKNNVTEFILLGLTQNPEGQKILFVTFLLIYIVTVMGNLLIMVTIIASQSLGSPMYFFLAYLSFIDTVYSTAIAPKMIIDLLYETKTISFRACMTQVFIDHLFAGAEVI
LLVVMAYDRYVAICKPLHYLTVMNWRVCVLMLLGAWIGGLLHSLIQFIFIYQLPFCGPNIIDNFLCDIYPLLKLACTNTYLIGLCMIANGGAICTVTFLILLVSYGVILH
SLKAHSLEGKRKALYTCASHIAVVILFFVPCIFLFARPTSTFPIDKCVTVVLTLITPMLNPLIYTLRNAEMKNAMRRLWTTKITLVGEMYSSCRT*
459 >lcl|NP_001000514.1|Plus115796310..15797242 NW_047657 olfactory receptor Olr725 Olr725 __SEG__ Chr3 {Rattus norvegicus} MKQMNNVTEFILLGLTQNPDVQKLLLVIFTLIYSLTLIGNLLIIVTVISSPALGSPMYFFLSFLSFVDGCCSSTMAPKMIFDLLAEKKTISFNGCMTQIFAEHFFGGVEI
ILLTAMAYDRYVAICKPLHYMITMNRRVCGFLVSMAWAGGFLHALIQILFMVWLPFCGPNIIDHFICDLFPLLKLSCTDNHIFGLFVAANSGLMCMLIFSILLTSYVLIF
CSLKTHSTEEQLKALSTCASHITVVLLFFVPCIFVYLRPTVIFPFDKAVAVFYTVITPMLNPLIYTLRNTEVKNAMRKLWNQRKPRKRFT*
460 >lcl|NP_001000515.1|Plus1complement(310721..311659) NW_047719 olfactory receptor Olr856 Olr856 __SEG__ Chr5 {Rattus norvegicus} MQKLNRTAVTEFILLGFAPDPRTNPLLFAFFLVFYLLILLSNSLLLTLIYQDSRLHTPMYFFIGVLSMLDVCYTTTTVPQMLVHILSRKRAISFTRCVAQMYIFLLFGVT
ESWLFSIMSVDRYVAICHPLRYKVIMSRGMCLLMVGICAAYGVVGGLCYTFFAMRLPYCGPNEIDHYFCEVPAVLKLACADTSLNDLVDFITGFNVIVVPLSLVAIVYAN
IFNTIMKIRSTQGRIKAFSTCTSHITVVTMFAIPCIIMYMSPGSGSLSNSGKKMALFYNIATAFLNPVIYSLRNKDVKNAFLKLVGRSGASK*
461 >lcl|NP_001000516.1|Plus1complement(13524147..13525088) NW_047798 olfactory receptor Olr1121 Olr1121 __SEG__ Chr8 {Rattus norvegicus} MEPQNQTSASEFILLGLSEKPEHEPVLFSLFLCMYVITVVGNLLIILAISSDSHLHTPMYFFLANLSLVDFCLATNTIPKMLVNIQIRNKSISYPCCLTQMYFFHFFGIM
DSVLIAVMAYDRFVAICHPLHYSTIMSPRLCGLLVGGPWVYSCFISLTHILLMARLVFCAKNELPHYFCDLTPLLRLSCTDTTVNKIFVLIVAGMVIATPFVCILASYAR
IIVAIMKVPSAGGRKKAFSTCSSHLSVVALFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALKKIINRKISTSS*
462 >lcl|NP_001000517.1|Plus1complement(10948888..10949847) NW_047799 olfactory receptor Olr1280 Olr1280 __SEG__ Chr8 {Rattus norvegicus} MESLTAGNHCRVSEYFLAGLSAKPELQLPLFLLFIGVYVITVVGNLAMITLIACSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLVNFVTEKNVISYPGCMTQLYCFLIF
GVAECYTLAAMAYDRYVAICNPLLYNVTMSYQIYTSLILGVYIFGMLCASVHTGFMIRVKFCKLDVINHYFCDLLPLLKLACSNTYINEMLILFFGTLNICVPLLTIITS
YIFIIVSILHIRSTKGRSKAFSTCSSHIVAVAIFFGSLAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVSIALKKLFERKSFIKAEVM*
463 >lcl|NP_001000518.1|Plus1complement(11024454..11025506) NW_047799 olfactory receptor Olr1283 Olr1283 __SEG__ Chr8 {Rattus norvegicus} MEDMAAGNHCIVTEFFLDGLSKKSELQLPLFLLFTGIYLITVAGNLGMITLILLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKMLMSFLTEKNIISYPGCLAQLYFAVIF
GTAECYTLAAMAYDRYVAICNPLLYNATMSFQIYCSLISGVYIFAVFCASVNLGFMLRIQFCKLDVINHYFCDVLPLFQLACSNTYINEMLILFFGILNIFVPLLTVIIS
YIFIIASILRIRTTEGRSKAFSTCSSHILAVAVFFGSLAFMYLQPSSVSSMDQGKVSSVFYTTVVPMLNPLIYSLRNKDVSVALKKILWRKKYVSIRSVKITYSTKKFKN
TYIGLIMFISSYFTLLLVIW*
464 >lcl|NP_001000519.1|Plus1complement(12056460..12057395) NW_047799 olfactory receptor Olr1307 Olr1307 __SEG__ Chr8 {Rattus norvegicus} MRNRSVVTQFILLGIPNTEGLETMLFVLFLSFYIFTLMGNLLILLAIISSSRLHTPMYFFLCKLSIFDIFFPSVSSPKMLFYLSGNSRAISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYSIIMSHRVCAILATGTSFFGCIQATFLTTLTFQLPYCGPNEVDYYFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSCIV
CSILQIRSAEGRRRAFSTCSAHLTAILLFYMPVVLIYLRPTPSPWLDATVQVLNNLVTPMLNPLIYSLRNKEVKSSLWKFLHSPAFLPEQL*
465 >lcl|NP_001000520.1|Plus17875132..7876103 NW_047817 olfactory receptor Olr1346 Olr1346 __SEG__ Chr9 {Rattus norvegicus} MATQVHRNGSLSAVSLQGFVLVGFGGSAETQALLFAVFLIMYVVTVLGNLTMIVVITLDARLHSPMYFFLKNLSFVDLCYSSVIVPKAMANLLSSTKVISFAGCATQFFF
FSLLVTTESFLLAVMAYDRFMAICSPLRYPVTMCPMACARLVLGAYCGGCLHSIIESSLTFRLPFCSSNRINHFYCDVPPLLQLACADTTLNELVMFGICGLIIVSTTLV
VLVSYGYITVTILRMRSGSGRHKLFSTCGSHMTAVSLFYGTVFVMYAQPGALTSMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKDALRRLGQRHSLVKEDVQ*
466 >lcl|NP_001000521.1|Plus11817377..1818312 NW_047453 olfactory receptor Olr1619 Olr1619 __SEG__ Chr15 {Rattus norvegicus} MKTFSSTINSSTITGFILLGFPYPREGQILLFVLFFIVYLLILMGNASIICAVCCDQRLHTPMYLLLANFSFLEIWYVTSTVPNMLANFLSETKVISFSGCFLQFYFFFS
FGSTECFFLALMAFDRYLAICRPLHYPALMTRHLCNILVISCWVLGFLWFPVPIIIISQMSFCGSRIIDHFLCDPGPLLALACSRAPLMEFFWTIIMSLLLVLPFLFIMA
SYILVLRTVFRLPSRDGQKKAFSTCGSHVTVVSLFYGSVMIMYMSPTSEHAAGMQKLVTLFYSVGTPLLNPIIYSLRNKDMKNALQKILRT*
467 >lcl|NP_001000522.1|Plus1complement(8294468..8295412) NW_047773 olfactory receptor Olr1069 Olr1069 __SEG__ Chr7 {Rattus norvegicus} MKSELKRNYTELTEFILLGFRASPKFQVFLFLVFLMIYMVTVVGNVSMITVIKMDSRLQTPMYFFLRNLSYLDLCYSTVIAPKTLANFLTSEKKISYNGCATQFFFFALF
VTAECFLLAVMAFDRFSAICSPLLYHVHMSQKVCVQLVTGSYICGCINSMVQTGFTFSLRFCGENRVDHFFCDVTALIKISCVDTFVNEIVLFILSALIVISTIIIILVS
YAYILSTVLKIPSSHGRSKTFSTCGSHIAAVSLFYGTVFFMYAQPGSISSPEKSKIVAVFYTLITSMLNPLIYSLRNRDVKDAVKKILGGKCSQ*
468 >lcl|NP_001000523.1|Plus1complement(5409229..5410170) NW_047333 olfactory receptor Olr1381 Olr1381 __SEG__ Chr10 {Rattus norvegicus} MSSTNHSSVSVFLLLGLSRQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMYFFLSNLSFVDLCFSSTTVPKVLANHILGSQEISFSGCLTQMYFLSVFAYM
DNFLLAVMAYDRFVAICHPLHYTKKMTHQLCALLVVESWLAVNLNALLHTLLMARLSFCGDNIIPHFFCDATPLLKLSCSDTHLNELMINTEGAVTMVTPFVCILISYIH
ITCAVLRVSSPRGGWKAFSTCGSHLAVVCLFYGTIIAVYFNPSTAHSPEKDTVATVLYTVVTPMLNPFIYSLRNRDLKWSLRKLVHRSTFSFQ*
469 >lcl|NP_001000524.1|Plus121675608..21676543 NW_047334 olfactory receptor Olr1393 Olr1393 __SEG__ Chr10 {Rattus norvegicus} MGNFNTSSQESFILVGFSDWPQLQVFLFVIILIFYSLTIFGNTTIIILARLDLRLHKPMYFFLSHLSFLDLCYTTSTVPQLLINLYGLDRTISYGGCVAQLFIFLALAST
ECLILVAMAFDRYAAVCHPLHYTSIMHPILCRALAISSWVGGLVNSLIQTGLVMAMRLCGHQINHFFCEMPIFLKLACEDTGGTEVKMFVARTIVLVCPAVLILGSYVHI
AKAVLKVKSMAGRRKAFGTCGSHLMVVSLFYGSGIYTYLQPVHKYSESKGKFVALFYTIVTPMFNPLIYTLRNKEVKGALWKMLGRGTDSG*
470 >lcl|NP_001000525.1|Plus131371219..31372202 NW_047334 olfactory receptor Olr1433 Olr1433 __SEG__ Chr10 {Rattus norvegicus} MGADNDSTFSHFILIGFSDRPQLERVLFAIILPAYLLTLLGNSTIILVSRLDPHLHTPMYFFLTHLSFLDLSFTSSSIPQLLYNLSGPDKTISYVGCALQLVLFLGLGGV
ECLLLAVMAYDRFVAVGKPLHYMVIMSPRLCMGLVSVAWSCGVANSLAMSPVTLSLPRCGHRRVDHFLCEMPALIRTACVNTVAVEGTVFVLAIGIVLSPLVFILVSYGY
IVRAVLRIRSAAGRQKTFNTCGSHLTVVSLFYGNIIYMYMQPGNSSSQDQGKFLTLFYNIVTPLLNPLIYTLRNKEVKGALXRLLLGSREIGEIRAGSRQTRGKLSW*
471 >lcl|NP_001000526.1|Plus1complement(31858879..31859805) NW_047334 olfactory receptor Olr1457 Olr1457 __SEG__ Chr10 {Rattus norvegicus} MSNHTTVTHFILRGFSDVPQLRLVVIPFFLLVYTFGLLGNFSIIMAVRRDSRLHSPMYFFLKNLSFLDMCYTSATIPKAVAISFTGSGVVSYLECVAQLYIIFTFACTEC
FLLTAMAYDRCLAILRPLLYGTIMSQKYCHALVVTAWVSGAIYSAFHTSNTFSLPYCGPNVVEHFFCDMPAIMRLSCTDYHLTEDVGFAVSSCVVMSSLALTVVSYIGIV
ATVLRIPSVDGRWKAFSTCSSHLTTVILFYGTGSFVYLRPASHYSPTLGRLASIFYSVVTPSLNPVVYCLRNKDMKFALQKLYCGRKY*
472 >lcl|NP_001000530.1|Plus14633672..4634595 NW_047355 olfactory receptor Olr1538 Olr1538 __SEG__ Chr11 {Rattus norvegicus} MAEENRTLVTEFILTGLTEHPALKVALFLLFLVIYLITMVGNLGLIALIWKDSHLHTPMYLFLSSLAFADSCTTSSVTPKMLVNFLSENHEISPFECFAQFYFMGSSATT
ECFLLSVMAYDRYVAICNPLLYPVLMSNRLCIHFIAVTYLLGVLHLAIHVGLLFRLTFCRSNIIQYYYCEILQLFNISCIDPTINMFVLLIFSISIQAFTFVTILVSYIH
VLFAILRKKSEKGRSKAFSTCSAHLLSVSLFYGTLFLIYVCPGSGPVGDKEKMLSLFYTVIIPLLNPFVYSLRNKEVICAFRRVMNN*
473 >lcl|NP_001000531.1|Plus1complement(4725082..4726008) NW_047355 olfactory receptor Olr1542 Olr1542 __SEG__ Chr11 {Rattus norvegicus} MAEDNYSLTTEFILVGFSDHPDLKILLFLVFTAIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMAQFYFLCLAETT
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLCVQMTTGAYIAGNLHPMIEVGLLLRLTFCRSHVIKHFFCDVLPLYGISCTDPHINELILLVLAGSIQVFTITIVLVSYSC
ILFTIFSMKSKEGRGKALSTCASHFLSVSIFYGSLLFMYAQPHSVNEGDKDVPVAIFYTLVIPLLNPFIYSLRNKEVINAMKRTMRKR*
474 >lcl|NP_001000533.1|Plus1complement(6681370..6682302) NW_047399 olfactory receptor Olr1581 Olr1581 __SEG__ Chr13 {Rattus norvegicus} MKRANYTPVREFVFQGFSNLQEHWLTLFIVFSALYILTLTGNLIIVTIIRIDHHLHTPMYFFLSVLSTSETFYSLVIIPRMLGSLVGLSQSISLECCGIQLFFFLGFAIT
NCLLLAVMGYDRYVAICNPLRYSIIMNWRVCVILASSVCAMGFLLSLAQAVAIFRLPFCNTLIEHFFCDVRPILDLACMVPVINDILTLVLSLMVITAPATFLCVSYVLI
ISTILKIASAEGRKKTFATCASHLTVVIIHYGCASIAYFKPKSENTSDQDQLISVTYTVITPLLNPVVYSLRNKEVQNALRKVLGRKSLS*
475 >lcl|NP_001000535.1|Plus13503856..3504782 NW_047453 olfactory receptor Olr1643 Olr1643 __SEG__ Chr15 {Rattus norvegicus} MGALNQTRVTEFVFLGLTDNWVLEILFFIPFTVTYVLTLLGNVLIVVTIVFTPRLHNPMYFFLSNLSFIDICHSSVTVPKMLEGLLLVRKTISFDNCIAQLFFLHLFACA
EIFLLTIMAYDRYVAICIPLHYPNVMNMKVCVQLVFALWLGGTVHSLVQTFLTIRLPYCGPNTIDSYFCDVPPVIKLACTDTYLTGILIVSNSGTISLVCFLALVTSYTV
ILFSLRKQSAEGRRKALSTCSAHFMVVALFFGPCIFIYTWPDTSFSIDKVVSVFYTVVTPLLNPLIYTLRNEEVKTSMKHLRQRRICS*
476 >lcl|NP_001000536.1|Plus1complement(3886900..3887838) NW_047492 olfactory receptor Olr1657 Olr1657 __SEG__ Chr17 {Rattus norvegicus} MEKENTSSFEGFILVGFSDRPHLELILFVVVLSFYLFTLLGNMTIILLSALDSRLHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGV
ECVLLAVMAYDRYAAVCKPLHYTVIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRQVDHFLCEMPALIGMACVDTMVLEALAFALAIFIILAPLILILISYGY
IARAVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANSYSQDQGKFLTLFYTIVTPSVNPLIYTLRNKDVKEAIKKVIGKESIEV*
477 >lcl|NP_001000538.1|Plus19539422..9540396 NW_047555 olfactory receptor Olr1 Olr1l __SEG__ Chr1 {Rattus norvegicus} MEAPVPIPTANRTSVLEFLLLGVTEKRGLQLLLFGILLITYTLTLLGNLFIIALTLADRRLHTPMYFFLRHFSLLEVGFTSTVSPQMLAHLLAARGAISRHRCFAQMILY
FTLGAVETLLLAVMSTDRFLAICWPLRYPALMTPRVCSALVLACWGASLLALPGLFAWMLSLPFCGPRVLNHFFCDSSPLLELVCADTRLLQLVAFLVAVCTLLTATLIT
TLSYGCIISTILRLPTPGGRSKXXSTCSSHXLVVSMSYGSCIIMYLNPTQTGKLDLNKGIAFFNTTVSPLLNPFIYCLRNQLVHRVCRDLLLRGRELSSKMFRA*
478 >lcl|NP_001000539.1|Plus111109963..11110901 NW_047555 olfactory receptor Olr6 Olr6 __SEG__ Chr1 {Rattus norvegicus} MERSLELANMTRVQQFLLLGLSTRLDIRDALFAVFLTLYLLTLLENTLIIYLICSHRELHKPMYFFLGNLSCLEMCYVSVTMPTLLMGLWNGLYHIHFIACMTQLFFFIV
LVGTECILLASMAYDRYVAICRPLHYPVLMRPQVCLGLAMTSWLGGLLVSMVKTTCIATLSYCGPNVLNHFFCDVSPLLNLSCTHVALTELVDFISAIVILWGCFLTTMA
SYVAIGRAVLRMPSTTARYKAFSTCASHLVVVGIFYSVTIFIYARPKRIEAMDLNKVLSVIYTVVTPMCNPVIYCLRNKEVQVALHRTMHWS*
479 >lcl|NP_001000540.1|Plus1complement(1225442..1226365) NW_047561 olfactory receptor Olr12 Olr12 __SEG__ Chr1 {Rattus norvegicus} MNFSIVNEFMILGLTQKSELQGILFIVFLCIYLVALLGNLLIVVAIIYNTTLHTPMYILLLALAVVDIICTTSIIPKMLGTMLTSENSISYGGCMSQLFFFTWSLGAEMV
LFTTMAYDRYVAICFPLRYSTIMNHYTCVALLSIVMAIAVTNSWVHTGLILRLTFCGPNTVDHFFCEIPPLLALSCSPVRVNEVMVYVADITLAVGDFTLTCISYGFIIA
AILRIRTTEGKKKAFSTCSSHLMVVSLYYSPVIYTYIRPASSYTFEKDKVVAALYTLVTPTLNPIVYSFRNKEMQSGIRKVFAFLKG*
480 >lcl|NP_001000541.1|Plus12817886..2818836 NW_047562 olfactory receptor Olr43 Olr43 __SEG__ Chr1 {Rattus norvegicus} MSCNTSSPGHSTFLLTGFPGLEASHHWVSIPINLICVVSILGNSIILFLIRTDPALHEPMFIFLSMLAASDLGLCASTFPTMVRLFWLGTRELPFDFCAAQMFFIHAFTY
VESGVLLAMAFDRFIAIRDPLHYATILPHSAVAKVGAAVLVRAILLNLPGPILLRRLIFPQISTLSHCYCLHCDLVGLACSDTRINSLVGLVSILLSLGLDSSLIMLSYV
LILRTVLGIASPGERLKALNTCVSHLCIVLIFYLPKLGLSVLHRVEKHSYPALAVLMANLHFLVPPFMNPVVYCIKSKQIRQGFLRRFQQKRVDIS*
481 >lcl|NP_001000542.1|Plus1complement(3257493..3258446) NW_047562 olfactory receptor Olr63 Olr63 __SEG__ Chr1 {Rattus norvegicus} MGSPSGNESSVTYFILIGLPGLEEFQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHRLHEPMYIFLCMLSGLDILISTSSMPKMMAIFWFNSTTIQFDACLIQMFAIHSLS
GMESTVLLAMAFDRYVAICHPLRHATVLTLPRVAKIGMAAVVRGAALMAPLPVFIKRLPFCRSNILSHSYCLHQDVMKLACADIRVNIIYGLIVIISAIGLDSLFISFSY
LLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRHDSLLPVIMANIYLLVPPVLNPIVYGVKTKEIRQRILRLFLMTTHTSAH*
482 >lcl|NP_001000543.1|Plus13628955..3629893 NW_047562 olfactory receptor Olr87 Olr87 __SEG__ Chr1 {Rattus norvegicus} MSSINETASHPSLFYLLGIPGLEAFHVWIAFPFFVVYLIALAGNFTILCVIKNEQSLHQPMFYFLALLSFIDLGLSTSTIPKMLGIFWFNLREISFEGCLIQMFFIHTYT
GMESVVLLAMAIDRFVAICYPLRYTSILTNKVVAVMASIVIGRPVLLVIPFCPLLKRLPFCGHYIIPHTYCEHMGIARLACANIRINIIYGLFTIAALIFDLILIALSYA
RILQAVFRLPSRDARHKALSTCGSHVCVILAFYTPAFFSFMTHRFGRNVPRYIHILLANLYVVVPPCLNPVIYGVRTKQIREGVIKILVKKE*
483 >lcl|NP_001000544.1|Plus1complement(4481882..4482826) NW_047562 olfactory receptor Olr142 Olr142 __SEG__ Chr1 {Rattus norvegicus} MLGLNGTPFQPATLQLTGIPGMHTGQAWVALIFCFLYFISIAGNLSILALVIREPPLHQPMYYFLSMLSLNDLGVSLSTLPTVLATFCFNYRHVGFDACLVQMFFIHTFS
FMESGILLAMSFDRFVAICDPLRYSTVLTNSRILAMGLGILAKSFTTLFPFPFLVKRLPFCKGNVLHHSYCLHPDLMKVACGDIHVNNIYGLFVVIFTYGVDSVFILLSY
ALILRAVLVIASHEQRLKALNTCISHICAVLAFYVPIIAVSMIHRFWKSAPAVVHVMMSNVYLFVPPMLNPIIYSVKTKEIRRGMLKVFHKSQT*
484 >lcl|NP_001000545.1|Plus1complement(4521851..4522795) NW_047562 olfactory receptor Olr145 Olr145 __SEG__ Chr1 {Rattus norvegicus} MRGEAQNSSGLPPFILTGLPGLETSQHWLFLLLGVLYTVSIVGNALILFIIKEEESLHQPMYYFLSLLSVNDLGVSFSTLPTVLAVFCFHLREISFNSCMSQMFFIHLFS
FMESGILLAMSFDRYVAICNPLRYSTVLTDARVVWMGVCVFLRSFCMIFPLPFLLKRLPFCKANVLSHAYCLHPDMIRLPCGDITINNIFGLFIVISTFGLDSALILLSY
ILILRSVLAIASKEERLKTLNTCVSHLCAVLIFYVPMVGVSMAARYGRHAPRYVHTLLSLVYLFVPPMLNPVIYSIKTKEIRRRLCKILLGTKI*
485 >lcl|NP_001000546.1|Plus14811665..4812606 NW_047562 olfactory receptor Olr152 Olr152 __SEG__ Chr1 {Rattus norvegicus} MYNLSCYNPYSFILVGIPGLEKFHIWIGIPFCVIYVVAIVGNCILLYLIAVEQSLHEPMFIFLSMLASTDIILSTATVPKLLSNLWFGSQEITFSGCLSQMFFLHFSFVV
DSAILLAMAFDRYVAICLPLRYSTILTPQVIVKIMVSIIVRSFSVILPDVFLLRRLPFCKTRVIPHTYCEHIGVARLSSADISINIWYGFSVPLMTVISDVILIAVSYIF
ILRAVFLLSSQGARQKALSTCGSHVCVILMFYTPAFFSILAHRFGHSVPRNVLILFANFYVAIPPALNPVVYGVKTKQIQDKFLLFFSLRKTQ*
486 >lcl|NP_001000547.1|Plus14834834..4835787 NW_047562 olfactory receptor Olr154 Olr154 __SEG__ Chr1 {Rattus norvegicus} MMLSASIPNGTAFHPSTFVLLGIPGMQDQHVWIAIPFCSMYILALVGNGTILYIIITDRALHEPMYLFLCLLSITDLVLCSTTLPKMLAIFWLRSHIISYHGCLTQMFFV
HAVFATESAVLLAMAFDRYVAICRPLHYTSILNAVVIGKIGLACVTRGLLFVFPFVILIERLPFCGHHIIPHTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDVVLI
ATSYILILQAVLRLPSKDAQFRAFSTCGAHICVILVFYIPAFFSFFTHRFGHHVPPQVHIILANLYLLVPPVLNPLVYGINTKQIRLRILDFFVKRR*
487 >lcl|NP_001000549.1|Plus1complement(5491345..5492283) NW_047562 olfactory receptor Olr192 Olr192 __SEG__ Chr1 {Rattus norvegicus} MEAQSNISSILVPDFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRMEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDNKSIGFSACFLQMFVMNSF
LTMESCTFMVMAYDRYVAICKPLQYPSIITDQFVVRAAIFVATRNGILTMPIPIFSSQLRYCARIIKNCICTNMSVSRLSCDDITFNKLYQFVIGWTLLGSDLILIVLSY
SFILKAVLRIKAEGAVAKALSTCGSHFILILFFSTVLLVLVITNLARERIPPDVPILLNILHHLIPPALNPIVYGVRTREIKQGIRNLLRRF*
488 >lcl|NP_001000550.1|Plus1complement(5690048..5691016) NW_047562 olfactory receptor Olr202 Olr202 __SEG__ Chr1 {Rattus norvegicus} MIHSNISIIHPAVFVLLGIPGLETYHIWLSIPLCLMYVTAVLGNSILIMVIITERNLHEPMYFFLSMLAITDILLSTTTVPKALAIFWFHAHNIAFDACVTQVFFVHTMF
VGESAILLAMAFDRFVAICAPLRYATVLTWPTVGRMALAIVIRSVCIIFPVIFLLKRLPFCRTNIVPHSYCEHIGVARLACADITVNIWYGFSVPIVMVIVDVILIAVSY
SLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQIREGVVHWFLDIKTQCCSLPLG*
489 >lcl|NP_001000551.1|Plus1complement(6723933..6724883) NW_047562 olfactory receptor Olr218 Olr218 __SEG__ Chr1 {Rattus norvegicus} MELWNTTLESGFILVGILNGSSSPELLCAIVTALYILALTSNGPLLLVITVDARLHVPMYFLLRQLSLIDLLFTSVVTPKAVMDFLLKENTISFGGCALQMALALMLGSA
EDLLLAFMAYDRYVAICHPLNYMIFMSPTVCWFIVSTSWIMASLTAVGHTVYTMHFPFCMSQEIRHLLCEILPLLKLSCVDTSQYELMVYVTGVTFLLLPLSAIVTSYTL
ILSTVLHMPSNEGKKKALVTCLSHLMVVGMFYGAATFMYVLPSSLHSTKQDNITSVFYTIVTPALNPLIYSLRNKEVIGALRRVLGRYILPAHPNI*
490 >lcl|NP_001000552.1|Plus16761647..6762570 NW_047562 olfactory receptor Olr220 Olr220 __SEG__ Chr1 {Rattus norvegicus} MGEENGTSVTEFIFLGLSQDPQTQVLLFFLFLLIYLLTVLGNLLIVVLIHSDPRLHTPMYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGAFVSLVDTTFTLRLPYRGNNVINHFFCEPPALLKLASADTYSTEMAIFAMGVVILXAPVSLILTSYWN
IVSTVIQMQSGEGRLKVFSTCGSHLIVVVLFYGSGIFAYMRPNSKIMNEKDKMISVFYSAVTPMLNPIIYSLRNKDVKGALRRITTK*
491 >lcl|NP_001000553.1|Plus1complement(6851476..6852420) NW_047562 olfactory receptor Olr224 Olr224 __SEG__ Chr1 {Rattus norvegicus} MLDMNITLVSEFILVGFPTAPWLQVLLFFIFLVVYMLIIVENLVIIFTVWSTSSLHKPMYYFLSSMSFLEIWYVSVTVPKMLDGFLLQRRHISFTGCMTQLYFFISLACT
ECVLLAAMAYDRYVAICHPLRYPVIMTTVYCMQLMALSYFSGFMVSVVKVYFISHVAFCGSNVMNHFFCDISPILKLACKDMSTAELVDFALAIVILVFPLFTTVLSYIY
IVSTILRIPSTQGRKKAFSTCASHLTVVIIYYTAMIFMYVRPRAIASFNSNKLISAVYAVLTPMLNPFIYCLRNQEVKDAIKKTLGGGRCILLC*
492 >lcl|NP_001000554.1|Plus1complement(8492869..8493807) NW_047563 olfactory receptor Olr286 Olr286 __SEG__ Chr1 {Rattus norvegicus} MSNRSNNTLVTEFILLGFPELRHLQGLLFGLFLIIYVVTVLENLVIVGTISASRQLHIPMYFFLANLSVLETLYTTVTVPKLLAGLLAGAKAISFSGCLTQLFLFLSLGS
SECFLLSTMACDRYLAICRPLHYPAIMDSKLCLHLALSAWLGGFLASFVSTALISRLSFCGSNALNHFFCDVSPLLQLSCTDTTAIEMLDFVAALAVLATSLIVTSVSYV
HIVATVLRIPGGAGRRRAFSTCASHLVVVLIFYTTTTFMYARPHAISSFDLNKLVSVIYSVVTPLLNPIIYCLRNRDIREALTKLLQSLRFP*
493 >lcl|NP_001000555.1|Plus19301013..9301945 NW_047563 olfactory receptor Olr311 Olr311 __SEG__ Chr1 {Rattus norvegicus} MLSPNQTLVTEFVLEGFSEHSSLRLLLTGCFLSLYTMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIVCTSSVLPKTLVGLLSEENTISFKGCMAQLFFLLWSLSS
ELLLLTVMAYDRYVAICCPLHYSSRMSPQLCGVLAMGVWSICALNASVHTGLMTQLSFCGPKVITHFFCEIPPLLLLSCSPTYVNSIMTLVADAFYGGINFVLTLLSYGY
IIASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSILSPTLNPLIYTLRNKDVKLALARLLPLFPR*
494 >lcl|NP_001000556.1|Plus124939227..24940159 NW_047563 olfactory receptor Olr361 Olr361 __SEG__ Chr1 {Rattus norvegicus} MTLVKNWTDVTWFILLGLTDDPSLKLPLFIIFLLIYIITLVGNLGMILLIFLDSRLHFPMYFFLGNLSLVDFCYSSAVTPKVITGLLIGDKTISYNDCAAQMFFFAAFAT
VENYLLASMAYDRYAAVCKPLHYTTTMTPNVCTYIIMGCYIFSFLNVSVYLGDTFSLSFCKSNVVHHFFCDMPAIMALSCSDRHVNELVLIYLASFNIFIAFIMILVSYI
IIFITILKMRSGAGFQKALSTCVSHLTAVFIFYGTIIFMYLQPSSRHAMDTDKVVSVFYTMVIPMLNPLVYSLRNKEVKNAFMKVVLKEK*
495 >lcl|NP_001000557.1|Plus1complement(646784..647746) NW_047596 olfactory receptor Olr1693 Olr1693 __SEG__ Chr20 {Rattus norvegicus} MNVSFKTGFLLMGFSEERTLQILHAVLFLITYLLAVMGNLLIVTIITVDQRLHSPMYYFLKHLSLLDLCFISVTVPQSIANSLMDNGFISLGQCMLQVFFFIALASSEVA
ILTVMSYDRYVAICRPLQYETIMDPHACKCAVIAVWMAGGLAGLIHTGVNFSIPLCGKRIIHQFFCDIPQMLKLACSYEFINEIAVAAFTTSTAFVCLIAIVFSYIQIFS
TVMRIPSADSRTKVFSTCLPHLFVVMFFLSAAGFEFLRPPSDSLSTMDLIVSIFYTVIPPTLNPLIYSLRNETMKAALKKVLSREEFSRRMVYIKAIFNL*
496 >lcl|NP_001000558.1|Plus1complement(434358..435320) NW_047627 olfactory receptor Olr390 Olr390 __SEG__ Chr2 {Rattus norvegicus} MTPFEVTNQTRVTEFIFLGFSNHSSLRGFFFLVFLAIYLTTLLGNTLMMVATRVSPALNTPMYYFLSNLSFLDICYTSTTIPAMLVNFFREKKTISYEGCLSQIFFFVTC
AGTECVLLAAMAYDRYVAICYPLRYPVLMSTRVCICLVIGSWLCGLVNSVTHTTLATTLTLCGPNQISHFLCDIPLLLKLSCSDTSVNESVLHVASATIGLSPCLFTAGS
YIFIISAILRIPSAQGRRKAFSTCASHLTVVVIFFGTANFNYDRPREGYSLDMDILVSVLFCVVTPMLNPIIYSLRNKEVKGALGKLIGAHSLTVTTPRE*
497 >lcl|NP_001000559.1|Plus11505579..1506517 NW_047653 olfactory receptor Olr395 Olr395 __SEG__ Chr3 {Rattus norvegicus} MRMDNDSTMSEFILLGLPIKPEEQGMYSALFLAMYLITVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDMSFSSVTASKMLMNMLTHSQSISYAGCVSQVYFFSIFADI
DSFLLTSMAYDRYVAICHPLHYITIMSQNLCVLLVVVSWALSSANTLVHTLLFARLSHFRNNTIPHYFCEISALLELSISDTTINELVILPLGTVIITVQFICILVSYGR
IGATVLRTPSIKGICKALSTCGSHLSVVSLYYGAIIGLYFVPSSNNTNDKDVILSVIYSLVIPMLNPFIYSLRNRDIKGALRNIFSRKLCLQ*
498 >lcl|NP_001000560.1|Plus11787313..1788236 NW_047653 olfactory receptor Olr399 Olr399 __SEG__ Chr3 {Rattus norvegicus} MDNESTVSEFILLGLPIRAEDQGLYSALILAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTAPKMLVNMLTHSQFISYTGCISQVYFFTVFGTIDS
FLLTSMAYDRYVAICHPLHYITIMNQNLCVFLVVVSWALSSANSLVHTLLLAHLSHFRNNTVPHYFCDLSTLLKLSSSDTTINELVILVLGNAVISLPFICILVSYGRIG
VTILKAPSIKGICKALSTCGSHLCVVSLYYGAIIGLYCVPSSNNTSEKNAIVAMMYTVVTPMLNPFIYSLRNRDMKGALRNILSRMK*
499 >lcl|NP_001000561.1|Plus1complement(10748213..10749157) NW_047657 olfactory receptor Olr482 Olr482 __SEG__ Chr3 {Rattus norvegicus} MAQINCSQVTEFILVGLTDREELKMPLFGVFLFIYLFTTFGNLGLIVVIRTDARLHTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFNACAAQLGCFLAFMTA
ECLLLASMAYDRYVAICNPLLYMVLMSPGICFQLVAAPYLYSFLVALFHATLTFRLCYCHSNTINHFYCDDMPLLRLTCSDTHSKQLWIFVCAGIMFISSLLIVFISYTF
IISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKLIISRNQMFMS*
500 >lcl|NP_001000562.1|Plus1complement(11514316..11515263) NW_047657 olfactory receptor Olr522 Olr522 __SEG__ Chr3 {Rattus norvegicus} MNAWNHTTETEFILMGLTGSKEVQLVLSVMFLLIYVLTVLGNIGMILIIRLDIQLHTPMYFFLTHLSCIDLCYSTIITPKTLQNLLTSIKNISFMGCFTQLFFFALLVAT
ECFILSSMAYDRYVAICNPLHYPAIMSPRLSHSLITVSYMIGALDSSVTVFCLSTLDFCNSKVIHHFFCDTFPILALSCSDTYGAEATIFYLAGATLLLSLIIISSSYVS
VLSTILKINSSSGKHKAFSTCASHLLGVTVFNGTMIFTYLKPSKSYSLGKDQVASVFYTVVIPMLNPLIYSLRNKEVKSAAIRVVKKREYTQKLK*
501 >lcl|NP_001000563.1|Plus1complement(11774796..11775761) NW_047657 olfactory receptor Olr532 Olr532 __SEG__ Chr3 {Rattus norvegicus} MSTWNYTKESDFILMGLTDSKELQLVLAVLFLLIYLVTVLGNTGMMLIIRLDARLHTPMYFFLTHLSFLDLCYSTVITPKTLQNLLTSNKIISFIGCFTQMYGFVLLAAA
ECFLLASMSYDRYVAICNPLHYPVIMSTRFCSALLTGSYMIGTLDATVNILCMNTLYFCRPKVIHHFFCDTSPILVLSCNDTHNIEIIIFIFAGSTLMVSVTTISASYMS
ILSTILKINSTSGKHKAFSTCASHLLGVTVFYGSMIFTYLKPSNSYSLGKDQVASVFYTVVIPMLNPLIYSLRNKEVKNAVHRVIKKQENSRLKFRVALSN*
502 >lcl|NP_001000564.1|Plus1complement(11805168..11806100) NW_047657 olfactory receptor Olr536 Olr536 __SEG__ Chr3 {Rattus norvegicus} MTENNFTKVTVFMLSGFSDHPELQVSLFLIFLFIYLFTVWGNIGLIMLIRIDSQLHTPMYFFLSNLAFIDIFYSSTVTPKALVDFQSTQKSISFVGCFVQMYFFVGLVCS
ECFLLGSMAYDRYVAICNPLLYSVIMSQKVCNWLAVIPYMIGFTNSLISICVISSLPLCDPYINHFFCDTTALLALSCVDAFNTELVIFVLAGFTLLSSLLIITFTYLTI
ISAILKIQSAAGRCKAFSTCASHLTGVTVFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNALLRVIDRKLFL*
503 >lcl|NP_001000565.1|Plus1complement(11913332..11914270) NW_047657 olfactory receptor Olr541 Olr541 __SEG__ Chr3 {Rattus norvegicus} MDAGNHTDVKEFILLGLTENPNWQVPLFLLFSIIYLIILLGNCGMIFLIWLNTHLHTPMYFFLSNLSFCDICYSTVIAPKMLINILSEHKSSKLFSCVLQSFFFMVYATT
EVILLSMMAYDRYVAIANPLMYTVIMTFSICINMVLACYLCGLINSLTHTISLLRLYFCGPNIVNHFFCDIPPLLKLSCSDAHINEMLLLVFSGVIAIFTFIIVMVSYIH
IIIAILRIRSTEGRLKAFSTCASHLTAVTLFYGSGSFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAIRLTCGWRNTS*
504 >lcl|NP_001000566.1|Plus1complement(11974324..11975262) NW_047657 olfactory receptor Olr542 Olr542 __SEG__ Chr3 {Rattus norvegicus} MEVWNHTGVKEFILVGLTENPNWQVPLFLLFCIIYFIILFGNWGMIFLIWLHAQLHTPMYFFLSNLSFCDICYSTIIAPKTIINLLSEHKSTRLFACILQSFFFAVYVTT
EVVLLSMMAYDRYVAIANPLMYTVIMTKSICTQMVLASYLAGLINSMIHTIGLLKLDFCGPNIVNHFFCDVPPLLKLACSDPHINEMLLLVFSGIIAISTFIIVMVSYSH
IIIAILRIRSAEGRRKAFSTCASHLTAVALFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAIQKLIFGKRNAC*
505 >lcl|NP_001000567.1|Plus1complement(12754201..12755139) NW_047657 olfactory receptor Olr577 Olr577 __SEG__ Chr3 {Rattus norvegicus} MTFENFTTFTDFVFLGLSSRQDVQQGLFAFFFLVYSLTVIANLGMVILIKLDSRLHTPMYYFLSNLSICDICYSSTVSPKMLADFLSKEKMIPYNLCAVQMYFFGAFADV
ECLMLAVMAYDRYVAICNPLLYTIAMSKKVCIQLVAVAYAVGLVDSAIHTCCTFRLSFCNSNVINHFFCDIPPLLALSCSDTSINEIVMFTFIGCVVGCSIVTVLLSYCY
IIATICRMNSAEGRRKAFSTCASHLMAVAIFHGTLLFMYFRPSSSYSMDTDKMASVFYTVIIPMLNPLIYSLRNKDVKAALKKAININSWPG*
506 >lcl|NP_001000568.1|Plus1complement(12772740..12773672) NW_047657 olfactory receptor Olr578 Olr578 __SEG__ Chr3 {Rattus norvegicus} MDKGNCSSHTEFVLLGITNDPSMKMVLFTVFLLIYLIILVANIGMIVLIKLDHQLHTPMYFFLSHLSFSDLCYSTAVGPKMLLDLMIKQKYIPLVGCALQFFFTCVFVDA
ECMLLAVMAFDRYKAISNPLMYVVDMSSKFCYQLLVGVYLVGMIDTVIHTIMTFGLCFCGSNEINHFFCDIPPILLLSCSDTQINELITFIIFGFIELSTISGVLVSYCY
IISSVLKIRSIDGRFKAFSTCASHLTVVAIFQGTLLFMYFRPASAYSLDQDKITSLFYTLVIPMLNPLIYSLRNKDVQEALQKLKNKICF*
507 >lcl|NP_001000569.1|Plus1complement(14991130..14992065) NW_047657 olfactory receptor Olr690 Olr690 __SEG__ Chr3 {Rattus norvegicus} MQNQSFITEFVFLGLSQNPNVQKLIFIICLLVYIATIGGNMMIVVTVVSSPTLLGSPMYFFLAFLSLLDASFSSAMTPKMIVDSLYERKTISFEGCMIQLFAEHFFGGAE
VIVLSAMAYDRYVAICKPLHYSSIMTLRLCGTLVGVAWAGGFLHSIIQIIFTLQLPFCGPNVIDHFICDLYPLLELACTDTHIFGLLVVANSGFICIIIFSLLLVSYGFI
LLSLRSHSSEGRWKALSTCGSHIAVVILFFVPCIFTYARPPTAFSFDKMVAIFYTMLSPLLNPMIYTFRNKDMKNAIRKVWKRLIINSDKK*
508 >lcl|NP_001000570.1|Plus1complement(15339454..15340374) NW_047657 olfactory receptor Olr705 Olr705 __SEG__ Chr3 {Rattus norvegicus} MGQGYNVTEFIFVGLTQDPAGQKALFALFSLTYIVTMLGNLLIAGTVIASPSLKSPMYFFLACLSVLDALYCNSISPNLIIDLLYNKKTISFKSCMLQLFVEHLFGGVEV
FLLVFMAYDRYVAICKPLHYLTIMNQRVCILLLLVAGVGGTVHSTIQVLTVYKLPFCGPNVIDHFMCDMNPLLGLACTDTYFLGITVMANGGVICVGIFTFLLVSYGIIL
NSLKTHSQEGRRKALFTCSSHITVVVCFFAPCSFIYARPVSNVPIDKYIAVFYTVVSPMLNPLIYTLRNSEMKNCIKKLWSKTLTK*
509 >lcl|NP_001000571.1|Plus1complement(15454997..15455941) NW_047657 olfactory receptor Olr710 Olr710 __SEG__ Chr3 {Rattus norvegicus} MGENNNVTEFVLLGLTQDPTGQKALFVMFLLMYIVTIVGNLLIVGTVIASPSLNSPMYFFLAFLSLMDAVYSTAILPKLLKDLVCDKKTISFTACLVQLFVEHLFGGAEV
FLLVVMAYDRYVAICKPLHYLTTMNQQVCISLLVVAWVGGFAHALVQVLSVYKLPFCGPNVIDHFGCDMYPLLALVCTDTYFIGLTVVANNGAMCMIVFVLLLFSYGIIL
SSLKTHSQEGRRKALSTCSSHIMVVVLFFVPCIFMYVRPVSNFPIDKSISVFYTAITPMLNPLIYTLRNSEIKNSMGKLWYKMISIGRVRIFAC*
510 >lcl|NP_001000572.1|Plus115700951..15701880 NW_047657 olfactory receptor Olr722 Olr722 __SEG__ Chr3 {Rattus norvegicus} MENQNNVTEFILLGLTENPKMQKIVFIVFLLIYIISITGNVLIVVTIISTSLLQSPMYFFLAYLSFIDACYSSVSTPKLITDSLCEKKTILFNSCMTQIFGEHLFGGAEI
ILLTVMAYDRYVAICKPLHYATIMSRRLCSLLVGVSWLGGFLHATIQILFIFQLPFCGPNVIDHFMCDLNPLLNLVCTDTHTLGLFVAANSGFICLLNFLLXLVSYVAIL
RSLKNHSAEGRRKALSTCISHITVVVLFFVPCIFVYMRPVATLPIDKAVAMFYTMITPMLNPLIYTLRNAQMKDAIKKLGSTKILSSNK*
511 >lcl|NP_001000573.1|Plus1complement(15747998..15748918) NW_047657 olfactory receptor Olr724 Olr724 __SEG__ Chr3 {Rattus norvegicus} MENRRNVTEFILIGLTQNPQMQKVVFVTFLILYMITISGNLLIVVTVINSQALSSPMYFFLSHLSLIDTIYTSSSAPKLIVDSLQENKVISFNGCMAQVYAEHIFGATEI
ILLTVMAYDRYVAICKPLHYMTIMNHKLCILLVGVAWTGGFLHATIQILFTVWLPFCGPNIIDHFMCDLYPLLELVCMDTHTLGLFVAANSGFICLFNFLLLMGSYVIIL
RSLKNYSLEGRRKALSTCVSHITVVVLFFIPCIFVYLRPVTTLPLDKGVAVFYTMVVPMMNPLIYTLRNAEVKNAIKKLWRKKSDR*
512 >lcl|NP_001000574.1|Plus1complement(15845902..15846828) NW_047657 olfactory receptor Olr729 Olr729 __SEG__ Chr3 {Rattus norvegicus} MEIPHNITEFFMLGLSQRPEIQRILFVVFLVIYAVTVFGNMLIVVTITFSSSLASPMYFFLSNLSFIDTCYSSSLAPKLIADSLYEGTTLSYEGCMAQLFGAHFLGGVEI
ILLTVMAYDRYVAICKPLHYTTKMTRHLCVVLVGVAWLGGFLHSLVQILLIFQLPFCGPNVINHFVCDLYPLLELACTDTYVIGLLVVANSGVICLLNFLMLGTSYIVIL
HSLRYHSVEGRRKALSTCGAHFTVVALFFVPCIFSYMRPSTTLSIDKNMAVFYGILTPMLNPLIYTLRNEEVKDAMRKLFTRMEATGT*
513 >lcl|NP_001000575.1|Plus1complement(16081023..16081949) NW_047657 olfactory receptor Olr741 Olr741 __SEG__ Chr3 {Rattus norvegicus} MARANNVTELIITGLFQDPNVQKVCFVLFLPVYMATVLGNGLIVAMVSVSKSLHSPMYIFLSSLSLVEIFYSSTVVPKFITDLLAKVKTISLNGCLAQIFFFHFLGVAEI
FLLVVMAYDRYVAICKPLHYMNIMSRQVCHTLVAVSWLGGFLHSIIQVLITIQLPFCGPNVIDHYFCDLQPLFKLACTDTFVESVIVMANSGLIALCSFLVLVSSYVIIL
INLRNHSADGRHKALSTCASHITVVILFFGPAIFLYMRHSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAVRKLWGKKNIGIK*
514 >lcl|NP_001000576.1|Plus1complement(16093045..16093962) NW_047657 olfactory receptor Olr742 Olr742 __SEG__ Chr3 {Rattus norvegicus} MANENNVTELIFTGLFQDPEVQKVCFGLFLPVYVATLLGNSLIIVAVSASKTLHSPMYFFLSSLSLVEIFYSSTIAPKFITDLLAKIKTISLKGCLTQIFFFHFFGVVEV
ILLVVMAYDRYVAICKPLHYMYIMSRLVCQRLVAGSWLGGLIHSIIQILITIPLPFCGPNVIDHYFCDLQPLFKLACTDTFLEGVIVMANSGLISIISLFILVSSYAIIL
VSLRNHSAEGRRKALATCASHITVVFLYFGPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMFWNQKEN*
515 >lcl|NP_001000577.1|Plus1complement(16124541..16125464) NW_047657 olfactory receptor Olr744 Olr744 __SEG__ Chr3 {Rattus norvegicus} MASINVTELIITGLFQDPEIQKVCFVLFLPVYLATVLGNGLIVVTISVSKTLHSPMYVFLSSLSLVEIFYSSTVVPKFITDLLAKVKTISLKGCLVQIFFFHFLGVAEIL
LLVVMAYDRYVAICKPLHYMNIMSRQVCHMLVAGSWLGGLIHSIIQILITIPLPFCGPNVIDHYFCDLQPLFKLACTDTFLEGVIVMANSGLISIISLFILVSSYAIILV
SLRNHSAEGRRKALSTCASHIMVVTLFFGPAIFLYLRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAVRKLWSKKDSETE*
516 >lcl|NP_001000578.1|Plus116148314..16149243 NW_047657 olfactory receptor Olr745 Olr745 __SEG__ Chr3 {Rattus norvegicus} MANTHNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVIVAASRNLGSPMYYFLSSLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFMHFFGGIEM
FLLTVMAYDRYVAICKPLHYTSIMNRQVCAVLVGTAWTGGFVHSLAQVLLIFRLPFCGPNVIDHYFCDVLPVLKLACSDTFLIGLLIVVNGGTLSVISFVVLLASYVVIL
FHLRTQSAEGRRKALSTCGSHVTVVVIFFAPCVFIYLRPTATLPIDKMVTVFYTVITPLLNPIIYSLRNAEVKKAMKTLWIRTTKVDKK*
517 >lcl|NP_001000579.1|Plus1complement(38872759..38873697) NW_047657 olfactory receptor Olr777 Olr777 __SEG__ Chr3 {Rattus norvegicus} MDRKNHTVVSEFVFLGLTHSWEIQLFLLVVSSVLYILSMSGNILIVFSVTIDPHLHSPMYFLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGV
EMVLLVAMAFDRYVAICKPLHYLTIMSPRVCTLFLAAAWGLGTSHSLFQLAFLIDLPFCGPNVLDSFYCDLPRLLRLVCKDTYKLQFMVTINSGFICVGSFLLLLISYIF
ILFSVWKHSSGGSSKALSTLSAHITVVFLFFGPPLFVYTWPHPHSQIDKFLALFDAVLTPFLNPVIYTFRNKEMKVAIKRVFKALLTFRNIS*
518 >lcl|NP_001000580.1|Plus1complement(39268629..39269567) NW_047657 olfactory receptor Olr791 Olr791 __SEG__ Chr3 {Rattus norvegicus} MGGANLSVVSEFVFLGLTNSWDIQLLLFMFSSMFYVASMMGNSLIIFTVASDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFKKHKVISFRGCVVQIFSIHVIGGV
EMVLLIAMAFDRYVAICKPLHYLTILSPRMCLFFVVIAWLVGLIHSLVQLAFVINLPFCGPNVLDSFYCDLPRFIKLACIDTHKLEFMVTANSGFISVGSFFILIISYIF
IIISVQKHSSSGFSKALSTLSAHVLVVVLFFGPLIFVYTWPSPSIHLDKFLAIFDAVITPFLNPVIYTLRNQEMRMAMKKIFKQLLGYRKIS*
519 >lcl|NP_001000581.1|Plus1complement(369719..370675) NW_047712 olfactory receptor Olr838 Olr838 __SEG__ Chr5 {Rattus norvegicus} MEIANQSTVAEFVLLGLSDHPMLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAMQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAVSSWVAGGANSMVQISLAVQLPFCGDNIINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIF
ILSTILRIPSAEGRKKAFSTCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLVDKLISLFYGVLTPMLNPIIYSLRNKDVKTAVRDLVGQKCLIQ*
520 >lcl|NP_001000582.1|Plus1complement(13770127..13771068) NW_047713 olfactory receptor Olr854 Olr854 __SEG__ Chr5 {Rattus norvegicus} MPGENVTVWSLFFLEGFSRYPRLEIVLFVFSLVMYLVTILGNSTLILITVLDSHLQTPMYLFLGNLSFMDICYTSASIPTLLVNLLSSKKTIIFSGCAVQMYLSLSMGST
ECILLAVMAYDRYVAICNPLRYPIIMSRHVCGQMAAISWVTGCLTALLETSCALQIPLCGNVIDHFTCEILAVLKLACVSSLLVDMVMLVVSILLLPIPMLLICISYGFI
LSTILRIGSTEGRNKAFSTCGAHLTVVILYYGAALSMYLKPSSSNSQEIDKIISLLYGVLTPMLNPIIYSLRNKEVKDAVKKLLGKVPLAPGM*
521 >lcl|NP_001000583.1|Plus1complement(323987..324934) NW_047719 olfactory receptor Olr857 Olr857 __SEG__ Chr5 {Rattus norvegicus} MQTLRKENCSSVSEFILLGFSSESQIRMALFIFFLLLYMVTLLGNGLIVALIYLDSRLHTPMYFFLSILSLVDMSYVTTTVPQMLVNMVCPKRTISWGACVAQMFIFLVL
GIAECVLYAIMAYDRYIAICFPLHYSVLMSRLVCAKMVTICSSISVTGALIYTVFTMRLPYCGPYKINHFFCEVPAVLKLACADTSFNDRLDFILGFVLLLVPLSLILAS
YACIFVSILRIRSSQGRLKSFSTCASHITVVTMFYGPAMVMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSLRNKDVKGAFMKVLGGRGTAQ*
522 >lcl|NP_001000584.1|Plus1343620..344558 NW_047719 olfactory receptor Olr858 Olr858 __SEG__ Chr5 {Rattus norvegicus} MQGSNQTFVTEFILLGFSLSPRTTPLLFSAFLTLYMLILLGNGLIFILICLDSRLHTPMYFFIGVLSMLDLGYTTTTVPQMLAHLASQKKTISYSNCVTQMFIFLVLGVT
ESWLFAIMSIDRYVAICHPLRYKVIMSPCLCGVMAIFCGLCGVTAALVYTIFAMRLPYCGPNKINHFFCEVPAVLKLACADTSVNDHVDFILGFSVILIPLSLILVIYVN
IFTSILKIRSAQGRLKAFSTCASHITVVTMFCVPAMVMYMKPGSKASPEEDKKLALFYNVISAFLNPVIYSLRNKDVKRAFLKVTGWGRSPE*
523 >lcl|NP_001000585.1|Plus1373464..374411 NW_047719 olfactory receptor Olr859 Olr859 __SEG__ Chr5 {Rattus norvegicus} MQGFSYENHSSVSEFILLGFSRNFQINIILFNVFFFLYLSTLVGNGLIVTLIHLDSRLHTPMYFFLSVLSLLDMSYVTTTVPQMLVHLVCQKQTISYSGCVAQMYIFLVL
GITEGWLFSVMAYDRYVAICHPLRYKVIMRPWLCGAMVVFCGLWGVSCSLIYTVFTMRLPYCGPNEINHFFCEVPAVLKLACADTSLNDRIDFILGFILLLVPLSFILAS
YVCIFATILRIRSAQGRLKAFSTCASHITVVTMFCGPAMFMYMNPGANASPERDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKVTGWGGATE*
524 >lcl|NP_001000586.1|Plus1complement(2466238..2467176) NW_047773 olfactory receptor Olr879 Olr879 __SEG__ Chr7 {Rattus norvegicus} MKNYTSITTFILVGLTDDANLQILLFIFLLLTYLLSVVGNLTIITLTLVDSHLKTPMYFFLRNFSILEVSFTTVCIPRFLYTMASGDNTITYNACATQLFFVIILGVTEF
FLLTAMSYDRYVAICKPLHYTTIMNNRVCIQFLIGCYLMALIIVIPPFSMSFKLEFCNSNVIDHFGCDAAPILKISCSNTEFIERFVLILAVLTLMFTLLCVVMSYTYII
RTILRFPSAQKRKKAFSTCSSHIIVVSITYGSCIFIYIKPSAKEGVAVNKVVSVLTTSVAPVMNPFIYTLRNKQVVQAFKDMIKKMASITKS*
525 >lcl|NP_001000587.1|Plus1complement(3938001..3938954) NW_047773 olfactory receptor Olr916 Olr916 __SEG__ Chr7 {Rattus norvegicus} MKNNTITTFILLGLTDDPQLQIPIFMFLFFAYTLSIAGNLTIIALTILDSHLKMPMYFFLQNFSILEISFTSACIPRYLYNIATGDRSITYDICVIQVFFTDVFGVTEFF
LLAIMSYDRYVAICKPLHYVTIMNSKVCQTLVLCCWMAGLLIILPPLTLFLNLRFCDSNVIDYFFCDASPILKISCSDTWLIEQLVIICALLTFILTLVCVTLSYVHIVK
TILRFPSVKQRKKAFSTCSSHMIVVSITYGSCIFIYINPSAKDSVTINKGVTVLMTSIAPMLNPFIYTLRNKQVRQAFSDSFKKIVMISMKKKTDQI*
526 >lcl|NP_001000588.1|Plus1complement(4240522..4241484) NW_047773 olfactory receptor Olr927 Olr927 __SEG__ Chr7 {Rattus norvegicus} MSNSGLRKNGSLSFCSEFTLVAFSSLAELQPVLILVFLVTYLFTVGGNLTIICVIWVTRSLHTPMYYFLANLSFLEMCYISSVVPQMLVHLLVQIKTISVRGCAVQMYVF
TILGLTECCLLATMAYDRFVAFCHPLHYPLRMGPSVCLKLAGASWMTGILVESAQTTWIFTLPFCGAGTIQHFFCDIMPVVKLACVDTSQNEIVIFIISLIFIMSPCLFI
LCSYIHIILTILKMPSAAGRHKAFSTCSSHILFVSLFYGTALFTYLQPKCSHTPDTDKATALMYTVVTPALNPVIYTLRNKEVKEAFHKVTQRKLHRQID*
527 >lcl|NP_001000589.1|Plus15107876..5108817 NW_047773 olfactory receptor Olr960 Olr960 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEILFILLGLTDDPQLQILIFLFMFFNYIFSLMGNLIIIFLTLLDLRLKTPMYFFLRNFSLLEIAFTTARIPRFLMSIITGDKTITYNACVAQLFFFVLLLITEF
YLLAAMSYDRYVAICRPLHYPIIMNSKVCHLLVISSWVTGFLSIFPPLMLGLKLEFCASKTVDHFLCDTSPVLQLSCTDTRFIEWIAFVVAVLTLIITLILVILSYTLIL
KTILKFPSAQQRRKAFSTCSSHMVVVSITYGSCIFMYIKTSAKERVTLNKGVAVLNTSVAPLLNPFIYTLRNQQVKDAFKQVINRLCYSQTVS*
528 >lcl|NP_001000590.1|Plus1complement(5977781..5978740) NW_047773 olfactory receptor Olr987 Olr987 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQVLIYLFLFFNYILRMMGNLVIIFLTLMDPHLKTPMYFFLRNFSFLEIAFTTACIPRFLMSILTGDRTISYNSCAAQLYFFFLSLITEF
YLLAAMFYDHSVAICKPLHYPIIMNSKVCHLLVPSSWVTGFLVIFPPLLLGLKLDFCASKTIDHFLCDTSPVLQLSCTDTHFIELMAFALAVMTLIITLILVILSYTLII
ITILKFPSAQQRRKAFSTCSSHMVVVSITYESCMFMYMKTSAKERVALNKGVAVLNTSVAPLLNPFIYTLRNQQVKDAFKQVLHRLCYSQNSELRFRPK*
529 >lcl|NP_001000591.1|Plus1complement(8316801..8317760) NW_047773 olfactory receptor Olr1070 Olr1070 __SEG__ Chr7 {Rattus norvegicus} MGDRESSNHSDMTDFILVGFRVRSELHILLFLLFLLVYTMILLGNLGMMAIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIAPKAMSNFWTESKSISFAGCVAQIFLFALF
IVAEGFLLAAMAYDRFIAICNPLLYSVHMSTRLCSQLVAGSYFCGCISSVLQTSMTFTLSFCASRAVDHFYCDSRPLQRLSCSDLFMHKIVSFSLSGIIILPTVIVIIVS
YVYIVSTVLKIRSTEGRKKAFSTCSSHLGVVSVLYGAVFFMYLTPNRFPELSKMASLCYSLVTPMLNPLIYSLRNKDVKDALSKLLEKKKIQSFIFPLL*
530 >lcl|NP_001000592.1|Plus1complement(12171066..12172019) NW_047773 olfactory receptor Olr1081 Olr1081 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFFLLGFTENPQLHFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFVDICFTSTTIPKMLVNIYTQSKSITYEDCISQMCVFLVFPE
LDNFLLAVMAYDRYVAICHPLCYTVIVNHRLCILLLLLSWVVSIFHAIIQSLIVLQLTFCGDVKIPHFFCELNQLSQLTCSDNFPSHLIMNLVPVMLAAISFSGILYSYF
KIVSSIHSISTVQGKYKAFSTCASHLSIVSLFYSTGLGVYVSSAVVQSSNSAASASVMYTMVTPMLNPFIYSLRNKDVKRALERLLEGNCKVYHWTG*
531 >lcl|NP_001000593.1|Plus114033129..14034064 NW_047773 olfactory receptor Olr1091 Olr1091 __SEG__ Chr7 {Rattus norvegicus} MAVTLGLNHTFVSEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATIWSEHSLHTPMYLFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
GFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTVVTTAIFNLTFCGPNEIHHFACHVPPLLKLACGKNVLAVAKGVGMVCITALLGCFLLILL
SYAFIVATILKIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPKSLGGDTLMGITYTVLTPFLSPIIFSLRNKELKNAMKEGLPK*
532 >lcl|NP_001000594.1|Plus1complement(16014288..16015250) NW_047798 olfactory receptor Olr1193 Olr1193 __SEG__ Chr8 {Rattus norvegicus} MKPGNQTSTLEFLLLGFSQDPEHQPMLFGLFLFIFVVAVLGNLLIILAVSIDSHLHTPMYFFLSNLSFSDICFITTTIPKMLVNIQTQSKSITYAECIIQMYFFMVFGGM
DTLLLTVMAYDRFVAICHPLHYPVIMNPHLSGLLVLVSWFTSFSYSLIQSLLMLRLSFCTNQVIKHFYCELAQALTIACSDTLINHILLYIVTCVLGFVPFSGIIYSYSK
IVTSILKIPSTDGKSKAFSTCGSHLSVVSLFYGTGLGVYLSSDASSSSEKGMVASVMYTIITPMLNPFIYSLRNKDIKKALQELGRIILSDKFTGFRLLR*
533 >lcl|NP_001000595.1|Plus110113116..10114057 NW_047799 olfactory receptor Olr1230 Olr1230 __SEG__ Chr8 {Rattus norvegicus} MKQTIIANNSSVTEFILMGLTVQRELQVPLFVLFLLNYTATVVGNLSLMNLICLNSHLHTPMYFFIFNLSCVDFCYSFVCNPTMLRSFISEENTIFYAGCMSQLFLFCFF
ANSESYLLTAMAYDRYVAICHPLQYTSVMSPMICGLLAFGSYFMGFAGAMTHTGFMIRLSFCNSNIINHYMCDIFPLLWISCSNTYVNELVSSAVVGTIIILSTVIIFVS
YAMILSNILHMSSSKGWSKALGTCGSHIITVSLFYGSGLLAYVKPSSAETVGQGKFFSVFYTLVVPTLNPLIYSLRNKDVKLAVKKTMKRITS*
534 >lcl|NP_001000596.1|Plus1complement(10456159..10457094) NW_047799 olfactory receptor Olr1257 Olr1257 __SEG__ Chr8 {Rattus norvegicus} MADSNRSTVTEFILAGLTDKPELQLPLFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMYFFLSSLSFIDLCYSTVITPKMLVNFVAKKNIISYQECMTQLYFFLAFVIS
ECHMLAAMAYDRYVAICNPLLYNVTMSYQVCSWMVGGVYAMGYIGAAVHTLCMLRVVFCKANIINHYFCDLFPLMELACSSTYVNEVVLLCLSAFNIFIPTLTILGSYVF
IIASILRIKSTEGRFKAFSTCSSHFCAVSVFFGSLAFMYLQPFSVSSKDKGKVSSVFYTTVVPMLNPMIYSLRNRDVKLALNKLFQKKFHV*
535 >lcl|NP_001000597.1|Plus1complement(11285089..11286024) NW_047799 olfactory receptor Olr1294 Olr1294 __SEG__ Chr8 {Rattus norvegicus} MAAANHCTLTEFFLAGLSEKQEVQLPLFLLFVAIYLIMVAGNLGMIALIWLSSHLHTPMYYFLSSLSFIDFCQSTVVTPKLLVSFLTENNQISYPGCMSQLYFFIAFGTA
ECYTLAVMAYDRYVAICSPLLYNVTMSYQLYSSLISVVYIYSVFCSSVNTGFMIRIQFCKLNVINHYFCDLLPLLKLACSNTYINEMLILFFGTVNICVPMLTVITSYIF
IIASILRIRSSEGKFKAFSTCSSHISAVAILYGSTAFTYLQPSSVSSVNQGKVSSVFYTTIVPMLNPLIYSLRNKDVTLALKRILERKNIM*
536 >lcl|NP_001000598.1|Plus1complement(11299985..11300929) NW_047799 olfactory receptor Olr1295 Olr1295 __SEG__ Chr8 {Rattus norvegicus} MQDMATGNHCTVTEFFLAGLSEKQEFHLPLFLLFIVIYLITVAGNLGMITLIGLSSNLHTPMYYFLSSLSFTDFCQSTVVTPKMLVSFVTEKNIISYPGCLAQLYFFIIF
GAAECYTLAAMAYDRYLAICNPLLYNATMSYQIYSSLISGVYIFAVFCASVHTGFLTRIQFCKLDVINHFFCDILPLLKLACSSTYIDEMLILFFGTLNIFIPTLTIIIS
YIFIIASILHIRSIEGKYKAFSTCSSHISAVAIFYGSAAFMYLQPSSVSSMDQGKVSSVFYTTVVPMLNPLIYSLRNKDVTLALKKIFERIKIM*
537 >lcl|NP_001000599.1|Plus112473798..12474721 NW_047799 olfactory receptor Olr1328 Olr1328 __SEG__ Chr8 {Rattus norvegicus} MESGNHSMVIEFILAGFSTKPELRLPLFLLFLGIYLLTVLGNLGMIILIILTSHLHTPMYFFLSSLSFIDLCHSTVITPKMLVNFVSEQNIISYPECMTQLYCFLVFAIA
ECHMLAIMAYDRYVAICNPLLYNVVMSHHLCFWLTVGVYTLGVIGSSVHTGFMLKLLFCKTNKINHYFCDLFPLLELSCSSIYINELLVLFLSALNILTPAFAILTSYIF
IIVSILRIRSTEGRSKAFSTCSSHISAVAIFYGSAAFMYLQPSSLSSMEQGKVSSVFYTTVVPMLNPLIYSLRNKDVKTAVKKILNR*
538 >lcl|NP_001000600.1|Plus139415384..39416319 NW_047657 olfactory receptor Olr796 Olr796 __SEG__ Chr3 {Rattus norvegicus} MKRVNHSVTSEFVFLGLTNSWDIQLLLFLVSSMLYVTNMMGNCLIIFTVASDPHLHSPMYFLLANLSFIDLGVSSATSPKMISDLLKKHKVISFRGCITQIFFIHAIGGA
EMVLLIAMAFDRYVAICKPLHYLTMMSPQMCIFFLITAWVVGLMHSVIQLVFIVNLPLCGPNILDSFYCDLPQFIKLACMNTHRLELLVSISSGFMSLGSFFLLSISYIV
IILTVLKHSSNGAYKALSTLSAHVSVVVLFFGPAIFFYIWPSSTHLDKFLALFDAVVTPFLNPVIYTLRNKEMKMAMRRVFRHLMGYRQIS*
539 >lcl|NP_001000601.1|Plus139395734..39396672 NW_047657 olfactory receptor Olr795 Olr795 __SEG__ Chr3 {Rattus norvegicus} MGKTNRSLVSEFVFLGLSNSWMIQLFLFLFSCVFYMASLLGNFLIVLTVTSNPQLHSPMYFLLANLSIIDLICSSFTAPKMIFDLLRKHKTISFGGCITQIFFIHAVGGT
EMLLLIAMAFDRYVAICKPLHYLIIMSPQNCILILVASWIIGFIHSVTQLIFVVDLPFCGPNELDSFFCDLPRFIKLACINTNTLEFMVTANSGFISVVSFLILIISYIF
ILVTVQKKSLGSLYKALSTLSAHVMVVVLFFGPLIFFYLWPFPTSHLDKFLAIFDVIVTPFLNPVIYTLRNKEMKVAMKRLCTRFMNYIKLS*
540 >lcl|NP_001000602.1|Plus1complement(39090378..39091316) NW_047657 olfactory receptor Olr788 Olr788 __SEG__ Chr3 {Rattus norvegicus} MGGANLSVVSEFVFLGLTNSWDIQLLLFMFSSMFYVASMMGNSLIIFTVASDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFKKHKVISFRGCVIQIFSIHVIGGV
EMVLLISMDFDRYVAICKPLHYLTILSPRMCLFFVVIAWLVGLIHSLVQLAFVINLPFCGPNVLDSFYCDLPQFIKLACLDTHKLEFMVTANSGFISVGSFFVLIISYIF
IIISVQKHSSSGFSKALSTLSAHVLVVVLFFGPLIINYTWPSPSIHFDKFLAIFDAVITPFLNPVIYTLRNQEMKMAMKKIFKQLLGYRKIS*
541 >lcl|NP_001000603.1|Plus1complement(39007336..39008298) NW_047657 olfactory receptor Olr785 Olr785 __SEG__ Chr3 {Rattus norvegicus} MGSVNQSVVSEFVFLGLTNSWDIQLFLFVFSSIFYVASMMGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGISSVTSPKMICDLFRKHKVISFRGCVTQIFFIHVIGGV
EMVLLIAMAFDRYVAICKPLHYLTIMSPRMCILFSVAAWVVGLMHSLVQLVFVVNLPFCGPNVLDSFYCDFPRFIKLACTDTYKLELLVSINSGFMSVGSFFILIISYIV
IIFTVQKHSSSGSSKALSTLSAHVTVVVLFFGPVIFFYTWPSSYTHLDKFLAIFDAIVTPFLNPVIYTLRNQEMKMAMMRVFSKLIGYSQILKHLNFEQP*
542 >lcl|NP_001000604.1|Plus1complement(39000319..39001257) NW_047657 olfactory receptor Olr784 Olr784 __SEG__ Chr3 {Rattus norvegicus} MDKANHSVVSEFVFLGLSNKWGIQLILFLFSSMFYMASLMGNLLIVFSVTADSNLHSPMYFLLANLSFLDLGVCSIAAPKMIYDLFRKHKVISFGGCITQIFFIHAIGGT
EMVLLIAMAFDRYVAICKPLHYLTIMRPQICILILAVSWILGLIHSVAQLAFVVDLPFCGPNILDSFYCDLPQLIKLACTETNKLVFMVTANSGLISVGSFFILIISYIF
ILVTVRKHSSGGISKALSTLSAHVTVVVLFFGPLIFFYTWPFPSSHLDKFLAIFDAVLTPFLNPVIYTFRNKEMKAAMRKLCSQVVNYRKAS*
543 >lcl|NP_001000605.1|Plus1complement(38954165..38955103) NW_047657 olfactory receptor Olr782 Olr782 __SEG__ Chr3 {Rattus norvegicus} MYGMNRSAVSEFIFLGITNIWEVQGLLFFFTLLFYFASMIGNLVIVLTVSLDPHLNSPLYFLLANLSVIDMMFCSITAPKMICDIFKKHKTISFWGCITQIFFSHAVGGT
EMVLLIAMAFDRYVAICKPLHYLIIMSPRVCLFFLVTSWVIGLIHSMVQLVFVVDLPFCGPNTLDSFYCDLPRLLRLACTNTEELELMVTVNSGFISVGSFLLLVISYIF
ILFTVWKHSSGGLSKALSTLSAHITVVILFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKDMKVAMGRLWAYFRHYRKMS*
544 >lcl|NP_001000606.1|Plus1complement(38923271..38924209) NW_047657 olfactory receptor Olr780 Olr780 __SEG__ Chr3 {Rattus norvegicus} MEGVNQSVVSEFVFLGLTNSWSIQLLLFVFSSMFYVASMMGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGVSSVSSPKMIYDLFRKHKVISFTGCVTQIFFIHVIGGV
EMVLLIAMAFDRYVAICKPLRYLIVMSPRMCIFFSVTAWVVGLMHSLVQLAFVVNLPFCGPNVLDSFYCDLPRFIRLACIDTYQLEFMVTVNSGFISVGSFFILIISYIV
IIMTVQKHSSSGSSKALSTLSAHISVVVLFFGPLIFFYTWPSPSTHLDKYLAIFDAVITPFLNPVIYTFRNQEMKIAMKRVCRQLVSYRKTS*
545 >lcl|NP_001000607.1|Plus1complement(38894176..38895102) NW_047657 olfactory receptor Olr778 Olr778 __SEG__ Chr3 {Rattus norvegicus} MFGANHSAVSEFVLLGLSNSWEAQIFLFFFSCLFYVSSLTGNFIIVVTVTSDPYLHSPMYFLLANLSVIDLIFCSIAAPKMICDLFRKQKVISFGGCISQVFFSHAVGGT
EMVLLIAMAFDRYVAICKPLHYLSIMSPRMCLLILVAAWIIGLIHSSTQLAFVINLPFCGPNILDSFYCDIPRLIKLACTDTYKLEFMIAANSGFISLIAFFLLIISYVF
LLNTVQKQSSGCSSKALSTLLAHIIVVVLFFGPLIFFYVWPAPSTHVDKFLAIFDAVLTPFLNPVIYTLRNRDMKIAIRKVFCQRLAL*
546 >lcl|NP_001000608.1|Plus1complement(38848761..38849699) NW_047657 olfactory receptor Olr776 Olr776 __SEG__ Chr3 {Rattus norvegicus} MDRKNYTVVSEIVFLGLTHSWEIQLLLLVFSSVLYILSMTGNILIVFSVTIDPHLHSPMYFLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGV
EMVLLVAMAFDRYVAICKPLHYLTIMSPRVCTLFLAAAWGLGTSHSLFQLAFLIDLPFCGPNVLDSFYCDLPRLLRLVCKDTYKLQFMVTINSGFICVGSFLLLLISYIF
ILFSVWKYSSGGSSKALSTLSAHITVVFLFFGPTLFIYTWPHPHSQIDKFLALFDAVLTPFLNPVIYTFRNKEMKVAIKRVFKALLTFRNIS*
547 >lcl|NP_001000609.1|Plus138703545..38704483 NW_047657 olfactory receptor Olr772 Olr772 __SEG__ Chr3 {Rattus norvegicus} MNGGNQSLVSEFVLLGLSQSQNLQVLLFIIFLMVYLLILSGNTIVMFLIITDKNLHSPMYFFLANLSFVDMWLSSATTPKMITDFLKEPKIISFAGCMSQVFFDHCVGAV
EMLLLVVMAYDRYVAICKPLHYFTIMNLKRCTGLVFTSWAIAFVHAMSQLLAVVKLPLCGHMEIDSFFCDIPLIIKLACMDSHILDIYMNIDCGFVVVTCFILLLISYTY
ILLTVRQSSKAGASKALSTCTAHITVVLIFFVPCIFIYVWPLSITWFDKFLAVFYTVFAPLLNPAIYTLRNKEMKNALKKLKNHFMNDKGNT*
548 >lcl|NP_001000610.1|Plus138639442..38640386 NW_047657 olfactory receptor Olr771 Olr771 __SEG__ Chr3 {Rattus norvegicus} MNEVNQSVVSEFVLLGLSHSQNLQVLLFVIFLIVYLLILSGNIVIVILITIDRHLHSPMYFLLANLSFVDIWLSSVTTPKMVTDFLRENKTISFAGCMSQVFFDHCIGAA
EMVLLLVMAYDRYVAICKPLHYFTIMNLKRCAALVLISWTIGFVHALSQLVPVLQLPLCGPLEIDSFFCDIPLVINLACMDSHDLDTLVNADCGVVVVTCFILLLISYTY
ILITVHQSSKTGASKALSTCTAHITVVLLLFVPCIFIYVWPLNITWFDKFLAVFYSVVTPLLNPAIYTLRNKDIKHSLKRLKGYFMNHRVRVNT*
549 >lcl|NP_001000611.1|Plus1complement(38552620..38553558) NW_047657 olfactory receptor Olr767 Olr767 __SEG__ Chr3 {Rattus norvegicus} MDGGNRSVVSEFILWGLTNSKNIQVFLFVIFLMLYMFILSGNIVILILVTTDPHLHSPMYFLLANLSFIDMWLSSNITPKMITDFLRENKTISFAGCMSQVFFTHCIAGG
EMVLLVVMAYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTIGFIHGISYLIVFVRLPFCGPNEIDSFFCDMPLVIKLACMDSHDLNTLMNAECGVVVVTCFSLLLISYTY
ILITVSQSSKAGASKALSTCSAHITVVLIFFVPCIFIYVWPLSITWFDKFLAVFYSVITPLLNPTIYTLRNKEIKNAMKRFLGKFLGPKGNS*
550 >lcl|NP_001000613.1|Plus138410719..38411654 NW_047657 olfactory receptor Olr757 Olr757 __SEG__ Chr3 {Rattus norvegicus} MDPINETVVFEFVLLGLSSSWKSTIFLMSSFSFLYVSIILGNLFIIFLVVTDSHLQSPMYFLLANLSLIDVGLSSTTVPKMISDLLKEHKVISFHSCMTQICSIHIMGGV
EMVLLIAMAFDRYIAICKPLRYLSIMSPRICISFVIAGWVTGVIHALSQFSFVVNLSFCGPNKLDSFYCDFPRVIQLACTDGDKFEFVVAANSGFMTMGTFFLLLLSYVF
ILVTVWQRSSGDLSKALVTLSAHITVVVLFFTPCMFLYVWPFPTSSIDKYLFIVDFAVTPALNPIIYTLRNKDMKNAIKKLSKQRCYIRIF*
551 >lcl|NP_001000614.1|Plus138400372..38401289 NW_047657 olfactory receptor Olr756 Olr756 __SEG__ Chr3 {Rattus norvegicus} MEEANQTVVTEFIFQGLCASKELQIFLLLPFSTLYLMAVVGNLFIVILIIIDHHLHSPMYFLLANLSFIDFCLSSVTTPKLITDLLKDNKTISFGGCMSQILCVHFFGGG
EMVLLVTMAYDRYVAICRPLHYSSIMDRQKCIWLVLISWIIGFIHAMSQLILVLELPFCGPRLVDSFFCDIPLVMKLACMNTDILEILINADSGVLATTCFILLLISYTY
ILLTVKLHSKDGSSKALSTCTSHIIVVVLFFGPVIFIYLCPVSITWVDKFLAVFYSVITPLLNPAIYTLRNKDIKNAIKKLINHM*
552 >lcl|NP_001000615.1|Plus138236390..38237328 NW_047657 olfactory receptor Olr749 Olr749 __SEG__ Chr3 {Rattus norvegicus} MNEINYTKVSEFVFLGLSKSKEIQHFFLAFSVVLYVAIVLGNTLVVFTLALDPHLHSPMYFLLGNLSFIDLCFSTLTVPKMISDLSSGHNTISFHGCVFQIFVIHVLGAS
EMVLLVVMAWDRYVAICKPLHYLTIMNPRICILLLSGAWIIAFLHSVIQLGFVVHLRFCGPNEIDSFYCDLPRFIKLACMDNYRMEFMVAANSGIISIGTFFLLIISYIV
ILLTVRKHSSGDLSKALSTLSAHISVVVLFFGPCIFVYMWPFPTVPVDKFLAILDFMITPILNPAIYTLRNKDMKVAMRKLSVQLLHFRKMS*
553 >lcl|NP_001000616.1|Plus1complement(16013488..16014414) NW_047657 olfactory receptor Olr737 Olr737 __SEG__ Chr3 {Rattus norvegicus} MANVNVTELIITGLFQDLEVQKVCFVLFLPVYLATVLGNGLIVVTVNISKSLYSPMYFFLSYLSLVEILYSSTVVPKFITDLLHKIKTISLKGCLAQIFFFHFFGVTEIL
LLTVMAYDRYVAICKPLYYTTIMSRPICHRLVAGSWVGGFFHSIIQIFITIPLPFCGPNIIDHYFCDLHPLFKLACTDTFVVGVIMFVNSGLFSVFSFLFLVSSYIVILY
NLRNHSAEGRRKALSTCASHIMVVVLFFGPAIFLYLRPASTYTEDKLVAVFYTVITPMMNPIIYTLRNAEVKNAVRRLWGKKVSSSLE*
554 >lcl|NP_001000617.1|Plus1complement(15943333..15944262) NW_047657 olfactory receptor Olr734 Olr734 __SEG__ Chr3 {Rattus norvegicus} MADLFNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVTVAVSRNLGSPMYFFLSSLSFVEICYSSTTAPKLILDLLAEMKSISVWGCMTQLFFLHYFGGIEI
FLLTVMAYDRYVAICKPLHYTSIMNRKVCIVLVGTAWTGGFVHSFAQIVLIFPLPFCGPNTIDHYFCDVLPLLKLACSDTFLIGLLIVANAGTLSVIIFVVLLASYVVIL
FHLRTLSAEGRRKALSTCGSHVTVVILFFGPCVFIYSRRSDTLPVDKMIAVFYTVITPLLNPLIYSLRSAEVKKAMKNLWFRTMKADEK*
555 >lcl|NP_001000618.1|Plus1complement(15934305..15935234) NW_047657 olfactory receptor Olr733 Olr733 __SEG__ Chr3 {Rattus norvegicus} MADLFNVTEFIFLGLSPNKEVQRVCFVLFLLLYMAIVLGNLLMVVTVAVSRNLGSPMYFFLSSLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFLHYFGGIEI
FLLTVMAYDRYVAICKPLHYTSIMNRKVCIVLVGTAWTGGFVHSFAQIVLIFPLPFCGPNTIDHYFCDVLPLLKLACSDTFLIGLLIVANAGTLSVISFVVLLASYVVIL
FHLRTQSAEGRRKALSTCGSHVTVVILFFGPCVFIYSRPSDTLPVDKIIAVFYTVITPLLNPLIYSLRSAEVKKAMKDLWFRTMKADEK*
556 >lcl|NP_001000619.1|Plus115822476..15823405 NW_047657 olfactory receptor Olr727 Olr727 __SEG__ Chr3 {Rattus norvegicus} MQKKMSNVTEFILLGLTQDPDLQKLLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSYLSIIDGFYSSSIAPKMIYDLISEKSTISFNGCMTQLFAEHFFAAAE
IILLISMAYDRYVAICKPLHYMTIMNRHVCIFLVVAAGIVGFVHGMIQTIFIAQLPFCGPNTINHFICDLIPLLELACTDTHTLGPLIAANSGSMCLLIFSMLVASYVFI
LRSLRNHSSEGRRKALSTCASHVTVVVLFFVPCSYLYVRPMISFHIDKVVSVFYTLVTPLLNPLIYTLRNEEVKNVMKKLLGQIRSNIC*
557 >lcl|NP_001000620.1|Plus115813077..15813997 NW_047657 olfactory receptor Olr726 Olr726 __SEG__ Chr3 {Rattus norvegicus} MSNVTEFILLGLTQDPDLQKLLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSYLSIIDGFYSSSIAPKMIYDLISEKSTISFNGCMTQLFAEHFFAAAEIILL
IAMAYDRYVAICKPLHYMTIMSRPVCIFLVGAAVILGFIHGGIQILFMAQLPFCGPNIIDHFMCDLIPLLELACTDTHTLGPLIAANSGSLCLLIFSMLVASYVVILRSL
RNHSSEGRRKALSTCASHVTVVVLFFVPCSYLYLRPMTSFPTDKAVTVFCTLVTPMLNPLIYTLRNEEVKRVMKKLWGQMRKAHDM*
558 >lcl|NP_001000621.1|Plus1complement(15592172..15593122) NW_047657 olfactory receptor Olr717 Olr717 __SEG__ Chr3 {Rattus norvegicus} MGQNNSVSEFILLGLTEDPAGQKTLFVVFLLIYIGTMVGNLLIVWTVIASPSLDSPMYFFLAYLSLIDALYSSTILPKLLIDLLCDKKTISLTACLVQLFVEHLFGGVEI
FLLVFMAYDRYVAICKPLYYLTIMNQRVCVCLVVVSWIGAFAHALVQVFSVYKLPFCGPNIIDHFACDMYPLLGLACTDTYFLGLTVVGNNGAISVVVFMLLLLSYGIIL
NSLKTHSQEGRRKALSTCSSHIMVIVLFFVPCIFMYVRPVSNFPLDKFITVFYTVFTPMLNPLIYTLRNLEIKKSMEKLCRKIFTSDRIRISSCYS*
559 >lcl|NP_001000622.1|Plus1complement(15573186..15574139) NW_047657 olfactory receptor Olr716 Olr716 __SEG__ Chr3 {Rattus norvegicus} MGQSNNVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFFLASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDI
VILVAMAYDRYVAICKPLHYLIIMNRRVCILFLVMAWVGGFAHALFQVLAVYNLPFCGPNIIDHFGCDIYPLLLLACTDTYLIGLTIIANGGAMCILIFILLLLSYAIIL
RSLQNHSQEGRRKALSTCSSHVTVIFLFFVPCIFMYVRPVSSFPIDKSITVIYTVVTPMLNPLIYTLRNSEMKNSMKKLLQKILSPNRLRLLCCLYY*
560 >lcl|NP_001000623.1|Plus1complement(15548035..15548958) NW_047657 olfactory receptor Olr715 Olr715 __SEG__ Chr3 {Rattus norvegicus} MGQKNNVTEFILLGLTQDPAGQKALFFMFFLIYIVTMVGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKTISFTACLVQLFVEHLFGGSEV
FILVVMAYDRYVAICKPLNYLTIMNRQVCILLLVVSWAGGFAHALLQVISVYLLPFCGPNVIDHFGCDMYPLLGLACTDTYFLGLTVVGNNGAMSIVVFILLLVSYGIIL
NSLKAHSQEGRRKALSTCSSHIMVVILFFVPCIFMYVRPVSNFPIDKYITVFYTIFTPMLNPLIYTLRNLEIKNCMAKLWGKCSLKT*
561 >lcl|NP_001000624.1|Plus1complement(15484235..15485188) NW_047657 olfactory receptor Olr712 Olr712 __SEG__ Chr3 {Rattus norvegicus} MGQSNNVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFFLASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDI
VILVAMAYDRYVAICKPLHYLTIMNRRVCILFLVMAWAGGFAHALFQVLAVYNLPFCGPNIIDHFGCDIYPLLLLACTDTYFIGLSVIGNNGAMCIVIFSLLLFSYGIIL
RSLQNHSQEGRRKALSTCSSHITVVFLFFVPCIFMYVRPVSSFPIDKSITVIYTVVTPMLNPLIYTLRNSEMKNSMEKLLQKILSPNRVRLLCCLHY*
562 >lcl|NP_001000625.1|Plus1complement(15465392..15466336) NW_047657 olfactory receptor Olr711 Olr711 __SEG__ Chr3 {Rattus norvegicus} MEETNNVTEFILLGLTQDPAGQKVLFVMFLLIYIVTIGGNLLIVGTVIASPSLGSPMYFFLAFLSLMDAVYSTAILPKLLTDLLCDKKAISVKACLVQLFVEHLFGGSEV
FILVVMAYDRYVAICKPLHYLTIMNRQVCILLLVVSWAGGFAHALLQVISVYLLPFCGPNVIDHFACDMYPLLGLACTDTYFLGLSVIGNNGAMSIVVFILLLVSYGIIL
NSLKTYSQEGRRKALSTCSSHIMVVILFFVPCIFMYVRPVSNFPIDKYITVFYTIFTPMLNPLIYTLRNMEIKNCMAKLWGKMFTKDIKKISAH*
563 >lcl|NP_001000626.1|Plus1complement(15301341..15302264) NW_047657 olfactory receptor Olr704 Olr704 __SEG__ Chr3 {Rattus norvegicus} MGQRSNVTEFVLLGLTQDPAGQKALFVMFLLIYIVTIVGNLLIVGTVIASPSLGTPMYFFLAYLSLLDAVYSTSISPKLMIDLLCNRKTISFSACMTQLFLEHLLGGAEV
FLLMVMAYDRYVAICKPLHYLIIMNRRACFLLLVVSWAGGLTHSVAQLLFVYNLPFCGPNVIDHFICDMYPLLGLACTDTYFIGLTVVANGGAICMLVFIILIISYGIIL
KSLKTHSQEGRQKALSTCSSHIMVVGLFFVPCIFMYVRPVHNFPIDKSITVFYTIVTPILNPLIYALRNSEMKKSMENLMYKVFRRV*
564 >lcl|NP_001000627.1|Plus1complement(15213049..15213966) NW_047657 olfactory receptor Olr701 Olr701 __SEG__ Chr3 {Rattus norvegicus} MEQRNNVTEFVLLGLTQSPEGQKILFVVFLVIYVVTMAGNLLIVVTVVVSPSLDAPMYFFLGYLSFMDAVYSTTVTPNMIIDLLYEKKTISFKACMSQLFIGHLFGGAEI
LLLVVMAYDRYVAICKPLHYLTIMNQRVCVLLLLLAWFGGFLHAVVKLLFVYNLPFCGPNIIDHFICDMYPLLKLACTDTYVIGLTVVANDGAICVIIFILLVISYGVIL
HSLKNLSQEGRRKTLSTCGSHITVVVLFFVPCIFMYVRPPSTLPIDKSLTVFYTIITPMLNPLIYTLRNAEMKNAMRKLWTSKGK*
565 >lcl|NP_001000628.1|Plus1complement(15081625..15082560) NW_047657 olfactory receptor Olr695 Olr695 __SEG__ Chr3 {Rattus norvegicus} MLNQSFVMEFVFLGLSQNPNLQKLIFIICLIVYIATIGSNMMIVVTIVYSPTLLGCPMYFFLAFLSLLDASFSSAMTPKMIVDSLYKRKTISFEGCMIQLFVEHFFGGAE
MILLTAMAYDRYVAICKPLHYSSIMTRKLCGTLVGMAWAGGFLHSTVQIIFTLQLPFCGPNVINHFMCDLFPLLELACTDTHIFSLFVVANSGLICIIVFVLLLISYAFI
LMSLRSQSSEGRWKALSTCGSHVAVVVLFFVPCIFIYARPHSAFSFDKMVALFYTMLSPLLNPIIYTFRNKDMKNAIRKLWKKLVIVPDER*
566 >lcl|NP_001000629.1|Plus1complement(15031441..15032358) NW_047657 olfactory receptor Olr693 Olr693 __SEG__ Chr3 {Rattus norvegicus} MENAKNVTDFILLSISKIPELRTIFSALFLIMYVVTILGNLLIVVTVMKSSNLRSPMYFFLISLSFLDVIYSSITAPKLIIDSLSENTTISLEGCMTQLFAEHFFGGVEI
ILLIVMAYDRYVAICKPLHYRTIVSPRMCWLMVGGAWVGGFAHATIQLLFMYQIPFCGPNIIDHVICDLFPLLQLACTDTHILDLLVILNSGVMCVTIFLILITSYVVIL
CSLKSRSSEGRRKALSTCSSHFTVVVLFFVPCIFLYMRPVVTYPVDNIMALCATIVEPMLNPLIYSLRNAEVKQALRKLWMKRGP*
567 >lcl|NP_001000630.1|Plus115012873..15013823 NW_047657 olfactory receptor Olr691 Olr691 __SEG__ Chr3 {Rattus norvegicus} MESTNNITEFILLGLSQNKKIKTLCFPLFLFCYISILGGNMFILISITYSQLVQQPMYFFLNYLALSDLCYTSTVTPKFLSDLIIERNIISYTSCMLQLFTMHFFGGIEI
LILTAMAYDRYVAICKPLHYTIIMSRGRCQAMVTACCAGAFIHSFFQNLLAISLPFCGHNEMDHYFCDIYPLLTLACTNTSRVGLLVVANTGMMGLVTFLVLMWSYSFIL
YTIRAYPAESRRKALSTCSSHVTVVILFFVPVLFIYIRPATTYPEDKVFALFYTILAPMFNPLIYTLRNTEMKNALRKVWCHKLFLFKRESYDIYC*
568 >lcl|NP_001000631.1|Plus1complement(14852134..14853069) NW_047657 olfactory receptor Olr681 Olr681 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVNEFILLGLSQNPKVEKILFVVFLLVYIATIVGNIIILVTIIYNPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCITQLFTSHFFAGVE
VIILTSMAYDRYVAICKPLHYSSIMTRRLCGTLVGVAWTGGFLHSITQVIFTLQLPFCGPNFIDHFSCDLFPLLQLACTDTHIFVILVFANSGSFCIIIFSLLIVSYGVI
LFSLRGHSSEGRRKALSTCGSHITVMILFFVPCMLIYARPSSAFSFEKNTLIFASVLTPLLNPMVYTFRNKEMKNAIRKMCRKLIVVSNTF*
569 >lcl|NP_001000632.1|Plus1complement(14750413..14751348) NW_047657 olfactory receptor Olr675 Olr675 __SEG__ Chr3 {Rattus norvegicus} MQNHSFVTEFILLGLSQNLNVEKMLLCLLLFIYFATIAGNMVIVVTIMYSPALLGSPMYFFLIFLSLLDACTSSSVIPKIIIDCFSERKTISFECCMIQLFAVHFFTGAE
VIVLSAMAYDRYVAICKPLHYSSIMTQRLCGILVVVSWAGGFLHSIIQVIFTLQLPFCGPNVIDHYMCDLFPLLKLACTDTHIYIFMIFANSGAICIIIFSLLLVSYGVI
LFSLRTHSSEGRCKALSTCGSHIIVVLLFFVPCILIYARPTSAFSFEKNVVTFMNAVTPLINPMVYTFRNKEMKNAIRKMWKRLIVISDEF*
570 >lcl|NP_001000633.1|Plus1complement(14605119..14606054) NW_047657 olfactory receptor Olr670 Olr670 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNPKVEKILFIIFLLLYLATIGGNMTIVVTIVWNPALLGSPMYFFLAFLSLLDACVSSIVTPKMIIDLFYKRKSISFECCMTQVFSVHFFSAVE
VIILAAMAYDRYVAICKPLHYSSIMNRRLCGILVGVAWAGGFLHSIIQIIFTLQLPFCGPNFIDHFICDLFPLLKLACTDTHIFVILVFANSGSICIIIFSFLLVSYGVI
LFSLRTHSSEGRRKALFTCGSHITVVVLFFVPCILIYARPTSPFSLEKNVFIFADVLTPLLNPMVYTFRNKEMKNAIRKMWRKLLVAPNTY*
571 >lcl|NP_001000634.1|Plus1complement(14514094..14515029) NW_047657 olfactory receptor Olr665 Olr665 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFLLLGLSQNPKVQKIVFVVFFFVYIGTFGSNMTIVVTIINSRALLGSPMYFFLAFLSFLDACISSVITPKITVDLLYERRTISFDGCMAQVFAVHFFTGVE
VIILITMAYDRYVAICKPLLYSSIMNRRLCAILVGIAWAGGFLHSTIQIIFILYLPFCGPNVIDHFLCDLFPLLKLACTDTHIFVILVFANSGSICIIIFSLLLVSYGVI
LFSLRAHSSEGRHKALSTCGSHITVVVLFFVPCILIYARPASAFFSEKNVFLFATILTPLLNPMIYTFRNKEMKNAIRKMWKRLMLDYGIS*
572 >lcl|NP_001000635.1|Plus114317757..14318680 NW_047657 olfactory receptor Olr660 Olr660 __SEG__ Chr3 {Rattus norvegicus} MQQNSTVTQFILLGLTQDPLKQKMVFIIFLIFYMGTVVGNTLIIVTIKFSRTLGSPMYFFLFYLSFADSCFSTSTAPRLIVDALSKKNIISYNECMTQVFALHLFGCMEI
FVLILMAVDRYVAICKPLRYPVIMSRQVCVILIILAWIGSFIHSTAQIVLALKLPFCGPNLIDHYCCDLQPLLKLACMDTYMINLLLVSNSGAICSSSFIILIISYFVIL
HSLRNHSAEGRKKALSTCTSHIIVVILFFGPCIFIYARPPTTFPMDKMVAVFYTIGTPFLNPIIYTLRNAEVKNAMKKLWHLKIVTE*
573 >lcl|NP_001000636.1|Plus1complement(14190195..14191124) NW_047657 olfactory receptor Olr654 Olr654 __SEG__ Chr3 {Rattus norvegicus} MENHKNVTEFIFMGLWENRQIELLFFVLFLLCYLAVLMGNSVILVTITCSHLIEQPMYYFLCHLSLMDLCYTSTVIPRLIRDLAATRKNISYNECMTQLFTGHLLAGVEI
FILVSMALDRYVAIVKPLHYMVIMRRKRCDMLIVTAWIVGFWHSIALLLMVLSLPFCGPNHINHYLCDVKPLLNLVCEDVHVVSILSIANSGMVVVAIFIVLLASYILIL
YSLRTRSSAGQRKALSTCSSHIMVVVLFFGPCIYIYIFPAGNENKDKEISLFYTVIAPILNPLIYTLRNSEMKNAMHKVWSQMSNSHLK*
574 >lcl|NP_001000637.1|Plus114173464..14174393 NW_047657 olfactory receptor Olr653 Olr653 __SEG__ Chr3 {Rattus norvegicus} MEIRNNVTEFVLLGLTQNLHMQKIVFVVFLVIYVFSVVGNLLILITITNSQLLGAPMYYFLAYLSFIDACYSSVNTPKLIFDSLHKKKSIKFNGCMTQVFAEHFFGGAEI
ILLTVMAYDRYVAICKPLHYATIMNRQLCNILVGVSWVGGFLHAGIQMLFMIGLPFCGPNVIDHFMCDLNPLLALACVDTHILGLFVAANSGFICLLNFLLLLVSYLVIL
HSLKNHSAEGRRKALSTCVSHITVVVLFFVPGIFVYMRPAATLPIDKAVAIFYTIITPMLNPLIYTLRNAQMKNAIWKLFSTNINSDEK*
575 >lcl|NP_001000638.1|Plus1complement(14147402..14148331) NW_047657 olfactory receptor Olr652 Olr652 __SEG__ Chr3 {Rattus norvegicus} MENHKNVTEFIFMGLWENRQIELLFFLLFLLCYLAVLMGNSVILVTISCSHLIEQPMYYFLCHLSLMDLCYTSTLIPRLIRDLAATRKNISYNECMTQLFTAHLLAGVEI
FILVSMALDRYVAIVKPLHYMVIMRRKRCDMLIVTAWVLGFWHSIALLLMVLSLPFCGPNHINHYFCDVKPLLKLVCKDIHVVNILSIVNSGVVVVAIFIVLLASYILIL
YSLRTRSSAGQRKALSTCSSHIMVVVLFFGPCIYIYILPAGNENKDKEISVFYTVIAPMLNPLIYTLRNSEMKSAMHKVWFQLTNSHFK*
576 >lcl|NP_001000639.1|Plus1complement(14115920..14116846) NW_047657 olfactory receptor Olr650 Olr650 __SEG__ Chr3 {Rattus norvegicus} MQLNINITEFILLGLTQDPSRKNIVFAIFVFFYMGTLLGNLLIIVTIKTSQALGSPMYFFLFYLSLSDTCFSTTVAPRTIVDSLLKEASISFNECIIQVFSIHLFGSLEI
FTLVLMAADRYVAICKPLHYTTIMNRQVCGMLMAIAWMGSCVHSLVQIFPALSLPFCGPNEIDHYFCDLQPLLKLACSDTYVSNLLMVSNSGSLCTVSFLMLMVSYIIIL
YSLRNHSAEGRRKALFTCVSHIIVVILFFVPCIFIYTRPATTFPMDKMISVFYTICTPFLNPLIYTLRNAEVKNAMRKLWTKKISDDI*
577 >lcl|NP_001000640.1|Plus114090965..14091900 NW_047657 olfactory receptor Olr649 Olr649 __SEG__ Chr3 {Rattus norvegicus} MEEVNNVTEFIFWGLSQNPQVEEVCFVVFSFFYIIILLGNVLIMLTVCTGSLFKSPMYFFLNFLSFVDICYSSVTAPKMIVDLLVKKKTISYVGCMLQLFGVHFFGCTEI
FILTVMAYDRYVAICKPLHYMTIMDRERCNKMLLGTWVGGFFHSIIQVALVVQLPFCGPNEIDHYFCDVHPVLKLACTDTYTVGVVVTANSGTIALGSFVILLISYTVIL
MSLRKQSSEGRRKALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAIFYTIITPMLNPLIYTLRNAEVKNAMRKLWTRKVSWDTIGK*
578 >lcl|NP_001000641.1|Plus114066023..14066958 NW_047657 olfactory receptor Olr648 Olr648 __SEG__ Chr3 {Rattus norvegicus} MDKSNNITVFILLGLSQNKNTEILCFVFFLFCYIAIWMGNVLIMISITGTQLIEQPMYFFLNYLSLSDLCYTSTVTPKLMTDLLAERKVISYNNCMIQLFTTHLFGGIEI
FILTGMAYDRYVAICRPLHYTVIMSRHRCNLIIITCCTGGFVHSACQLFLTIFLPFCGPNEIDHYFCDVYPLLKLACSNTHIIGLLVIANSGLIALVTFVVLIFSYFFIL
YTVRAFSAESRSKALSTCSSHLTIVVLFFAPALFIYIRPATTFPEDKVFAPFYTIIAPMFNPLIYTLRNTEMKNALRKVWGHQGLLKVKLI*
579 >lcl|NP_001000642.1|Plus114036741..14037661 NW_047657 olfactory receptor Olr646 Olr646 __SEG__ Chr3 {Rattus norvegicus} MMNKNNVTEFILLGITSDPELRKMLSVLFLIMYMITIFGNLLIVVTITRSPSLRSPMYFFLLSLSLMDVTYSSVIAPKLIIDSLSERTIVSFEGCMAQLFAEHFFGGVGI
ILLIVMAYDRYVAICKPLHYTKIMTPNVCCLMVGGAWVGGSMHATIQLLFMYQIPFCSPNIIDHFMCDLFPLLKLACMDTYILGLLVILNSGVMCVSIFLILIASYIVIL
CSLKSYSSEGRRKALSTCSSHFTVVVLFFVPCIFLYMRPVVTFPIDKAMAVSFTIVEPMLNPLIYTLRNAEVKYAIKNMCRKQGCH*
580 >lcl|NP_001000643.1|Plus1complement(13939724..13940632) NW_047657 olfactory receptor Olr641 Olr641 __SEG__ Chr3 {Rattus norvegicus} MGNQNNVTEFILLGLTENQDLRKLFSAVLLIMYVVMLLGNMLIVATMITSQRLRLPMYFFLTSLSVVDITFSSVIAPKLILDSLSENTTISFEGCMAQLFAEHFFGGVGI
ILLIVMAYDRYVAICKPLHYMNIMSPRKCCTLLCGAWVGGLAHATIQLIFMYQIPFCGPNIIDHFLCDLFQLLILACMDTHTLGLIVIFNSGVMCIAIFIILIASYITIL
CSLKTHNSEGRRKALSTCGSHFTVVVLFFVPCIFLYVRPVSTYHIDKAMAVSDSIVTPMLNPLIYTLRNTEVKNAMKKLWKK*
581 >lcl|NP_001000644.1|Plus113931835..13932764 NW_047657 olfactory receptor Olr640 Olr640 __SEG__ Chr3 {Rattus norvegicus} MMHNNSVTEFILLGLTQDSEKQKAIFGVFLILYLMTLLGNFLIVVTIKMSQTLGGPMYFFLFYLSFADACFSTTTAPRLIVDSFFQKKIITYNECMTQIFAGHFFGCMEI
FVLILMAFDRYVAICKPLRYTTIMNQRICGILVILAWVGSCIHSSAQIFLALRLPFCGPNVIDHFSCDLQPLLKLACIDTYVINLLVVSNSGAICMVSFIVLFVSYIVIL
YSLKNHSAEGRRKALSTCTSHFIVVVIFFGPCIFIYTRPLITLPIDKMVSVFYTIATPLLNPLIYTLRNAEVKNAMKKIWCGKALIKNI*
582 >lcl|NP_001000646.1|Plus113802585..13803514 NW_047657 olfactory receptor Olr635 Olr635 __SEG__ Chr3 {Rattus norvegicus} MMHNNSVTEFILLGLTQDSEKQKAIFGVFLILYLMTLLGNFLIVVTIKLSQTLGSPMYFFLFYLSFADACFSTTTAPRLIVDSLFQKKIITYNECMTQIFAAHFFGCMEI
FVLILMAFDRYVAICKPLRYTTIMNQHICGILVILAWVGSCIHSSAQIILALRLPFCGPNVIDHFSCDLQPLLKLACMDTYVINLLVVSNSGAICTVSFIVLLISYIVIL
YSLRNHSAEGRRKALSTCTSHFIVVVIFFGPCIFIYTRPLITLPIDKMVSVFYAIATPLLNPLIYTLRNAEVKNAMKKIWCGKALIKNI*
583 >lcl|NP_001000648.1|Plus113764004..13764915 NW_047657 olfactory receptor Olr633 Olr633 __SEG__ Chr3 {Rattus norvegicus} MHNNSVTEFILFGLTRDPEKQKAIFGVFLILYLMTLLGNFLIVVTIKMSQTLGGPMFFFLFYLSFADACFSTTTAPRLILDSLSQKKIITYNECMTQVFAAHFFGCMEIF
VLILMAFDRYVAICKPLRYTTVMSQRICGLLIILAWVGSCIHSTAQIILALRLPFCGPNIIDHYFCDLQPLLKLACMDTYVINLLVVSNSGAICMVSFIVLLMSYVVILY
SLRNHSVEGRRKALSTCTSHFIVVVIFFGPCIFIYTRPPTTFPIDKMVSVFYTIGTPLLNPLIYTLRNAEVKNAMKKIWCGKG*
584 >lcl|NP_001000650.1|Plus113602073..13602987 NW_047657 olfactory receptor Olr624 Olr624 __SEG__ Chr3 {Rattus norvegicus} MMHNNSVTEFILLGLTQDSEKQKAIFGVFLILYLMTLLGNFLIVVTIKMSHTLSSPMYFFLFYLSFADACFSTTTAPRLIVDLLFQKKVITYNECMTQLFAAHFFGCMEI
FVLILMAFDRYVAICKPLRYTIIMNQRICGILVILAWLGSCIHSLAQIFLALILPFCGPNVIDHFFCDLQPLMKLACMDTYVINLLVVSNSGAICTISFIVLLISYIVIL
YSLRNHSAEGRRKALSTCTSHFIVVVIFFGPCIFIYTRPLITLPIDKMLSVFYTIGTPLLNPLIYTLRNAEVKNAMKKVWCSKV*
585 >lcl|NP_001000652.1|Plus1complement(13529112..13530023) NW_047657 olfactory receptor Olr621 Olr621 __SEG__ Chr3 {Rattus norvegicus} MHNNTVTEFILFGLTQDPDKQKAIFGVFLILYIMTLLGNFLIVITIKMSHTLGSPMYFFLFYLSFADACFSTTTAPRLIFDSLTQKKIITYNECMTQVYALHFFGCMEIF
VLILMAFDRYVAICKPLRYTTIMSQHICGLLVILAWVGSCIHSTAQIILALRLPFCGPNIIDHYFCDLQPLLKLACMHTYVINLLVVSNSGAICTVSFMVLLISYIVILY
SLRNHSAEGRRKALSTCTSHFIVVVLFFGPCIFIYTRPPTTFPIDKMVSVFYTIGTPLLNPLIYTLRNAEVKNAMKKLWCGKV*
586 >lcl|NP_001000654.1|Plus1complement(13374834..13375766) NW_047657 olfactory receptor Olr613 Olr613 __SEG__ Chr3 {Rattus norvegicus} MDRGNCSSVNKFIFSGITNNHDTKVALFITFLLVYLIALLANLGMIILIRADAQLHTPMYFFLTNLSFCDFCYCTAIGPKMLVDLLADDKSIPFVGCALQFLTFCVFADS
ECLLLAVMAFDRYQAISNPLLYTVNMSNTVCSMLMVGVYLIATTDGLIHTTLAFRLCFCGSNEINHFFCDLPPLYMLSCSDIQVNELALFTVFGFIELSTISGVLISYCY
IILSVLKISSTEGRFKAFSTCTSHLTAVAIFQGTVLFMYFRPSSSYSLDQDKITSLFYTLVIPMLNPLIYSLRNKDVKQALQKLKMKIWF*
587 >lcl|NP_001000655.1|Plus1complement(13306439..13307419) NW_047657 olfactory receptor Olr608 Olr608 __SEG__ Chr3 {Rattus norvegicus} MNSVVPSTRSQWWNEGNQSMVSSFILLAFSEFPNLQLPLFLVFLIMYTVTVLENLGMIFVIRINPKLHTPMYFFLSHLSFVDFCYTSVIAPKLLDLLLVEDKSISFEGCM
VQYFLGCTFVITEMFMLAVMAYDRLVAVCNPLLYTAAMSQELCSILVVVTYIWAGIFSSTLTYILLQLSYCGPNVINHFCCEYSALLSVSCSDISFSQTACLVISMFNEA
CCLLIIITSYVFIGVTIIKIPTKGAFQKALSTCASHLTAIGVCHGIVLLLYCVLKSKSSLFLVKVATVFHSMVIPMLNPLIYSLRNTDVKETVRKLVYLKCIFHSI*
588 >lcl|NP_001000656.1|Plus1complement(13165905..13166861) NW_047657 olfactory receptor Olr604 Olr604 __SEG__ Chr3 {Rattus norvegicus} MLLSGRNNSEMIFTLLGFSDYPELKVPLFLVFLIIYSIIVVGNIGMILVIRINPKLHTPMYFFLSHLSFVDFCYSSIITPKMLVNLVAKDRTISFRECIVQYFLFCIFVV
TEAFLLVVMAYDRFVAICNPLLYTVVMSQKLCFTLVMGSYTWGFTCSLTLTCSTVQLSFHTVNIIDHFFCEFSSLLALSSSDTRISQLLLFVFATFNAVSTLLIILLSYL
FIVVTVLKTHSASGLRKAFSTCASHLAAITIFHGTILFLFCVPNSQNSRLTVKVGSVFYTVVIPMLNPLIYTLRNKDVLDTIRKIMTMVSCVKNDRHN*
589 >lcl|NP_001000657.1|Plus113017837..13018772 NW_047657 olfactory receptor Olr594 Olr594 __SEG__ Chr3 {Rattus norvegicus} MQFVLIGFSDFPNLQGFLHAVFSVVYIIILVGNFLIILTTSMDPALQKPMYFFLANFSSLEICYVSVTVPRILFNLEKQDRSISLMSCATQLCFFLIFGTTECLLLTVMS
YDRYVAICNPLQYPLVMNPKRCTQMVAVSWLGGIPVQIGQTYQIFSIPFCYSNQIDHFFCDIPPILKLAGGDTSVHELSVYLVVSMVVAFLFILVLTSYSKIIATILGLP
TTKGRAKAFSTCSSHLLVVVLFYGSATVTYLRPKSRHSPGTDKVFSLFYAIVISMLNPLIYSLRNKEVTAAMRKLIFQIRDLCRHRSLLFF*
590 >lcl|NP_001000658.1|Plus112986630..12987562 NW_047657 olfactory receptor Olr590 Olr590 __SEG__ Chr3 {Rattus norvegicus} MERENCSSFTEFILMGITNNTEVKAALFTIFLVVYLINLIGNLGMIVLIKVDPQLQTPMYFFLSNLSFCDLCYSSAVGPKMLTDIFGNDKSIPFFGCALQFFISCTFVDS
ECILLAVMAFDRYQAISNPLLYTTNMSSRLCSLLMAGVYLVGVADSLIHTTLTFHLCFCGSNEIDHFFCDIPPILLLSCSDTQVNELAIFTIFGFIELSTISGVLVSYCY
IISSVLKISSTEGRFKAFSTCASHLIAVAIFQGTVLFMYFRPSSSYSLDQDKMSSLFYILVIPMLNPLIYSLRNKDVKEALKKLKNKRCC*
591 >lcl|NP_001000659.1|Plus1complement(12950248..12951183) NW_047657 olfactory receptor Olr587 Olr587 __SEG__ Chr3 {Rattus norvegicus} MDKGNCSSLHEFLLLGITNNPDMKVLIFTVFLAIYLSILITNIGMIILIKMDPQLQTPMYFFLSHLSFSDLCYSSAVGPKMLIDIFSKYKTIPFVGCALQFFFVCIFIDV
ECVLLAVMAFDRYKAINQPLLYAVDMSNRVCYQFLAGVYLVGMTDALIHTTLTFRLCFCESNEINHFFCDIPPILLLSCSDTQVNELVIFAIFGFIELSTISGVLVSYCY
IILSVLKIHSAKGRFKAFSTCTSHLTAVAIFQGTLLFTYFQPSTSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEALQKLGNKRWCK*
592 >lcl|NP_001000660.1|Plus112933302..12934237 NW_047657 olfactory receptor Olr586 Olr586 __SEG__ Chr3 {Rattus norvegicus} MDVRNCSSITEFILVGITNDPSMKVVLFVAFLLIYLIILVANIGMIVLIKLDSQLRTPMYFFLCHLSFSDICYSTAVGPKMLVDLLTKCKSISFGGCALQFFFTCIFIDA
ECVLLAVMAFDRYKAISNPLIYAVDMSSRFCYQLLAGVYILAMIDTLMHTIMTFELCFCRSNKINHFFCDLPPILLLSCSDIYVNELAMFVFSGFVELCTISGLLVSYCY
IITSVLKISSDEGRFKAFSTCASHLTAVAIFQGTLFFMYFRPSSSYSLDQDKIASLFYTLVIPMLNPIIYSLRNKDVKEALYKVRNKRLFK*
593 >lcl|NP_001000661.1|Plus1complement(12903756..12904694) NW_047657 olfactory receptor Olr584 Olr584 __SEG__ Chr3 {Rattus norvegicus} MDNGNCSSLTEFLLLGITNNPEVKVFLFIMFLVVYLTNLLTNVGMIILIRMDTQLHTPMYFFLSHLSFSDLCYSTAVGPKMLVDLLSKNRRSIPFLGCAMQFFTFCIFID
AECVLLAVMAFDRYKAISNPLMYVVDMSRKVCFQLLIGVYSVALADALIHTTLTFHLCFCGSNEINHFFCDIPPVLVLSCSDTQVNVLVIFTVFGFIELSTISGVLISYC
YIISSVLKISSAAGRIKAFSTCTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKVTSLFYTLVIPMLNPLIYSLRNKDVKDALQRIRSKMCLK*
594 >lcl|NP_001000662.1|Plus112858885..12859817 NW_047657 olfactory receptor Olr582 Olr582 __SEG__ Chr3 {Rattus norvegicus} MDKENCSSLPDFFLLGISRNPDMKRALFVVFLVVYLTILVANAGMIVLIRIDPQLHTPMYFFFSQLAFSDLCYSTAVGPKMLLDLITENNPISFVGCFLQFLLVCTFIDI
ECMLLAVMAFDRYKAISTPLLYAVDMSNRVCYQFLTGIYVLGTIDGFIHTSLAFSLCFCGSTHINQFFCDFPAVLLISCSDTQINELVLFILFGFIELSTISSVLVSYCY
IISSVLKISSAGGRFKAFSTCASHLTAVGIFQGTMLFMYFRPSSAYSLDQDKMTSVFYLLIIPMINPLIYSLRNKDVKEALVRLRKKRWF*
595 >lcl|NP_001000663.1|Plus112833560..12834498 NW_047657 olfactory receptor Olr581 Olr581 __SEG__ Chr3 {Rattus norvegicus} MDKENCSSLPEFFLLGITSNYDMKIVLFMVFLLVYLSILLENVGMITLIRMDSQLHTPMYFFLSHLSFSDLCYSTAVGPRMLVDLVAKKHSIPFIGCFLQLLFVCVFIDV
ECMLLAVMAFDRYKAISNPLLYAVDMSTKVCYQFLTLIYMASAADGLIHTTLAFSLCFCGSTEINHFFCDLPPLYLLSCSDTQTNELVVFTLFGFIELSTILSVLVSYCY
IISSVLKISSSGGRFKAFSTCASHLTAVGILQGTTLFMYFRPSSAYSLDQDKMTSVFYLLIIPMMNPLIYSLRNKDVKEALIRLRGSFNINV*
596 >lcl|NP_001000664.1|Plus112604937..12605866 NW_047657 olfactory receptor Olr569 Olr569 __SEG__ Chr3 {Rattus norvegicus} MDIGNCSLNEFIFVGVTNNPEMKGTLFTIFLLIYFINLLGNLGMIILIRMDPQLHTPMYFFLSHLSFCDLCYSTAIGPKMLVDMFGKNKSIPFWGCALQFFISCTFADSE
CVLLAVMAFDRYQAISNPLLYTVNMSSRVCSMLMAGVYLVGTSDALIHTTLAFRLCFCGSNEINHFFCDLPPLYLLSCSNTQVNELALFTVYGFLELSTISGVLVSYCYI
IASVFKIRSTEGRLKAFSTCTSHLTAVAIFQGTLLFTYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEAMEKMKNKRCF*
597 >lcl|NP_001000665.1|Plus112539765..12540709 NW_047657 olfactory receptor Olr566 Olr566 __SEG__ Chr3 {Rattus norvegicus} MKSTEIRAEDNATTVTQFLLLGFSDLPNLQGILFGMFSIIYLIILIGNSFIIVITRIDPALQKPMYFFLANFSTLEICYVSVTLPRILFNIATQDRSISVLSCATQMCFF
LMLGATECFLLAVMSYDRYVAICNPLHYPLVMNPTKCTRLAAGSWLGGIPVQIGQTCQIFSLRFCNSNQIKHFFCDLPPILKLACGDTSIHELSVYLVAMLFVAFPFTLI
LASYSKIIATILKLPTATGRAKAFSTCSSHLLVVFLFFGSATVTYLRPKSTHSPGIDKLLSLFYTIVTPMFNPLIYSLRNKEVIAALKKLLPKK*
598 >lcl|NP_001000667.1|Plus112485545..12486501 NW_047657 olfactory receptor Olr562 Olr562 __SEG__ Chr3 {Rattus norvegicus} MNHQPKPQEGNLTNLKDFVLLGFSDVPNLQWLLFGLLLAIYSFIILGNGTIVLLTKVDSALQTPMYFFLGNFSFLEICFVSITLPRMVFNLGTQRRTISFIGCATQMCCT
LILGATECFLLAVMSYDRYIAICNPLRYPLVMNQRVCSQLVIGSWISGMPVQIGQTSQIFSLSFCGSNEINHFFCDIPPILHLACGDTFINELMVFLGAALFSFFPLLLI
VFSYSKIISAVLKLASAKSRAKAFSTCSSHLAVVMLFFGSGMITYFRSNTSHSGEIDKVISLFYTVVTPMFNPMVYSLRNKDVTIALRKFLCKQFVKM*
599 >lcl|NP_001000668.1|Plus112408037..12408981 NW_047657 olfactory receptor Olr559 Olr559 __SEG__ Chr3 {Rattus norvegicus} MKHTDIREEDNASTVTQFLLLGFSDLPNLQSFLFGIFSIMYLIILIANSFIIVITTLDPALQKPMYFFLVNFSFLEICYVSVILPRILYSIWTHNRNISLLACAIQMCFF
LMLAATESILLAVMSYDRYVAICNPLHYALVMNPRKCRQLAAGSWLGGMPFQLGQTCQIFSLHFCNSNQIDHFFCDIPPVLKLACGDTSVNEMYVYVVAILLAAIPFILI
LTSYSKIIATILRLPTAEGRAKAFSTCSSHLVVVVLFFASASITYLMPKSTHSAVSDKFLSLFYTIVTPIFNPMIYCLRNKEVIAALRRLLLRT*
600 >lcl|NP_001000670.1|Plus1complement(12209225..12210163) NW_047657 olfactory receptor Olr551 Olr551 __SEG__ Chr3 {Rattus norvegicus} MDSGNHTDVKEFILLGLTDNPSWQVPLFLLFSIIYFIIFVGNWGMIFLIWLNTHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSEHKSTRVFACILQSFFFAVYVTV
EVTLLSMMAYDRYVAIVNPLMYTVIMTFSICTNMVLACYFCGLINSLTHTIGLFRLDFCGPNTVNHFFCDIPLLLKLSCSDAHINEMLLLVFSGGIAIFTFIIVMVSYIH
IIISILRISSTEGRCKAFSTCASHLTAVTLFYGSGTFSYIQPSSQYSMQQEKVSAVFYTLVIPMLNPLIYSLRNKEVKEAAKRLTCGWRNNS*
601 >lcl|NP_001000671.1|Plus1complement(11815106..11816044) NW_047657 olfactory receptor Olr537 Olr537 __SEG__ Chr3 {Rattus norvegicus} MADRNLTVITEFILLGLTEDPLLNTVLSVLFLLIYVITVAGNFWIIVIILATAQLHSPKYFFLSHLAFLDFSYSSVFLPKMLINYLVGQNSISYQGCLLQYSCVNMFLTA
ECFLLAAMAYDRYLAICSPLHYRGLMTPTFCIYLVSASYLLGCANSLTHLRSLLNLTFCGPNVIDHYFCDIPLLFQLSCSDTYASEVLFVVLSGATSITTFLIVVSSYLG
ILITVLKTNSARGSYKALSTCASHLTVVTLFYGTVISTYLGTSSSFPQDTEKILSVFYTLLLPVLNLLIYSVRNKEAKEAMRRMIKRKILSQ*
602 >lcl|NP_001000672.1|Plus1complement(11798225..11799166) NW_047657 olfactory receptor Olr535 Olr535 __SEG__ Chr3 {Rattus norvegicus} MNRLNITKEYDFILMGLTDSKEIQLVLSVLFLLIYLVTLMGNTGMMLIICLDARLHTPMYFFLTHLSFLDLCYSTVITPKTFENLFTSIKNISFIGCFIQLYFFVLFGGA
ECFLLSSMAYDRYVAICSPLHYPVVMSRRRCHALLTGSYLMGALDSSINMLCLSRVNFCGSHVINHFFCDTPAILALSCSDTYVIELIIIIVSGSTLMVSLLTISVSYAS
ILSSILKIGSTSGKRKAFSTCASHLLAVTIFYSTMIFTYLKPKRSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKNAVNRVVKKRENSRQ*
603 >lcl|NP_001000673.1|Plus1complement(11782151..11783086) NW_047657 olfactory receptor Olr533 Olr533 __SEG__ Chr3 {Rattus norvegicus} MENVTYVSLFILRGLTGNTELQIILFFLFLMIYLFTLMGNIGLIAVVIGNPQLHNPMYYFLGVLSFIDTCFSTIITPKMLIDFMSKKKVISFLGCTAQMFLAVSCGTTEC
FLLAAMAYDRYVAIYNPLLYAVSMSPRVYVSLIIASNVGGILHASIHTAATASLSFCNSNEIKHFFCDIPPLLAISCSDTKMNELLLFVFVSSIEVLTILVIIISYSFIL
FAILKMHSAEGRQKVFSTCGSHLTGVSIYYGTILFMYMRPSSSYALEHDMVVSTFYAIVIPMLNPIIYSLRNKEVKEAMKRLLGKVFMNVK*
604 >lcl|NP_001000674.1|Plus1complement(11708473..11709417) NW_047657 olfactory receptor Olr529 Olr529 __SEG__ Chr3 {Rattus norvegicus} MNTWNYTNKLDFILMGLTDSKEVQLVLSVLFLLIYMLTVLGNVGMILIIRLDVQLHTPMYFFLTHLSFLDLTYSTVITPKTLENLMTSTKNISFVGCFTQMYFFVLLAAT
ECFLLSSMAYDRYVAICSPLHYSVIMSNRFCSTLLTLSYVFGAVDSTVNMLCMGTLDFCNSNVIHDFFCDTSPLIALSCSNTHDIESIIFIFAGSTLLLSLITISASYVS
IFSTILKINSTSGKQKAFSTCASHILAVTIFYGTMIFTHLKSNKSFSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKCAIGRIIRKGEKVLNY*
605 >lcl|NP_001000675.1|Plus1complement(11653666..11654613) NW_047657 olfactory receptor Olr527 Olr527 __SEG__ Chr3 {Rattus norvegicus} MYTWNQTNKPDFILMGLTDNKEIQLVLSVLFLLIYLATVLGNTGMILIIRLDIQLHTPMYFFLTHLSFLDLSYSTAITPKTLESLLTANNTISYTDCFTQLYIFILLAAT
ECFLLSSMAYDRYIAICNPLQYPVIMSSQCCLALLTGSYVIGAVDSSVTVFGMSNLHFCKSNIIHHFYCDTSPLLSLSCSDTHVVEIIIFIFAGSTILGSLITISVSYVS
ILSTILKINSTSGKQKAFSTCASHLLGVTVFYSSLIFTYLKPSKSYSLGKDQVASIFYTIVIPMLNPLIYSLRNKEVKSAVVRLVKKRQESRKLR*
606 >lcl|NP_001000676.1|Plus111369165..11370115 NW_047657 olfactory receptor Olr518 Olr518 __SEG__ Chr3 {Rattus norvegicus} MKNVTDITMFILTGFTGDADMQALLFILVFVIYLFTLIGNLGLVLLVIGDSRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLSKDKSISYPGCVTELFLLVTFGTTEC
FLLAAMAYDRYVAIYNPLLYAVKMSPTVYIPLIIACYSGGIMHATIHTVATFSLSFCASNEIRHVFCDIPPLLAISCSNTNINQLLLFYCVGAIEIITILIVLVSYSFIL
FAILKMRSAEGRRKIFSTCGSHLTGVPIYHGTILFMYVRPSSNYALEHDMIVSTFYTIVIPMLNPIIYSLRNKDVKEAMKKIFERNLFMNKVHLKF*
607 >lcl|NP_001000677.1|Plus1complement(11109681..11110622) NW_047657 olfactory receptor Olr508 Olr508 __SEG__ Chr3 {Rattus norvegicus} MDKHNITVVTEFILMGITKNPDLQAPLFGLFLIIYLTSVTGNLGIIILTNVDSKLQTPMYFFLRHLAFTDFVYSTTVGPKMLVNFVVDQNAISYYLCATQLAFFLLFIGS
ELFILSAMSYDRYVAICKPLLYTVIMSHRVCWVLVTMTYLYCTFMSLVVTINIFSLSFCGYNIINHFFCDCIPLISLVCSNTQEVELIVMIFAAFDLISSLVVVLMSYLL
ILIAVLRMNSAAGRRKAFSTCGSHLTVVTVFYGTLIFMYVQPESSHSIDTDKISSIFYTLIIPLLNPLIYSLRNKDVKDALQRTWQKIFTIFS*
608 >lcl|NP_001000678.1|Plus1complement(11071347..11072288) NW_047657 olfactory receptor Olr507 Olr507 __SEG__ Chr3 {Rattus norvegicus} MESQNLTPVTEFILRGITDRPELQAPLFGLFLIIYLISLVGNLGMIILTIAESRLQTPMYFFLRHLAITDLGYSTAIGPKMLANFVVSKNTISFHLCATQLAFFLLFIAC
ELFILSVMSYDRYVAICNPLLYNVIMSQIMCWVLVAIPYLYSVFISLIVTINIFSSSFCGYNVIPHFYCDGLPLISLLCTNTDKIELIILILSAINLISSLLVILGSYLL
IFRAILRMNSAEGRRKAFSTCGSHLTVVIVFYGTLIFMYVQPKTSHSFDNDKVASIFYTLIIPMLNPLIYSLRNKDVKYAIRKTGKIICSNFS*
609 >lcl|NP_001000679.1|Plus1complement(11049858..11050799) NW_047657 olfactory receptor Olr505 Olr505 __SEG__ Chr3 {Rattus norvegicus} MENHNLTVVSEFILMGITDRPELQIPLFALFLIIYLISLVGNLGMIILTMVESRLQTPMYFFLRHLATTDLGYSTAVGPKMLRSFFVDQNTISLYFCAVQFAFFSMFIIS
EFFILSAMSYDRYVAICKPLLYNVIMSHRVCWVLVAIPYLYSIFVALTATINIFSSSFCGPNIINHFYCDGPPLTSLLCSNKEESETLNLILSTINLISSPLVILVSYLL
ILRAILRMNSAEGRKKAFSTCGSHLTVVIVFYGTLIFMYVQPKSSHSLNTDNAASIFYTLIIPMLNPLIYSLRNKDVKYSIRKTGKSIQNIFS*
610 >lcl|NP_001000680.1|Plus1complement(11004556..11005509) NW_047657 olfactory receptor Olr500 Olr500 __SEG__ Chr3 {Rattus norvegicus} MTISNGEIQSQTLTEFILMGITYHAELQVPLFGLFLIIYLTSLVGNLGMIILTMMDCRLQTPMYFFLRHLATTDLGYSTAVGPKMLSNFLVDQNTISFQDCAIQSAFFSM
FIVSEFFILSAMFYDHYVAICKPLLYTIIVSQKVCWILVTIPYLYSIIVSLLVNIKIFTLSFCGYNVINHFYCDALPLLSLACSNTHEIEVIILVFSAFNLLLSLLKVIG
SYLLILKAILSINSAEGKRKAFSTCGSHLTVVIVFYGTLIFMYLQPASTHSIDSNKVTSIFYTQVIPMLNPLIYSLRNKDVKDALKKTMEKVHNLVS*
611 >lcl|NP_001000681.1|Plus1complement(10941355..10942296) NW_047657 olfactory receptor Olr496 Olr496 __SEG__ Chr3 {Rattus norvegicus} MENHTFEMVTEFILLGITDRSELQAPLFGLFLSIYLTSLIGNLGMIILTIVDSRLHTPMYFFVRHLATTDLGYTTAVGPKMLQNFLVDQNTISFYLCAIQLTFFSMFIAC
EIYILSAMSYDRYVAICKPLLYMVIMSKRLCWVLIIIPYLYCSIVALLITIKIFTLSFCGSNVISHFYCDSLPLLSLVCSNTQEIEVMLLCFSAFHLIVSLLLVLVSYLL
IFIAILRMNSAEGRRKAFSTCGSHLTVVTVFYGTLIFMYMQPKSSHSFDTDKVASIFYTMVIPMLNPLIYSFRNKDVKDAFHRTRKTIHHVFF*
612 >lcl|NP_001000682.1|Plus1complement(10814238..10815197) NW_047657 olfactory receptor Olr486 Olr486 __SEG__ Chr3 {Rattus norvegicus} MGKHNVTVVTEFVLMGITDQPELQAPLFGLFLIIYLISLMGNLGMIILTTVDSRLQTPMYFFLKHLAITDLGYSTSVGPKMLVNFVVNQNTISFKLCATQLSFFLVFIVS
ELFILSAMSYDRYVAICKPLLYTVIMSQRLCWVLVAIPYLYCTFVSLLVTIKIFTLSFCGYNVISHFYCDSLPLLPLLCSDTHEVELIILILAAFDLISSLLVVLVSYLL
ILIAILRMNSAEGRRKAFSTCGSHLTVVIVFYGTLIFMYVQPNSSHSFESEKVASVFYTLVIPMLNPLIYSLRNKDVKFALKRTLNNLCKLFSLAFHKI*
613 >lcl|NP_001000683.1|Plus1complement(10764978..10765937) NW_047657 olfactory receptor Olr483 Olr483 __SEG__ Chr3 {Rattus norvegicus} MAQINCTQVTEFILMGLTDRKELKMPLFVVFLFIYLFTAIGNLGLILVIRTDARLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYRHNFISFNACAAQLGCFLTFMVS
ECLLLASMAYDRYAAICNPLLYMVTMSPGICIQLVVVPYSYSFLMALIHTLLTFRLSYCHSNIINHFYCDDMPLLRLTCSDTHYKQLSILACAGITFISSVLIVSVSYMF
IISAILRMRSAEGRRKAFSTCSSHMMAVSIFYGTLIFMYLQPSSDHSLDTDKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKLLDNKNHTSIFRELRK*
614 >lcl|NP_001000684.1|Plus1complement(10739100..10740044) NW_047657 olfactory receptor Olr481 Olr481 __SEG__ Chr3 {Rattus norvegicus} MAKGNHSSVTEFILLGLTEDPELQIILFVILLIIYLFSVMSNLGLVVLIQISPQLQSPMYFFLSHLAFVDFCYTSCVTPNALVNFLREIKSISFYGCAAQVCFFTTFSVC
EVFLLSVMAYDRYVAICNPLLYVILMPRRLCIQIAITTYIYAFVTALIQTVTTFILSFCDSNLVNQFFCEDIPLMALACSNTQVKELMLLSMAGFNVCCSLLIVLISYLF
IVSAILKKHSGEGRQKVFSTCASHLSSIAIYYGTIIFMYLQPESSHSLNTDKFAAVFYVVVIPMLNPLIYSLRNKEVKNALKKSIDKIPINISK*
615 >lcl|NP_001000685.1|Plus1complement(10730035..10730976) NW_047657 olfactory receptor Olr480 Olr480 __SEG__ Chr3 {Rattus norvegicus} MVKSNHSAVSEFVLVGLTDDPKLQVSLFGVFLVIYLTSVVGNIGLIVLIQVSPQLHTPMYFFLTHLAFIDFCFTSSVTPNTLLNFLREVKSITFYACATQLCCFVTFVVC
ELYLLSIMAYDRYVAIWNPLLYAVLMPRKLCLQVIASTYIYGFTVGLAQAVETFRLSFCGSNVVNHFYCDDVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVVISYIC
IVFAILRIHSAEGRRKAFSTCASHLTSITIFYGTVSFMYLQPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKSALKKIVEKLTLAIK*
616 >lcl|NP_001000686.1|Plus110643924..10644856 NW_047657 olfactory receptor Olr475 Olr475 __SEG__ Chr3 {Rattus norvegicus} MPNFTDVTEFLLVGLTRRQELRVLLFAVFLVVYMVTLLGNIGMIILISISPQLQSPMYFFLSHLSFVDVLFSSNVTPKMLENLLSERKTISYVGCLVQCYFFIALVHVEV
YILAVMAFDRYMAICNPLLYSSKMSTVVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNVKINHFYCADPPLIKIACGGVHIKEYTMIVIAGINFTYSLSVVLISYMLIV
VAVLRMHSADGRRKAFSTCGSHLTAVSMFYGTLIFMYLRRPTEESVEQGKMVAVFYTSVIPMLNPMIYSLRNKDVKEAVSKIIAKANLRK*
617 >lcl|NP_001000687.1|Plus110384459..10385373 NW_047657 olfactory receptor Olr456 Olr456 __SEG__ Chr3 {Rattus norvegicus} MDHNNTVSEFIMLGFTTDPVMQKVLFAVFLIVYTLTLIGNCSLIMLICNDSRLHTPMYFFIGNLSFLDLGLSSVYTPKILATCISEDKSISFAGCVTQFFFSAALDYTEC
YLLAAMAYDRYVAISKPLLYSQAMSLKLCVFFVAASYLGGFINSVIITKDTFALTFCSDNVIDDFFCDIPPLVKLACGKKDSFQSVLFFLLTSNVIIPIVFILATYLFII
ATILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEALNKLLK*
618 >lcl|NP_001000688.1|Plus1complement(9979085..9980014) NW_047657 olfactory receptor Olr436 Olr436 __SEG__ Chr3 {Rattus norvegicus} MEQSNGTRVTEFILLGFAGQHKSWHILFIIFLMIYVATLMGNIGMILLIKFDSSLHTPMYFFLQHLAFVDLCYTSAITPKMLKNFIETKASISYIGCMLQLLAYGTFATI
DCFILAAMAVDRYVAICNPLRYPIIMSQRLCILLLVGSYTMGFLNASVNTSFTFSLNFCNSNAINHFFCDEPPILALSCSSIDFSILLLTVFVGFNLMSTVLVVIFSYIY
ILAAILRMSSAAGRKKAFSTCASHLTAVTIFYGTLSYMYLHPHTNESQEQEKAASVFYGIIIPMLNPLIYSLRNQDVIEAFKKMSKKWL*
619 >lcl|NP_001000689.1|Plus11809043..1809981 NW_047561 olfactory receptor Olr34 Olr34 __SEG__ Chr1 {Rattus norvegicus} MANSTVVTEFLLDFFAETCELRILLSVLFLLVYLGSLLGNLTIIIATTVDQSLNTPMYFFLRNLSFLDIGYISVTVPNACINSLTDHRNISVAGCAAQIFVVFFCACVEI
QFLTIMSQDRYVAICKPLLYPMIMNHQFCVQMTLASLFSSLVLASVHTFKTFQLSFCHSNVVPQFFCDIPSLLRLSCSDTFNNILLLLLSAIGLSGSCFTFIAISYVRII
SAVLRVPVKGDRGKAFSTCVPHIIVVSVFLSSGAYVYLRPPSTSEMVEDMTLSLFYTIVPPFLNPIIYSLRNKQIKDAVKKVRFRFIHSCIK*
620 >lcl|NP_001000690.1|Plus1complement(1757542..1758549) NW_047561 olfactory receptor Olr32 Olr32 __SEG__ Chr1 {Rattus norvegicus} MSNVTKITGFILMGFSDVPELQTVCGLFFLVMYLAVIMSNFLIITLITLDLKLQTPMYFFLKNLSLLDVLFISVPIPNFFINSITHNNSISILGCALQVILMTSFASGDL
FVLTAMSYDRYIAICSPLHYEAIMSRSNCVLMAGVSWATGVLFGTLYTACTFSMPFCGSCVIAQFFCDVPSLLRISCSDTLVVIYTSLGIGVCLGISCFICVVISYFYIF
STVLKIRTTKGQSKAFATCLPHLTVFSVFIATACFDYLKPPSNTASIADRVFSVLYIVLPPSLNPVIYSLRNTDIKGALRRLQQNLCPRRLLHLTVQSICPRYSGSHFTN
KFYNY*
621 >lcl|NP_001000691.1|Plus1complement(1705730..1706737) NW_047561 olfactory receptor Olr29 Olr29 __SEG__ Chr1 {Rattus norvegicus} MPNVTRITGFILMGFSDVPELQTVCGLFFLVMYLAVIMSNFLIITLITLDLKLQTPMYFFLKNLSLLDVFLISVPIPNFFINSITHNNSISILGCALQLFLMTSFTSGEV
FVLTAMSYDRYIAICSPLHYEAIMSSGNCVLMVGVSWATGVLFGTLYTAGTFSMPFCGSHVIPQFFCDVSSLLRISCSNSLVVIYTSLGIGFCLGMFCFICVVISYFYIF
STVLKIRTTKGQSKAFATCLPHLTVFSVFIATACFVYLKPPSNTASIADRVFSVLYIVLPPSLNPVIYSLRNTDIKCALKSLQQNLCPRGLLHLTVQSICPWCSSSHFIN
KFYNY*
622 >lcl|NP_001000692.1|Plus11626225..1627217 NW_047561 olfactory receptor Olr25 Olr25 __SEG__ Chr1 {Rattus norvegicus} MVNSTLVTEFLLEFFAETWEPRILLSMLFLLVYIGSLLGNLIIIIATTVDHTLNTPMYFFLRNLSILDMGYVSVTVPNACINSLTDHRNISVAGCAAQVFLFFFCACIEI
QFLTIMSQDRYVAICKPLLYAVIMNHQFCVQMTLASLFISLVLASVHTFKTFQLSFCHSNVVPQFFCDIPSLLRLSCSDTFSNKLLLFLTAFGLSGTCFAFIAISYVRIL
SAVLKVPVKRERGKAFSTCVPHIIVVSMFFSSAAYVYLRPPVVTFEVVKEMTLSVFYTIVPPFLNPIIYSLRNKQIKEAVKKVILRISFIFKYKRNEYLSEFSRGRKLTK
*
623 >lcl|NP_001000693.1|Plus1complement(1596475..1597416) NW_047561 olfactory receptor Olr24 Olr24 __SEG__ Chr1 {Rattus norvegicus} MPNVTKITSFILMGFSDVSELQTVCGLFFLVMYLAVIMSNFLIITLVTLDLKLKTPMYFFLKNLSLLDIFFISVSIPNFFINSITHTNSISILGCALQVFLMTTFTSGEG
CILTAMSYDRYIAICSPLHYETIMCSGNCVLMVGVSWSTGVLLGVLYTAGIFSMPFCGSRVIPQFFCDIPSLLKISCSDKLLVIYISLGIGFCLGMSFFICVVISYCYIF
STVLKIPTTKGQSKAFATCLPHIIVFSTFIATACFVYLKPSSEEPSASDRLFSVLHTVLPPALNPVIYSLRNTDIKCALRRLQNNLFPRSSLT*
624 >lcl|NP_001000694.1|Plus1complement(1321704..1322654) NW_047561 olfactory receptor Olr16 Olr16 __SEG__ Chr1 {Rattus norvegicus} MTNNTRITEVILMGFSDVLELQTVCGLLFLVMYLAVIMSNFLIITLITLDLKLKSPMYFFLKNLSLFDILLVSTPIPKFIINSLTHNNYISIVGCAFQILLMTSFSAGEI
FVLTAMSYDRYVAICCPLHYEVIMSSGNCVLMVGVSWATGVLFGAMYTCSTFSMHFCSSIVIPQFFCDIPSLLRISCSGSLMIIYISLGIGMCLCMSCFLCVVMSYFYII
STVLKIPTTKGQSKAFATCIPHLTVFTVFVATACFVYLKRPSDVPSITDRLFSVIYTLLPPALNPVVYSLRNSKVKCSLRRLQQNLCPRDSYYLTV*
625 >lcl|NP_001000695.1|Plus1complement(1279297..1280238) NW_047561 olfactory receptor Olr14 Olr14 __SEG__ Chr1 {Rattus norvegicus} MPNITALTGFILTGFSDTQELQTLCGVFFLGMYMEAVMSNLIIITLITLDLHLQTPMYFFLKNLSLLDIFFVSVPIPNFIVNSLIHSNSISIQGCAFQVFLMTSFSSGEV
FVLTSMSYDRYVAICFPLNYDAIMNNHICVLMVCISWATGILFGALYTAGTFSMPFCGSNVIPQFFCDVPSLLRISCSETLVVIYTSLGIGFCLGVSCFICVVISYFYIF
STVLRIPTSKGQSKVFATCIPHLTVFTVFLFTACFVYLKPFSNAPSISDRLFSVLYTVLPPALNPLIYSLRNSDVKSALRKFQQNLSLRRLLI*
626 >lcl|NP_001000697.1|Plus1complement(8221995..8222942) NW_047773 olfactory receptor Olr1067 Olr1067 __SEG__ Chr7 {Rattus norvegicus} MKLQQSSNDTELTDFILLGFWTSSEARVPLFLLFLLIYLVIVLGNISMLTVIKIDSRLHTPMYFFLQNLSFLDLCYSTVIAPKTLATFLSKEKKISYNECATQFFFFALF
VGTEGFFLAVMAYDRFSAICSPFLYPVHMSQPACIRLVAGSYICGCINSMVQTGFTFSLRFCGENRLDHFFCDVPALIKISCVDTFVNEIVLFSLSALIIISTITIILVS
YAYILSTVLKIPSSHGRSKTFSTCGSHIAVVSLFYGTVFFMYAQPGSISSPEKSKIVAVFYTLIIPMLNPLIYSLRNTEVKNALKKILLRKLLWH*
627 >lcl|NP_001000698.1|Plus1complement(7997688..7998644) NW_047773 olfactory receptor Olr1060 Olr1060 __SEG__ Chr7 {Rattus norvegicus} MKNQSEEIVFILLGLTGDPQLQILIFLFLFFNYILSLMGNLVIIFLTLLDPHLKTPMYFFLRNFSFLEIAFTTVCIPRFLMSILLGEKMILYNACVAQLFFFFLLGATEF
YLLAAMSYDRYVAICRPLHYPIIMNSKVCHLLVLSSWVIGFLVIFPPLLLGLKLDFCASKIVDHFFCDTSVLQLSCTDTRLIELLAFALAVMTLIITLILVILSYILIIK
TILKFPSAQQRKKAFSTCASHMVVVSITYGSCIFMYMKTSAKERVTLNKGIAVLNTSVAPLLNPLIYTLRNQQVKDAFKYVFHRFYSFKNHQTRFRHK*
628 >lcl|NP_001000699.1|Plus16799208..6800152 NW_047773 olfactory receptor Olr1014 Olr1014 __SEG__ Chr7 {Rattus norvegicus} MRNSTAVTNFILLGLTNDPRWQFVVFTFLLVTYLLSLTGNLIIIILTLSDVHLMTPMYFFLRNFSLLEISFTSVCIPRFLVTIVTGDRTISYNGCVAQLFFFIFLGVTEF
YLLAAMSYDRYVAICKPLHYTTIMSNRVCILLVFSSWFAGFLIIFPPIILLLQLDFCASNIIDHFICDSSPILQLSCSNSHFLELMAFLLAVITLMVTLTLIILSYTNII
RTILRIPSTNQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFKTMIQRILFSLKKFT*
629 >lcl|NP_001000700.1|Plus16358951..6359886 NW_047773 olfactory receptor Olr996 Olr996 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTIFILLGLTDDPQLKTLIFTFLFLTYVVSMTGNLMIISLTYIDSYLKTAMYFFLQNFSFLEISFTTACIPRYLYNISTGDKTITYNNCAIQIFCTDIFGVTEFF
LLAIMSFDRYVAICKPLHYITIMSSRICTRLILCCWAAGLFVILPPLSLGLNLEFCDSNVIDHFVCDAYPLLKFSCTETWLIEQIVIVCAVLTFVMTLLCVVLSYVYIIK
TILRFPSAQQRKRAFSTCSSHMIVVSITYGSCIFIYVKPSAKDSVAINKGVMVLTTFIAPMLNPFIYTLRNKQVRQAFNDSVKRIALFFKK*
630 >lcl|NP_001000702.1|Plus1complement(5825103..5826038) NW_047773 olfactory receptor Olr982 Olr982 __SEG__ Chr7 {Rattus norvegicus} MKNRTSVTEFILLGLTKDPKLNIVIFIFLFLTYILSITGNLTIITLTLVDSHLKTPMYFFLRNFSFLEIAFTTVSIPRFLVSIVTGDMTISFNSCLAQEFFFILLGATEF
FLLTAMAYDRYVAICKPLHYATIMSNRVCMQLIVGSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPLLLISCTDTAFLELFAFFLAVFTLIVTLALVILSYSFIL
RTILRIPSAEQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVTLTKSIAVLNTSVAPMLNPFIYSLRNKQVKESFKNLIKRCISNKM*
631 >lcl|NP_001000703.1|Plus14932740..4933693 NW_047773 olfactory receptor Olr954 Olr954 __SEG__ Chr7 {Rattus norvegicus} MKNNTITTFLLLGLTDDPQLQIPIFVFLFVAYMLSITGNLTIIALTILDCHLKKPMYFFLKNFSMLEISFTSACIPQYLYNIATGDRSITYDVCVTQVFFIDVFGVNEFF
LLAIMSYDRYVAICKPLHYVTIMNSKVCQTLNLCCWMAGLLIILPPLTLLLNLKFCDSNVIDYFFCDASPILKISCSDTWLIEQLVIVCAVLTFILTLVCVTLSYVHIIK
TILRFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYINPSAKESVAINKGVAVLMSSIAPMLNPFIYTLRNKQVREAFSDSIKKITMISMKKENVQI*
632 >lcl|NP_001000704.1|Plus14367041..4367979 NW_047773 olfactory receptor Olr931 Olr931 __SEG__ Chr7 {Rattus norvegicus} MKNHTRQIEFILLGLTDNPQLQIVIFVSLLLNYFLSMIGNLTIIALTLLDPLLKTPMYFFLRNFSFLEILFTTTCIPRFLITTVTQEKTISYNGCICQLFFYIFLGGTEF
FLLATMSYDHYIAICKPLHYASIMSSKVCHQLVLGSWVTGFLVIFTPLIIGLDLDFCASNVIDHFLCDVSPVLQLSCSDTNLLEVTAFILALMTLIVTLVIVILSYPHIV
KTITKFPSVQQKKKGFPTCSSHMIVVSLTYGSCIFIYIKPSANERVTLSKGIAVFNISVAPLLNPFIYTLRNKQVKQAFGAMFRKIFSASQR*
633 >lcl|NP_001000705.1|Plus1complement(4112930..4113874) NW_047773 olfactory receptor Olr922 Olr922 __SEG__ Chr7 {Rattus norvegicus} MKNQSMEFHFILLGLTDDPRLQIVVFLFLFLNYMMSLVGNLVIVFLTLLDPRLKTPMYFFLRNFSLLEIMFTTVCIPRFLTTIVTGDKTISYNNCASQLFFILLLGVTEF
YLLAAMSYDRYVAICRPLHYPIIMNNRVCYQLVLSSWVTGFLVIFPPLAMGLELDFCDSRIIDHFMCETSPILQISCTDTHVLEMMSFVLAVVTLVVTLVLVSLSYSFII
KTIMNFPSAQQRTKAFSTCTSHMIVVSISYGSCIFMYIKPSARERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFWDILQKTLSFSKHKV*
634 >lcl|NP_001000706.1|Plus1complement(3631972..3632910) NW_047773 olfactory receptor Olr906 Olr906 __SEG__ Chr7 {Rattus norvegicus} MKNHSMINEFVLLGISDTPEVQVVIFIFLFIAYILSVTGNLTIITLTLLDSQLKTPMYFFLRNFSFLEIIFTSVSIPRFLEAIITKVKTISYNNCLTQLFFFISMGVSEF
FLLTAMSYDRYVAICKPLHYTLIMNQKVCTLLVLTSWMGGFLTIFPLLMLFLKLDFCASNIIDHFCCDYFPILQLSCSDTWLLETIGFYFAFVTLLFTLALVILSYICII
STILRFPSASQRKKAFSTCSSHMIVISISYGSCIFMYVKPSANERASLTKGVALLNTSIAPMLNPFIYTLRNQQVKQAFKELINKLVLIGKK*
635 >lcl|NP_001000707.1|Plus1complement(2336760..2337698) NW_047773 olfactory receptor Olr877 Olr877 __SEG__ Chr7 {Rattus norvegicus} MLAVKNQTSTEFILLGLTDSPDLQICVFLFLLLTYILSVLGNLTIIVLTLLDSHLQTPMYFFLRNFSFLEISFTSTFTPRMLFSISTGIKTISFAGCFTQYFFAIFFGAT
EFYLLTAMSYDRYVAICKPLHYSTIMSNRVCTLLVLCSWMSGLLIILFPIILTSQLDFCASNVLNHYYCDYGPLIEIACSDTRLLELFDFVLAVLTLIVTLVLVILSYTR
IIRTILKIPSAHQRKKAFSTCSSHMVVISLSYGSCISMYIKPSVTEGVAFNKGIAVLNTSVAPLLNPFIYTLRNKQVKQSFKDITRKIVNLQ*
636 >lcl|NP_001000709.1|Plus112276097..12277029 NW_047773 olfactory receptor Olr1084 Olr1084 __SEG__ Chr7 {Rattus norvegicus} METGNNTRRISSFFLLGFSENPHLQLLIFALFLSMYMVTVFGNLLIIMAIITQSHLHSPMYFFLANLSFVDICFTSTTIPKMLVNIHTQSKTITYVHCISQMCVFLVFGE
LDNFLLAVMAYDRYVAICHPLYYTVIVNHRLCILLLLLSWDVSILHALLQSLMVLQLTFCGDVKIPHFFCELNQLSQLTCSDNFPSHLIMNLIPVMLGAISLSGILYSYF
KIVSSIRSISSVQGKHKAFSTCASHLSIVSLFYSTGIGVYISSAVVQSSHFAARVSVMYTVIIPMLNPFIYSLRNKDVKRALERLLEGKL*
637 >lcl|NP_001000710.1|Plus1complement(12227724..12228656) NW_047773 olfactory receptor Olr1083 Olr1083 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFFLLGFSENPHLQFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLVNLSFVDICFTSTTIPKMLVNIHTQSKTITYVHCISQMCVFLVFAE
LDNFLLAVMAYDRYVAICHPLYYTVIVNHRLCILLLLLSWVVSIFHAFLQSLIVLQLTFCGDVEIPHFFCELNQLSQLTCSDNFPSHLIMNLVPVMLAAISFSGILYSYF
KIVSSIRSVSSVKGKYKAFSTCASHLSIVSLFYSTGLGVYVSSAVVQSSHSAASASVMYTVVTPMLNPFIYSLRNKDVKRALERLLEGKL*
638 >lcl|NP_001000711.1|Plus1complement(12127746..12128678) NW_047773 olfactory receptor Olr1079 Olr1079 __SEG__ Chr7 {Rattus norvegicus} MESGNSTRRFSSFFLLGFSENPHLQFLIFALFLSMYLVTVLGNLLIIMAIITQSHLHTPMYFFLANLSFADICFTSTTIPKMLVNIHTQSNTITYEDCISQMFVLLVFGE
LDNFLLAVMAYDRYVAICHPLYYTVIVNHRLCILLLLLSWVVSILHAFLQSLIVLQLTFCGDVKIPHFFCELNQLSQLTCSDNFPSHLTMHLVPVILAAISLSGILYSYF
KIVSSIRSMSSVQGKYKAFSTCASHLSIVSLFYSTGLGVYVSSAVIRSSHSSASASVMYTVVTPMLNPFLYSLRNKDVKRALERLLEGKL*
639 >lcl|NP_001000712.1|Plus1complement(12063524..12064480) NW_047773 olfactory receptor Olr1076 Olr1076 __SEG__ Chr7 {Rattus norvegicus} MEPGNDTQLSEFFLLGFSEKQPEIQPLIFGLFLSMYLVTVTGNLLIIMAIIVDAHLHTPMYIFLSNLSFVDICFTSITVPQMLVNIHTQSKVIIYANCITQVYFLLLFSV
LDIFLLTVMAYDRYVAICHPLHYMIIMNTRRCGLLILACWIISVINSLLHTFLVLRLSFCTDLEIPHFYCELNQIVHHACSDISLNDMVIYIAALLLVVGPLSGILYSYS
KIVSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAHATAMASLMYTVVTPMLNPFIYSLRNNDMKKALKIVLGRVTRNRSMDLA*
640 >lcl|NP_001000725.1|Plus15060507..5061460 NW_047355 olfactory receptor Olr1558 Olr1558 __SEG__ Chr11 {Rattus norvegicus} MMKANHSLTIEFILIGFTDHPDLKTLLFLVFSAIYLVTMVGNLGLVALIYMEPRFHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISFCECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICNPLQYHTMMSKKLSLQMSMGIFIASNLHSLIHTGCLLRLNFCKSTKIDHFFCDILPLYRLSCTNPFINELMIYIFSMPIQVFTITTILVSYFC
ILFTIFKMKSKDGRGKAFSTCASHFFSVSIFYTCLLMYIGPSEDGSKDIPVAVFYTVIIPLLNPFIYSLRNKEVVNAVKKVMKTYSIFKNASASIVH*
641 >lcl|NP_001000726.1|Plus1complement(4961959..4962888) NW_047355 olfactory receptor Olr1555 Olr1555 __SEG__ Chr11 {Rattus norvegicus} MEKKNETLWSEFILTGLTCQPQWKTPLFLMFLVIYLMTIVGNLGLITLIWNDPHLHIPMYLFLSNLAFVDTWLSSTVTPKMLFNLLDKGKVISIAECMTQFFSFAISVTT
ECFLLAAMAYDRYAAICNPLLYPVVMTNRLCIRLLALSFLGGFLHAVIHESFLSRLTFCNSNILYHFYCDVIPLLKISCTDPSLNYLMIFIFSGSIQVFTIMIVLMSYTF
VLFTILKKKSDKGVRKALSTCGAHLLSVSLYYGPLLFMYVLPASSEVDAQDMILSLFYTVIVPVLNPMIYSLRNKQVIDSLKKMLKIMG*
642 >lcl|NP_001000727.1|Plus14888629..4889558 NW_047355 olfactory receptor Olr1551 Olr1551 __SEG__ Chr11 {Rattus norvegicus} MERENTTLLTEFVLTGLTDHQGLQVPLFLLFLAIYLITIVGNLGLIALIWTDPHLHIPMYFFLGSLAFVDAWISSTVTPNMLFDLLSTNKMISLSECMIQFFAFAFGGTT
ECFLLGTMAYDRYVAICKPLLYPVIMTNRLCIRLLVSVFVGGFLHSLFHVLFLFRLTFCNSNIIHHFYCDIIPLYNISCTDPTLNLLLVFILSGSIQVVTIMTVLVSYTL
VLFTILKMKSLQGIRKAFSTCGAHLLSVSLYYGPLLFMYVLPASQQTDEQGMMDSLFYTVIIPVLNPIIYSLRNKQVTDSLKKRLERHI*
643 >lcl|NP_001000728.1|Plus14708238..4709167 NW_047355 olfactory receptor Olr1541 Olr1541 __SEG__ Chr11 {Rattus norvegicus} MGIENATLLTEFVLTGLSHLPQWKIPLFLLFLVIYLITVVGNLGLITLIWNDPHLHIPMYLFLASLAFVDTWLSSTVTPKMLLDFFTKSKLISFSECMIQFFSFGISGTT
ECFLLAAMAYDRYVAICKPLLYPVIMTNRLCVRLLTMSFIGGFIHTFIHAVFLFRLTFCDSNIIYHFYCDIMPLLKISCSDPSLNYLMIFIFSGSIQVFSILTILISYTL
VLFSILKQKSIKGIKKALSTCGAHLLSVSLYYGSLLFMYLRPASPHVDDQDMMDSVFYTVLIPVLNPIIYSLRNKQVKKSLEKFLKRNT*
644 >lcl|NP_001000729.1|Plus14676075..4676995 NW_047355 olfactory receptor Olr1539 Olr1539 __SEG__ Chr11 {Rattus norvegicus} MTGENQTVVAEFVLMGLTESPELQIPLFLIFFIIYLITMVGNLGLIALIWKDPHLHTPMYLLLGSLAFADACASSSVTPKMLVNILSKDHKILLVECFTQFYFFGSSATT
ECFLLSVMAYDRYVAICNPLLYPVMMSNSLCMHFIHVSYTVGFLHSAIHVGLLVRLHFCKSNIIDYFYCEILQLFKISCTDASVNVLLVLIFSAFIQGFTFMTIIVSYFS
VLFAILKTKSEKGRSKAFSTCSAHLLSVSLFYGTLFLMYVRPGSGSGEHKDRMYSLFYTIIIPFLNPFIYSLRNKEVTAALRRKMK*
645 >lcl|NP_001000730.1|Plus1complement(8742012..8742956) NW_047562 olfactory receptor Olr278 Olr278 __SEG__ Chr1 {Rattus norvegicus} MAFLENGNYTALTEFILLGLTNDPVLRVILFIIILCIYLVTVSGNFSTILLIRVSSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVERNTISYLGCGIQLGSAVFF
GTVECLLLAAMAYDRFIAICSPLLYSNKMSTQVCVQLLIGSYIGGFLDASSFTLSFFSLLFCGPNRVNHFFCDFAPLVKLSCSDVSVPAVVPSFTAGSIIMMTMLVIAVS
YIYILITILKMRSTEGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVVPMLNPIIYSLRNKEIKGAMKRQFGKNTFS*
646 >lcl|NP_001000732.1|Plus18622079..8623023 NW_047562 olfactory receptor Olr271 Olr271 __SEG__ Chr1 {Rattus norvegicus} MAFLEDGNHTAVTEFILLGLTDDPVLRVVLFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASADIGYSSSVTPNMLVNFLVEKNTISYLGCGIQLGSGAFF
GGVECFVLAAMAYDRFVAICSPLLYPTKMSTQVCVQLLVVAYISGFLNASSFTFSFFSFFFCGPNKINHFFCDFTPLVELSCSEDSVSIILATITVGIIILITVIVIAVS
YIYILITILKMHSTEGRQKAFSTCTSHLTAVTLFYGTITFIYVTPKSNYSTDQNKVLSVFYMVVIPMLNPLIYSLRSNEIKGALKRQLGRKRFS*
647 >lcl|NP_001000733.1|Plus18569074..8570018 NW_047562 olfactory receptor Olr268 Olr268 __SEG__ Chr1 {Rattus norvegicus} MAFQEDGNHTTVTEFILLGLTDDPVLRVVLFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLGSADIGYSSSVTPNMLVSFLVKKNTITTLGCGIQLGSGAFF
GTVECFVLAAMAYDRFVAICSPLLYSTKMSTQVCVQLLVVAYISGFLNASSFTLSFFSFFFCGPNRINHFFCDFTPLVELSCSEDSVFIILVTISSGTVIVITVLIIAVS
YIYILITILKMRSTGSRHKAFSTCTSHLTAVTLFYGTVTLIYLMPKSSYSTDQNKVVSVFYIVVIPMLNPLIYSLRNNEIKDALKRHIGRKTCS*
648 >lcl|NP_001000734.1|Plus17929242..7930174 NW_047562 olfactory receptor Olr241 Olr241 __SEG__ Chr1 {Rattus norvegicus} MEAENHTTVAELVILGLTEDPKLCIVFFVIFLGVYIVTLVGNISIITLIRISSQLQTPMYLFLSHLAFVDILYSTSVSVIMLMELLGHGLVLPVTACAAQLCITVSFGSA
ECFLLAAMAYDRYVAICSPLLYSTLMSSRVCFLLLGMSYVGGCTNGWTFTGCLLNLSFCGPNQIDHFFCDFSPLLKLSCSDVSIIGIIPSISSGSIIVVTILVIAVSYIY
ILITILKMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSNYSTEQNKVLSVFYTVVIPMLNPLIYSLRNRDVKEALRKATVRVYT*
649 >lcl|NP_001000735.1|Plus1complement(6636361..6637287) NW_047562 olfactory receptor Olr213 Olr213 __SEG__ Chr1 {Rattus norvegicus} MGGRNQTYVVEFILLGLSENPKVQILLFCIFLVIYFLSVFGNLLIIILIHIDSRLHTPMYFFLKNLSFADLCFSTSIVPQMLVHFLSKKKTISFIGCSIQIVVFLLAGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTQRLCFQLAVVSWISGALACSVDSAFTLYIPYRGQNVINHYFCEPPALLKLASADTHNVEMALFLVGVIMLLGPLSLILVSYGN
IISTVIRMQSKERRLKVFSTCGSHLIVVVFYYGSGIFAYMRPNSKTMSEKDKVVSVFYSVMTSMLNPIIYSLRNKDVKGALRKLVGRL*
650 >lcl|NP_001000736.1|Plus1complement(6557350..6558300) NW_047562 olfactory receptor Olr209 Olr209 __SEG__ Chr1 {Rattus norvegicus} MEWWNSTLGGSFILVGILDDSGSPEMLCAVITALYMLALASNGLLLLVINMDRQLHIPMYHLLGQLSLIDFFLTSIIIPKAVMDFLLKDNTISLEGCALQMFLALTLGGA
EDLLLAFMAYDRYVAICHPLNYMVFMRPSICWLGVATSWILGFLSALGHTIHTMQYPFCKSRKIRHLYCEIPPLLKLACADTSKYELMVYMMGVTFLIPSLVAILTSYIL
ILFTVLNKPSNEGRKKALATCSSHLTVVSLYYGALTVMYVLPSSYLSPKQENILSVFYTVMTPALNPLIYSLRNKDVTGALRRVLGKWFLPTRSIF*
651 >lcl|NP_001000737.1|Plus15002013..5002978 NW_047562 olfactory receptor Olr164 Olr164 __SEG__ Chr1 {Rattus norvegicus} MSLLNVSSLTPASLILNGIPGLEEVNLCIFFPLFTMYSIALTGNFGLIYLIYSEEVLHRPMYIFLALLSFTDVLMCTSTIPNTLFISWFNFKKIDFKACLAQMFFVHTFT
GMESGVLVLMVLDLYIAMCYPLRYATILTNVVIAKAGMLTFLRGVALVIPFIFLTKRFPYCKGNVIPHTYCDHISVAKISCGNVQINAIYGLMVVLLIGDFDIPCITVSY
TMILWAAVSLSSADARQKAFSTCTAHICAIVITYVPAFFTFFTHRFGWHTIPSHIHIIMANLYLLMPPTMNPIVYGVKTKQIQKRVIRFFFKGRENSSHKF*
652 >lcl|NP_001000738.1|Plus14919254..4920222 NW_047562 olfactory receptor Olr160 Olr160 __SEG__ Chr1 {Rattus norvegicus} MQLLNQTEVTLASFFLTGTPDLEDMHIWISIPFCSMYAIAVVGNCGLLYLIFFEDTLHRSMYYFLAMLSLTDLVMCSASIPKTLCIFWFHLKEISFIDCLVQMFFIHTFT
AMESGVLMLMALDRYVAICYPLHYSTILTNPIIVKAGLATFLRAVVLIIPLIFITKQLPFCRSSILIHHTYCDQLSVAKVSCGNIKVNIVYGLMIALFIGGFDILCITVS
YTMILRAVVSLSSADARQKAFSTCTAHICAIIFSYSPAFFCFFSHRFGGHTIPPSCLIIVANLYLLLPPTMNPVVYGVKTKQIRDCVIRILSGSKDSKAPSI*
653 >lcl|NP_001000739.1|Plus1complement(4641796..4642728) NW_047562 olfactory receptor Olr150 Olr150 __SEG__ Chr1 {Rattus norvegicus} MYNMSSYSTGPFTLSGIPGLEQYHVWISIPFCFIYLVAILGNSILLYLIAVERSLHSPMFFFLSMLAMTDLILSTTCVPKTLSIFWFGPQEISFPGCLTQLFFLHYSFVL
DSAILLAMAFDRYVAICSPLRYTTILTPKATVKIAVGISFRSFCVFVPCVFLVNRLPFCRTHVIAHTYCEHIGVARLACADISINIWYGFCVPIMTVIIDVVLIAISYTL
ILHAVFRLPSRDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGRNVPRTFHIMFANLYVIIPPALNPMVYGVKTKQIRDKAVLLLFPK*
654 >lcl|NP_001000740.1|Plus1complement(4116063..4117022) NW_047562 olfactory receptor Olr125 Olr125 __SEG__ Chr1 {Rattus norvegicus} MATSNSSTIVSSTFYLTGIPGYEEFHHWISIPFCFLYLIGITGNCMILHIVRTDPRLHEPMYYFLAMLSLTDMAMSLPTMISLFRVLWSISREIQFNICVVQMFLIHTFS
FTESSVLLAMALDRYVAICHPLRYATILTPKLIAKIGTAALLRSSILIIPLVARLAFFPFCGSHVLSHSYCLHQDMIRLACADIRFNVIYGLVLITLLWGMDSLGIFVSY
VLILQSVLKIASREGRLKALNTCASHICAVLILYVPMIGLSIVHRFAKHSSPLIHIFMAHIYLLVPPVLNPIIYSVKTKQIRQGILHLICSPKINSITM*
655 >lcl|NP_001000742.1|Plus13928198..3929145 NW_047562 olfactory receptor Olr111 Olr111 __SEG__ Chr1 {Rattus norvegicus} MIMSSNHTNLRDIWYTMIGIPGLEDIHLWLSIPICSMYIVALIGNTLLILLIFTEHSLHEPMYLFLSMLALADIILSTVTTPKVLAIFWFQAGGISFASCVSQMFFLHFM
FVTESAILLTMAFDRYVAICYPLRYTTILTPSVICRIGIVSVSRSFFICFPLVFLVYRLTYCGRSIIHHSYCEHMGIARLACDSIKVNIYYGMTVPLFSIGLDIVLIIIS
YTLILHTVFRIPSQSAQLKALGTCGSHVCVILLFYTPSLFTFFAHRFGGHSIPRHMHILFANLYVVVPPTLNPIIYGVKTKQIQDRFFQMFSCIH*
656 >lcl|NP_001000743.1|Plus13896008..3896973 NW_047562 olfactory receptor Olr110 Olr110 __SEG__ Chr1 {Rattus norvegicus} MTTPSTILNYTNVRDIWYTMIGIPGLEESHIWISIPICSMYIVAIAGNALLLFLIITERSLHEPMYLFLSMLALADIFLSTVTTPKMLAIFWFQAAGISFASCVSQMFFL
HFIFVAESAILLAMAFDRYVAICYPLRYTTILTPSVIIKMGIASVIRSFFICFPLIFLVYRLTYCGKNIIRHSYCEHMGIARLACDSIKVNIYYGVIVALFSTCLDVVLI
IVSYALILCSVFRIPSRDARLKALGTCGSHVCVILLFYTPAFFSFFAHRFGGHSIPLHVHILLANLYVVVPPSVNPIIYGVKTKQIQERVIQVFSLGKSFC*
657 >lcl|NP_001000744.1|Plus13785409..3786359 NW_047562 olfactory receptor Olr101 Olr101 __SEG__ Chr1 {Rattus norvegicus} MVNNTTHHYISYFYLVGIPGLEKFHSLISIPVCLLFVLTLLGNSIVIATIKVEPSLHQPMYFFLGMLGMNDIFLTCSTSLKMLDIFWFNEHWIEFDVCLTQMYFIHMFCA
FESAILVAMAFDRFVAICIPLHYSTILTTTMVIKLGVVGLSRAVLIVFPCPLLIKRLPYYTSYIIPHAYCEHMAVVKLASANTLINRAYGISAAFAVTILDIWLIATSYI
KILQAVFRLSSQNARSKALGTCAAHICTILAFYTPALFSFLTHRIGKNVSPSVHIILASLYLLVPPTVNPLVYGVKTKQIRDRVLSLFSHLKTTEG*
658 >lcl|NP_001000745.1|Plus13649803..3650753 NW_047562 olfactory receptor Olr89 Olr89 __SEG__ Chr1 {Rattus norvegicus} MLNPNNMTYLNPGTVILIGIPGLEHVQFWIGFPFFTVCLVAVLGNVVLLIIIPAERSLHQPMYIFLAVLAATDIGLCAAIAPKMLAIFWFQAYSMVFDACLAQLFFIHTL
QCMESGILLAMAFDRYIAICDPLRHTSILTPSILGRMIVVVVVRAVVLVGLLPLLIKRLHHFQSIHIAHSYCEHMAVVKLAADDVRINKICGLFVGFSILGFDMVFILIS
YALIFQAVFRLQQKEARLKAFNTCTAHIFVFLEFYILAFFSFFSHRLGHVVPSTHILLSTIYLLLPPALNPIVYGVKNMVIRKRVAQMFLLDRGRQ*
659 >lcl|NP_001000746.1|Plus13641953..3642900 NW_047562 olfactory receptor Olr88 Olr88 __SEG__ Chr1 {Rattus norvegicus} MNHNNVTYLNPGTVILIGIPGLEHVQFWIGFPFFTVCLVAVLGNVVLLIIIPAERSLHQPMYIFLAVLAATDIGLCAAIAPKMLAIFWFRAYSMVFDACLAQLFFIHTLQ
CMESGILLAMAFDRYIAICDPLRHTSILTPSILGRMIVVVVVRAVVLVGLLPLLIKRLHHFQSIHIAHSYCEHMAVVKLAADDVRINKICGLFVGFSILGFDMVFILISY
ALIFQAVFRLQQKEARLKAFNTCTAHIFVFLEFYILAFFSFFSHRFGHVVPSTHILLSTIYLLLPPALNPIVYGVKNMVIRKRVAQIFLLNQGCQ*
660 >lcl|NP_001000747.1|Plus13616977..3617915 NW_047562 olfactory receptor Olr86 Olr86 __SEG__ Chr1 {Rattus norvegicus} MVPPNHTQFHPYFFLLLGIPGLEDVHIWIGFPFFIVYLTALLGNITIISVIQTERSLHQPMFYFLSLLSSIDLGLSTSTIPKMLGIFWLNFKKISFDGCVIQMFFIHLFT
GMESAVLLAMAYDRYVAICNPLHYTMVLTNKVVFINAWLVLLRPLVIAIPFIVLILRLPFCGHQVIPHTYCEHMGIARLSCASIKVNIIYGLCAISNLFLDIVAIILSYV
QILHAVFRLPSRDARLKALSTCGSHVCVMLSFYTPAFFSFMTHRFGRNIPRYIHILLANLYVVIPPALNPVIYGVRTKQIRERVVMTIRNKL*
661 >lcl|NP_001000748.1|Plus13235880..3236842 NW_047562 olfactory receptor Olr60 Olr60 __SEG__ Chr1 {Rattus norvegicus} MISSQAFINISFFQPQSFLMIGIPGLEAVHGWISIPFSFMYTVALTGNCLILLAVRRTHSLHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRFIGFNACLIQMFFL
HSFSVLESSVLLAMSFDRFVAISNPLRYASVLTNTVIIRIGVAIVARATLSLFPVPFLLKRLNYCPGKILLSHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSSL
IVMSYSLILYTVMGLASPRERVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYSVKSKPIRGAMFRVLRGKDQT*
662 >lcl|NP_001000749.1|Plus1complement(3190467..3191411) NW_047562 olfactory receptor Olr57 Olr57 __SEG__ Chr1 {Rattus norvegicus} MPYFNQSTAYPPVFFLTGIPGLETSHTWLSIPFCCLYAIAISGNSMILFIIITESSLHEPMYYFLSMLSFTDLGLCLSTLVTVLGIFWFNVREISFDACIGQMFFIHGFT
FMESSVLLVMAFDRFIAICNPLRYAMILTNSRITVVGFAIIIRGTTALVPLLLLLKRLSFCRSHVLHHSYCFHPDVMKLSCSDTRVNSAFGLAIVISTAGLDSVLILLSY
VLIIHSVLCIASKEERKKAFSTCVSHLSAVAIFYIPMISLSLVHRFGKHAPPFVHTLIANVYLLIPPVMNPIIYSVKTKQIRKAMLKVFFVKSS*
663 >lcl|NP_001000750.1|Plus17950051..7951052 NW_047817 olfactory receptor Olr1353 Olr1353 __SEG__ Chr9 {Rattus norvegicus} MATAVHRNGNLSAVSLQVFVLVGFGGGSEIQALLFAVFLVLYVVTVLGNLTMIMVITLDARLHSPMYFFLKNLSFVDLCYSSVIAPNALANFLSASKVISFAGCATQFFF
FSLLATTETFLLAVMAYDRFMAICSPLRYPVTMCPMTCVRLVLGTFCVGCLNSIVQTSLTFQLPFCSSNRIDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLA
VLVSYGYITVTILRMHSGSGRHKVFSTCGSHLTAVSLFYGTLFVMYAQPGALTSMEQGKVVSIFYTLVIPMLNPLIYSLRNKDVKDALWRLGQRHNLVRAVRGCPEVRGN
ASV*
664 >lcl|NP_001000751.1|Plus17918054..7919013 NW_047817 olfactory receptor Olr1351 Olr1351 __SEG__ Chr9 {Rattus norvegicus} MEVHRNGSFSTTSLQGFVLLGFRGGKETQTLLFAVFLVLYMVAVLGNLTMIVVITLDARLHSPMYFFLKNLSFVDLCLSTVIVPNALANIFSSKTISFAGCATQFFFFSV
LATTEALLLAVMAYDRFMAICSPLRYPVTMCPMTCVRLVLGTFCGGCLNSIVQTSLTFQLPFCSSNSIDYFFCDMRPLLQLACASTALNELVMFGICGFIVVCAVFVVII
SYVYITVTILRMRSGSGRHKLFSTCGSHMTAVSLFYGTGFAVYGQPGGVASMEQGKVVSIIYTLIIPMLNPLIYSLRNKDVKDALRRLGQRHSLVKESG*
665 >lcl|NP_001000752.1|Plus17907379..7908350 NW_047817 olfactory receptor Olr1350 Olr1350 __SEG__ Chr9 {Rattus norvegicus} MATAVHRNGSLSTVSLQGFMLVGFGGGAETQALLFTVFLVLYVVTILGNLTMIMVITLDARLHSPMYFFLKNLSFVDLCYSSAIAPNALANFLSASKVISFEACATQLFF
FSLLATTEAFLLAVMAYDRFMAICSPLRYPVTMCPTVCARLVLSTYCGGCLNSIVQTSLTFRLPFCSSNRIDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLA
VLVSYGYITVTILRMHSGSGRHKVFSTCGSHMMAVSLFYGTVFVMYAQPGAVASMAQGKVISVFYTLVIPMLNPLIYSLRNKDVKDALQRLRQRHSLVTRGGK*
666 >lcl|NP_001000753.1|Plus1complement(7827725..7828663) NW_047817 olfactory receptor Olr1345 Olr1345 __SEG__ Chr9 {Rattus norvegicus} MRGENITKVSTFILLGFPTAPRLQYLLFLLFLLIYLFVLVENLAIILTVWSSASLHRPMYYFLGIMSTLEIWYVCDIIPKMLDGFLLQRKHISFIGCMTQLYFFSSLVCT
ECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFISSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGH
ITLAVLRIPSATGRWRAFSTCASHLTVVTIFYTALLFMYVRPQAIDTRSSNKLISVLYTVLTPILNPLIYCLRNKEFKDALRKALGLSQTPL*
667 >lcl|NP_001000754.1|Plus125032896..25033834 NW_047563 olfactory receptor Olr363 Olr363 __SEG__ Chr1 {Rattus norvegicus} MTLMKNNTGVTQFLLLGLTDEPGLQLPLFFTFLFIYTITLVGNLGMILLIVLDFRLHTPMYFFLGNLSLVDFCYSSAVTPTVMTGLLIGNKIISYNDCAAQMFFFVAFAT
VENYLLASMAYDRYAAVCNPLHYATTMTTSVCVCLSLGSYACGFLNASIHIGDTFSLSFCRFHVVHHFFCDIPAVMVLSCSDRHVSELVLIYVVSFNIFFALLVIWISYI
FIFITIFKMKSSSGYRKAVSTCASHFIAVSIFYGTIIFMYLQPSSSHSMDNDKIASVFYTMIIPMLNPLIYSMRNKEVKNAFTKFFMLQNNL*
668 >lcl|NP_001000755.1|Plus1complement(24892418..24893332) NW_047563 olfactory receptor Olr360 Olr360 __SEG__ Chr1 {Rattus norvegicus} MENRTWFILAGLTDNQRLQLPLLITFFLIYTITFVGNLGLILLILLDSRLHSPMYIFLSNLSLVDFCYSSTVTPKVIAGILTGDKIMSYNACASQMFFFANFANVENYLL
VSMAYDRYAAVCKPLHYTTTMTTRVCVSLVIGCYICGFLNASIYTMDALSLSFCESNVVHHFFCDVLAVMIISCSDRHVNELILVYVASFNIFFALILILLSYMFIFTNI
LKMHSAAGYCKALSTCASHLTAVSIFYGTIIFMYLQPSSRHSMDTDKIASVFYTMVIPMLNPLVYSLRNKDVKNAFTKIVLRSR*
669 >lcl|NP_001000756.1|Plus1complement(24860030..24860962) NW_047563 olfactory receptor Olr358 Olr358 __SEG__ Chr1 {Rattus norvegicus} MENNTKVTEFLLLGLTIDPGLQLPLFMLFLLIYTITLVGNVGMILMIFLDSCLHTPMYFFLGNLSLVDFCYSSAVTPTVMTGLLIGNNVISYNDCAAQMFFFVAFATVEN
YLLASMAYDRYAAVCKPLHYATTMTTSVCACLSIGSYACGFLNASINTWNTFRLSFCRSNMVHHFFCEIPAVMVLSCSDRRVSELVLVYLGSFSILFALLVISISYILIF
ITIFKMHSSAGYGKAVSTCASHFTAVSIFYGTVIFIYLLPSSSHAMDTDSIASVFYTMIIPMLNPLVYSLRNKEVKSAFTKVFQWQSSLQ*
670 >lcl|NP_001000757.1|Plus124665825..24666748 NW_047563 olfactory receptor Olr348 Olr348 __SEG__ Chr1 {Rattus norvegicus} MENRTEVRYFVLVGLTNDPDLQLPLFITFFLIYTITIIGNMGLILLILSDSRLHTPMYIFLGNLSLVDFCYSSTVTPNVIAGFLTGDKIMSYNACASQMFFFANFADVEN
YLLVSMAYDRYVAVCKPLHYATTMTTRVCVCIVIGCYICGFLNASIYTVNAFSLSFCESNVVHHFFCDVLAVMIVSCSDRHVNELTFVYVASFNIFFALILILISYMFIF
TSILKMHSAAGYQKALSTFASHFTAVSIFYGTIIFMYLQPSSSQSMDTDKIASVFYVMIIPMLNPLVYSLRNRDVKSAFTKIILRSR*
671 >lcl|NP_001000758.1|Plus124653614..24654537 NW_047563 olfactory receptor Olr347 Olr347 __SEG__ Chr1 {Rattus norvegicus} MENRTEVTQFFLLGLTNDPGLQHPLFIIFLLIYTITLVGNLGLILLIVLDAHLHSPMYIFLGNLSLVDFCYSSGVTPKVMAGFLVGDKVMYYNDCAAQMFFVTGFATVEN
YLLASMAYDRYAAVCKPLHYASTMTTGMCVWMIAGCYACGFLNACIYTGDAFSLSFCRADVVHHFFCDIPAVMVLSCSDNHVNELLLVCVASFNIFFALIIIIISYLMIF
ITILKMRSAAGHQKAMSTCISHFTAVFIFYGTVIFMYLQPSSSHAMDTDKTVSVFYTMVIPLLNPLVYSLRNKEVKSAFRKFIFRLK*
672 >lcl|NP_001000759.1|Plus123812642..23813604 NW_047563 olfactory receptor Olr336 Olr336 __SEG__ Chr1 {Rattus norvegicus} MPGGRNNTIITKFILVGFSDFPKIKLVLFVVFLGSYLSTVVWNLGLVILIRIDPYLHTPMYFFLSNLSFLDFCYISSTTPKMLSGFFQKLKSISFVGCTMQYFFFSSLGL
AECCLLAAMAYDRYAAICNPLLYTAIMSPSLCVHMVVGAYTIGLFGSLIQLCAILQLHFCGPNIINHFFCDLPQLLVLSCSETFPLQVLKFVIAVIFGVASVLVILVSYG
YIISTILNISSVEGRSKAFNTCASHLTAVTLFFGSGLFVYMLPNSDSSQGYDKMASVFYTVVIPMLNPLIYSLRNKEIKDALQRCKKKCFSHCHCQLKIC*
673 >lcl|NP_001000760.1|Plus1complement(23746648..23747595) NW_047563 olfactory receptor Olr331 Olr331 __SEG__ Chr1 {Rattus norvegicus} MEAIIKGKNITEITQFILLGFSDFHQITALLFVIFLTLYITALTWNLSLIVLIRMDSYLHTPMYFFLSNLSFIDLCYITSTVPKMLSNFFQEMQTISFVGCIVQYFIFST
MGLTESCLMTAMAYDRYAAICNPLLYSSIMSPSLCARMLLGSYTAGLVGSVSQVCALLQLHFCGPNVIRHFFCDMPQLLNLSCIDTLFAQVLLAVLTTLFGFSNALAIMI
SYGHIILSIMKITSVKGRSKAFNTCASHVTAVSLFYTSSVFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLVYSLRNKEIRDAVKRLKKKLGCC*
674 >lcl|NP_001000761.1|Plus123704413..23705351 NW_047563 olfactory receptor Olr330 Olr330 __SEG__ Chr1 {Rattus norvegicus} MIGGRNITKITQFILLGFSDFPQITALLFVIFLILYLIALTWNLSLIVLIRMDSYLHTPMYFFLSNLSFIDFCYITSTVPKMLSNFFQEKQTISFVDCIVQYFIFSTMGL
TESCLITAMTYDRYAAICNPLLYSSIMSPSLCSWMLLGSYTAGLISSLCQICVLLQLHFCGSNVIRHFFCDMPQLLNLSCNDNFFAHVLLVLLTIFFGLTNAFVIMVSYG
YIVSSIMKITSAKGRSKAFNTCASHLTTVSLFYSSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDAMNRLQKKATCS*
675 >lcl|NP_001000762.1|Plus1complement(23447605..23448540) NW_047563 olfactory receptor Olr322 Olr322 __SEG__ Chr1 {Rattus norvegicus} MENYTRVKELIFLGLTQSHEVSMVLFLFLLLVYVTTLLGNLLIMVTVTYESRLHTPMYFLLRNLSIADICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDV
FSLSVMALDRYVAISKPLHYVTIMSRGRCIGLIAASWVGGFAHSIVQISLLLTLPFCGPNVLDTFYCDVPQVIKLACTDIFVLELLMISNNGMLTTLWFFLLLISYMVIL
LLLRSHSGEGRKKAISTCTSHITVITLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMRRLRKRLGPSHRIEK*
676 >lcl|NP_001000764.1|Plus19332386..9333321 NW_047563 olfactory receptor Olr312 Olr312 __SEG__ Chr1 {Rattus norvegicus} MTLSLNQTGVTEFVLEGFSEHPGLRLFLAGCFLSIYMMALMGNIVIIALVTSSTGLQSPMYFFLCNLATMDIVCTSSVIPKALVGLVSEENTISFKGCMTQLFFLACSAS
SELLLLTVMAYDRYVAICFPLHYSTRMYPQMCGALAMGVWSIGSLNACVHTGLMARLSFCGPKVITHFFCEIPPLLLLSCSPTYVNSIMTLVADAFFVAINFMLTLLSYS
CIIASILRMRSPEGKKKAFSTCSSHLIVVSVYYSSVFCAYISPASSYSAERSKATSVLYSVLSPTLNPLIYTLRNKDVKLALGRILASLSH*
677 >lcl|NP_001000765.1|Plus19247996..9248928 NW_047563 olfactory receptor Olr310 Olr310 __SEG__ Chr1 {Rattus norvegicus} MVSPNETEMTEFVLQGFSEHPSLRLFLIGCFLFLYTTALVGNIMIIALVTSSTGLHSPMYFFLCNLATMDIVCTTSVLPKALVGLFSEENTISFNGCMAQLFFLIWFGSS
ELLLLTVMAYDRYVAICFPLHYSTRMSPQLCGALAMSVWSICATNACVHTGLMTRLSFCGPKIITHFFCEIPPLLLLSCTPTYVNSIMTLIADFLFGGINFVLTLLSYGC
IITSILRMRSAEGKRKAFSTCSSHLIVVAMYYSSVLSAYISPAFSYSPERSKFTSVLYSVLSPTLNPLIYTLRNKDVKLALGRILASFSH*
678 >lcl|NP_001000766.1|Plus19111919..9112851 NW_047563 olfactory receptor Olr306 Olr306 __SEG__ Chr1 {Rattus norvegicus} MVSPNQTVVTEFVLQGFSEHPGLRLLLTGCFLSLYTMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMAQLFFLLWSGSS
ELLLLTVMAYDRYVAICFPLHYSSRMSRQLCGALAIGVWSICAVNASVHTGLMTQLSFCGPKVITHFFCEIPPLLLLSCSSTYVNSIMTLVADAFYGGINFVLTLLSYGC
IIASILCMHSAEGKKKAFSTCSSHLIVVAMYYSSVFFTYISPASSYSPERSKFTSVLYSVLSPTLNPLIYTLRNKDVKLALSRILGSFSH*
679 >lcl|NP_001000767.1|Plus18747189..8748118 NW_047563 olfactory receptor Olr289 Olr289 __SEG__ Chr1 {Rattus norvegicus} MAVSNYTTVVEFVLQGLSGDPELEALFLVFFLLLYILALAGNTLIIIAISLNPSLHIPMYFFLANLALLDIVCTSTVLPKLLEGLVLKSSHISYKGCMTQLFFMTWFLGS
ELVLLTAMAYDRYVAICRPLHYSMLMSWPICVLLTGIVWLIGIANTSLHTGLMARLNFCGPNQIGNFLCEVPTLLLLSCSPTILNNIMIVIADTYFGVANFLLIMISYSF
IIANILRIRSTEGKKRAFSTCSAHLVVVILYYCTVIYTYLQPGSGSSLENGKVVTLLYTAVSPALNPLIYSLRNKDVKVALRKLFLCLH*
680 >lcl|NP_001000769.1|Plus131914004..31914930 NW_047334 olfactory receptor Olr1460 Olr1460 __SEG__ Chr10 {Rattus norvegicus} MSNHTSVTHFILRGFSDVPQLRLVVIPFFLLTYTFGLLGNFSIIMAVRRDSRLHSPMYFFLKNLSFLDMCYTSATIPKAVAISFTGSGVISYLECVAQLYIFITLCATEC
FLLTTMAYDRYLAILRPLLYGTIMSQKYCLALVVTAWVSGAIYSAFHTFNTFSLPYCGPNIVEHFFCDIPQVMRLSCTDYHVTEEVSFAVISCIIMSSFALTVVSYIGIV
ATVLRIPSVDGRWKAFSTCSSHLTTVILFYGTGSFVYLRPASHYSPTLGRLASIFYSVVTPSLNPVVYCLRNKDMKFALQKLYCGRKY*
681 >lcl|NP_001000770.1|Plus131898590..31899516 NW_047334 olfactory receptor Olr1459 Olr1459 __SEG__ Chr10 {Rattus norvegicus} MSNHTTVTHFILRGFSDVPQLRLVVIPFFLITYTFGLLGNFSIIMAVRRDSRLHSPMYFFLKNLSFLDMCYTSATIPKAVAISFTGSGVVSYLECVAQLYMFITLCATEC
FLLTTMAYDRCLAILRPLLYGTIMSQKYCHALVVTAWVSGSIYSAYHTFNTFSLPYCGPNLVEHFFCDIPQVMRLSCTDYHLTEEVGFAVSSSVVMSSFALTVVSYIGIV
ATVLRIPSVDGRWKAFSTCSSHLTTVILFYGTGSFVYLRPASHYSPTLGRLASIFYSVVTPSLNPVVYCLRNKDMKFALQKLYCGRKY*
682 >lcl|NP_001000771.1|Plus131821318..31822247 NW_047334 olfactory receptor Olr1455 Olr1455 __SEG__ Chr10 {Rattus norvegicus} MKTPSNSTEVDFILLGLFSHTYAHLFLLSAVLVIFTTSLMGNTLMILLICRDPRLHTPMYFLLSQLSFMDMMLVSTIVPKMAANYLMNTRSISPAGCGSQIFLFLTLAGG
ECFLLAAMSYDRYVAICYPLRYHVLMSPKLCAYLTVGSWLLGAADGLMQAGTILSFPFCQSRTINHFFCEAPSLVRLACADTRVFEFFMYICCILMLLIPLSLVLASYSL
ILVAVLRMRSSAARKKAFATCSSHLAVVGLFYGAIIFIYMRPRSHQPGKSDKVVSAFYTIFTPVLNPLIYSVRNKEVKGALRKWLQKKV*
683 >lcl|NP_001000772.1|Plus131798329..31799255 NW_047334 olfactory receptor Olr1453 Olr1453 __SEG__ Chr10 {Rattus norvegicus} MKTPSNSTEVDFILLGLFSHTYAHLFLLSSVLVIFTTSLMGNTLMILLICREPRLHTPMYFLLSQLSFMDMMLVSTIVPKMAANYLMNTRSISPAGCGSQIFLFLTLAGG
ECFLLAAMSYDRYVAICYPLRYHVLMSPKLCAYLTVGSWLLGAADGLMQAGTILSFPFCQSRTINHFFCEAPSLVRLACADTRVFEFFMYICCILMLLIPLSLVLASYSL
ILVAVLRMRSSAARKKAFATCSSHLAVVGLFYGAIIFIYMRPKSHQPGKSDKVVSAFYTIFTPVLNPLIYSVRNKEVKGALRKWLKTV*
684 >lcl|NP_001000773.1|Plus131769114..31770103 NW_047334 olfactory receptor Olr1452 Olr1452 __SEG__ Chr10 {Rattus norvegicus} MDKGNPTAGFILLGLFDHTRAHLFLFVLVLTVAFNSVVGNALLLLLIHQDHRLHTPMYFLLSQLSLMDMMLVSTIVPQMAAGYLTGKNSISAAGCGFQIFFLTLGGGECF
LLAAMSYDRYVAICHPLRYPVLMSWQLCLRLTLGSWLLGAADGAMQAAATMSFQFCSRHEIDHFFCEAPVLLRMACGNTSAFEFVMYICCVLMLLISFSLILVSYGLILT
AVLRMRSTEARKKTFATCCSHLTVVGLFYGAAAFSYMRPASARSANHDKVVSAFCSIVTPMLNPLIYSLRNSEVKGSLRKCLARCSALRSKDTLVGLDLAGATKEKGIQ*
685 >lcl|NP_001000774.1|Plus131735021..31735938 NW_047334 olfactory receptor Olr1450 Olr1450 __SEG__ Chr10 {Rattus norvegicus} METGNHSCGTDFTLVGLFQYGHMDTFLFTVITLLFAVALIGNITLVQLIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAVNFLSDTKTISFLGCVIQAFVFLTLGAS
EALLLGFMSYDRYIAICRPLHYPVLMRRKICCSIVTSAWSSSSITALMHIIYIFQLPFCGSKIVNHFFCEVPSLLPLVCEDTSQYEHTVLVSGLVFLLLPFLAILASYAR
VLVVVFRMGSGKGQSRAVSTCSSHLTVASLFYVTALCTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKEVMGALRRHL*
686 >lcl|NP_001000775.1|Plus131705049..31705969 NW_047334 olfactory receptor Olr1449 Olr1449 __SEG__ Chr10 {Rattus norvegicus} METGNHSCKTDFTLVGLFQCGHTDTFLFTVITLLFAVALIGNITLVHLIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSNTKTISFLGCAIQTFVFLTLGGS
EALLLGFMSYDRYIAICWPLHYPLLMSRKICCSMVASAWSSSSITALMHIIYIFQLPFCGSKIVNHFFCEVPSLLPLVCEDTSQYEHLIVMSVLILVLIPFLAILASYAQ
VLVVVFRMGSGKGQSKAVSTCSSHLTVASLFYVTGLCTYTQPHSLHSPGRDKVVAVVYSIITPVLNPFIYSLRNKEVMGALRRQMG*
687 >lcl|NP_001000776.1|Plus131598956..31599870 NW_047334 olfactory receptor Olr1442 Olr1442 __SEG__ Chr10 {Rattus norvegicus} MGTGNHSCGTDFTLVGLFQYGHMDTFLFTIITLLFAVALMGNITLVYLIRLDRILHTPMYFLLSQLSIIDMMYISTTVPKMAMNSLSDTKTISFLGCAIQTFLFLTLGGS
EALLLGFMSYDRYIAICQPVHYPVLMSRKICCSIVTSTWSSSSITALMHIIYLFQLPLCGSRINHFFCEVPSLLPLVCEDTSQYEHAVLMSGLVILLLPFLAILASYARV
LVVFQMGSGKGQSRAVSTCSSHLTVASLFYITTLSTYTQPHTLHSPGRDKVVAVIYSIVTHVLNPFIYSLRNKEVMWALKRQMG*
688 >lcl|NP_001000777.1|Plus1complement(31414453..31415370) NW_047334 olfactory receptor Olr1435 Olr1435 __SEG__ Chr10 {Rattus norvegicus} METGNHSSGTDFTLVGLFQCGHTDTFLFTIIVLLFAVALIGNITLVHIIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCAIQTFLFLTLGGS
EALLLGFMSYDRYIAICQPLHYPVLMSRKICCSMVAGAWSSSSINALVHTVYVFQLPFCGSRINHFFCEVPSLLPLVCEDTSQYEHTVLLSGLVILLLPFLAILASYARV
LVVVFQMGSGKGQSRAVSTCSSHLTVASLFYVTTLSTYTQPHSLHSPGRDKVVAVLYSIITPVLNPFIYSLRNKEVMGALRRHMG*
689 >lcl|NP_001000778.1|Plus131284741..31285688 NW_047334 olfactory receptor Olr1431 Olr1431 __SEG__ Chr10 {Rattus norvegicus} MRPQNSSTITELILVGFSDHPETEVPLFLIFSLVYLANCLGNTAVVTLVALDVSLQTPMYFFLCHLAFLNGFFSTVVAPKMLFNFLASRKVISYPFCLAQTYLTLFLEST
ECFLLAVMAIDRYVAICYPLRYLLIMSWVVCTALSVAIWVIGFCASVIPLCFTILPLCGPYVVDYLFCELPILLHLFCTDTSLLEAMMAIGGAGTVLFPFLLIVLSYLRI
LVAVIRIDSAEGRKKAFSTCASHLAVVTIYYGTGLIRYLRPKSLYSAEGDKLISVFYAVIGPALNPFIYSLRNKEVQGAMRRVMERYKKSTRVTF*
690 >lcl|NP_001000779.1|Plus1complement(31209457..31210395) NW_047334 olfactory receptor Olr1424 Olr1424 __SEG__ Chr10 {Rattus norvegicus} MNNYTGKSDFDLVGLFSQSKHPTLLAGVIFVVFLMALSGNALLILLILFDTHLHTPMYFFISQLSLRDMMYISVTVPKMLMDQILGNHRISAAACGMQMFLYLTLVGSEF
FLLAAMSYDRYVAICHPLRYPVLMNHRVCLLLLSVCWLLGSLDGFMLTPVTMTFPFCGSREIHHFFCEVPAVTKLSCSDTWLYETLMYVCCVLMLLIPVTVISGSYSSIL
LTVLRMNSAEGRKKALATCSSHMTVVILFYGAAVYTYMLPTSFHTPEKDMVVSVFYTILTPLLNPLIYSLRNKNVTEAIKKLLGENSSFQKQ*
691 >lcl|NP_001000780.1|Plus1complement(31133165..31134127) NW_047334 olfactory receptor Olr1421 Olr1421 __SEG__ Chr10 {Rattus norvegicus} MGIITCVNNYTGLSDFTLVGFLSQSKDPVLLAVLIFVVFLMALSGNALLILLILSDTHLHTPMYFFIGQLSLMDMMYISVTVPKMLMDQVLGSHKISAAACGMQMFLYLT
LAGSECLLLAAMSYDRYVAICHPLRYPILMNHRVCLLLLSVCWLLGSLDGFIFTPVTMTFPFCGSRKIYHFFCEVPAVTKLSCSDTWLYETFMYVCCVIMLLIPVTVISG
SYLSILLTVLRMNSTEGRKKALATCSSHMMVVILFYGAAVYNYMLPISFHTPEKNMVVSAFYTILTPLLNPLIYSFRNKNVNKALSKLLDVSTIFQKTVK*
692 >lcl|NP_001000781.1|Plus1complement(30955280..30956287) NW_047334 olfactory receptor Olr1415 Olr1415 __SEG__ Chr10 {Rattus norvegicus} MDRKNKTTASFILLGLFPSCRYPNLLISVILLIYALASAGNSLLILLIWLDPRLHTPMYFLLSQLSLIDLAYISCTVPKAATNYFTGRRNISFFACATQMFSFLTLGLAE
CILLTLMAYDRYVAVCNPLRYAILMSPKVCLKMAASTWIGAVVAALVHTAYPMNFPICGSREINHYFCEMPAILRMSCVDTSVYEMVKFVSTIIFLLAPFTLILTSYALI
FLTVLKMNSPKGRSKALATCSSHLTVVSLYFGQAIFIYMTPTSSHTPDQDQVGAVLGTIVTPMLNPLIYSLRNKEVIGALQKCTGRCCSRDRVRSLRCCAQKCPSLHLKS
GFKSN*
693 >lcl|NP_001000782.1|Plus1complement(30937140..30938093) NW_047334 olfactory receptor Olr1414 Olr1414 __SEG__ Chr10 {Rattus norvegicus} MLEVQDISRGNGTSTDFILLGLFPELRYLGILIISILLIYLIAFTGNAVLVLLIWADSRLHTPMYILLSHLSLIDLALISTTVPKMVINFFSRKKSISKVACGTQIFFFF
ALGGSECLLLTLMAYDRYVAVCNPLRYSIIMNSRVCLWMALVSWGGGALNSLINTIYTMHFPFCGSREIHHFFCEMPAVLRLSCEDTSLYETVVSIICIVFVLLPLGLIM
TSYLLIFLAVLRMNSPEGRRKALATCSSHLAVVSLYYGPAMIIYMTPDSFHTPEQDEILSMINTIFTPMLNPLIYSLRNKEVLAALRKVVSQRFILK*
694 >lcl|NP_001000783.1|Plus123457836..23458768 NW_047334 olfactory receptor Olr1411 Olr1411 __SEG__ Chr10 {Rattus norvegicus} MAGENETGVSGFLLLGITNDPQQQRILFWAFLCMYLVTVAGNTLIFMAISSDPRLHTPMYFFLTNISFDDICFTTNIIPRLLASHVSGIETISYAHCLTQMYFLISFGNV
DTFLLAAMALDRFVATCYPLQYHTIITPQLCVGLAAVVWISCGLIALVHTLLTSRLTFCSSIPEVSHFYCDAYLLMKFTCSDKQVNQLLFLGAVVFFVAPCILIVFSYVQ
IAVAVFQIPSAKGRHKAFSTCSSHLTVVILFYGTVLGIYIRPPDSFTQDTVATIMFTVVTPMLNPFIYSLRNKDMKETVTRLLNRGSNSS*
695 >lcl|NP_001000784.1|Plus123444368..23445309 NW_047334 olfactory receptor Olr1410 Olr1410 __SEG__ Chr10 {Rattus norvegicus} MSKWGENETGVSEFLLLGITNDPQQQRILFWAFLCMYLVTVAGNTLIFMAISSDPRLHTPMYFFLANLSFNEVCFTTNLIPRLLASHVSGIGTISYAHCLTQMYFLISFA
DVDFCLLTAMALDRFVAICYPLQYHTIITPRLCVGLAAVVWISCGLIALVHTLFMSRLTFCSSIPEISHFYCDPYLLMKLACSDTRVDQLLFLGAVVLFVAPCILIVFSY
ARIAVAVFQIPSAKGRHKAFSTCSSHLTVVILFYGTVLGIYIRPPDSFSTQDTVATIMYTVVTPMLNPFIYSLRNKDMKETVTRLLHRCSKSS*
696 >lcl|NP_001000785.1|Plus123418934..23419875 NW_047334 olfactory receptor Olr1408 Olr1408 __SEG__ Chr10 {Rattus norvegicus} MSKWGENETGVIEFLLLGITNDPQQQRILFWAFLCMYLVTVAGNTLIFLAISSDPHLHTPMYFFLANLSFDDVCFTTNIIPRLLAGHVSGTETISYAYCLTQMYFLISFG
NVDTFLLAAMALDRFVAICYPLQYHTIITPRLCVGLASVVWISSGLIALVHTLLMSRLTFCSSIPEISHFYCDAYLLMKLACSDTRINQLVFLGAVVFFVAPCILIVFSY
VRIAMAVFQIPSAKGRHKAFSTCSSHLTVVILFYGTVLGIYIRPPDSFSTQDTVATIMFTVVTPMLNPFIYSLRNKDMKETVTRLLHRGSKSS*
697 >lcl|NP_001000786.1|Plus123386477..23387388 NW_047334 olfactory receptor Olr1406 Olr1406 __SEG__ Chr10 {Rattus norvegicus} MDGPNQTATEFLLLGFSEQEEVVFGMFLGMYMVTISGNLLIILVISCDPRLHTPMYFFLANLSSVDICFSSVTVPKALVNHMLGSKTISYTECMAQMYFLFIFGNMDGFL
LSVMAYDRYVAICHPLHYTMMMRPRLCVLLVAISWVITNLHALLHILLMVQLTFCSYNAVRHFFCDPYLILKLSCSDTFINDVAAFTEGPLIFLTPFICIVVSYAYIYAK
VLKIPSAHGIKKALSTCGSHLTVVCLFYGAILGVYMHPSSSYSLQDAVASVIFTVVTPMVNPFIYSMRNRDIKGALRKIILTS*
698 >lcl|NP_001000787.1|Plus123367158..23368105 NW_047334 olfactory receptor Olr1404 Olr1404 __SEG__ Chr10 {Rattus norvegicus} MVRENQSTAIEFLLLGLAGQSEQEEVVFGLFLWMYLVTVCGNLLIILAISCDPRLHTPMYFFLANLSSVDICFSSVTVPKALVNHVLGSKTISYTECMIQIYFFITFINM
DGFLLSVMAYDRYVAICHPLHYTMMMRPRLCVLLVAVSWVITNLHALLHTLLMVRLTFCSHNAVHHFFCDPYPILKLSCSDTFINDITAFTVGGLTSITPFTCITVSYAY
ILSSVLKFPSIQGIRKALSTCGSHLTVVSLFYGAILGVYMHPSSTYSLQDTVATAFFTVVTPMVNPFIYSLRNHDVKGALRKLMFKRLLSSRVYN*
699 >lcl|NP_001000788.1|Plus121574864..21575799 NW_047334 olfactory receptor Olr1388 Olr1388 __SEG__ Chr10 {Rattus norvegicus} MGSFNASLDKGFMLVGFSDWPELELIFFIYILIFYSVTLFGNTAIIALSRMDLRLHTPMYFFLSHLSFLDLCYTTSTVPQLLINLHGLDRTISYGGCVAQLFISLALGST
ESVLLVVMAFDRYAAVCRPLHYTTMMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEMPVFLKLACEDTEGTEAKMFVARVVIVAVPAMLILGSYAQI
ARAVLRVKSVAARRKAAETCGSHLLVVSLFYGSATYTYLQPKDSYSESKGKFFALFYTIITPMLNPLIYTLRNKDVKGALWKVLGRAAATV*
700 >lcl|NP_001000789.1|Plus1complement(12627996..12628943) NW_047799 olfactory receptor Olr1338 Olr1338 __SEG__ Chr8 {Rattus norvegicus} MTQGVVSENNSSVKEFILLGLTQQPELQLPLFFLFLGIYVVSMVGNLGLIVLIVLNPHLHTPMYYFLFNLSFTDLCYSSVITPKMLVGFVKQNIISHAECMTQLFFFAFF
VIDECCILTAMAYDRYAAICKPLLYKVIMSHQVCFMLMVGGYTVGFVGAIAHTVSMLRLTFCDGNIINHYMCDIPPLLKLSCTSTSINELVVFIVVGVSIIVPSVTVSVS
YTLILSNILRIHSTKGRSKALSTCSSHMIAVSLFFGSSSFIYFKSSPVGSVDQDKISTVFYTVVVPMMNPFIYSLRNKDVQIALSKTLKKKSSLE*
701 >lcl|NP_001000790.1|Plus1complement(12512947..12513885) NW_047799 olfactory receptor Olr1331 Olr1331 __SEG__ Chr8 {Rattus norvegicus} MRNDTSVTEFILLGISNSEGLESMLFILFLVFYVFALLGNLLIFLTILASPNLHTPMYFFLGNLAVFDIFFPSVNSLKMMDYLVGQSRTISYQGCASQIFFYHTLGCTEC
FLYTVMAYDRFVAICHPMRYTIIMNHRVCTCLTVGTWVGGFVHGSILTFLIFKLPYCGPTEVDSFFCDIPIVLSLACADTSLAQTVSFTNVGVVALTCFLLVLTSYTRIV
ISILKIRSSEGRRRAFSTCSAHFTSILLFYGPVILVYLRPASSPWLDSVVQVFNNIVTPSLNPLIYSLRNHEVKSALRKVLNQAIQPLGYKE*
702 >lcl|NP_001000791.1|Plus112491860..12492792 NW_047799 olfactory receptor Olr1329 Olr1329 __SEG__ Chr8 {Rattus norvegicus} MRPGNHSETSLFVLEGLTDKPELQIPLFSLFLLIYVVSMAGNLGLVFLIRISSQLHTPMYYFLSNLSFIDFCYSSVIIPKMLVNFVSEKNFTSFPECMAQLYLFSFFGID
DSFMLTAMAYDRYVAICNPLLYNVTMSHRVCMLLSTAVYIMGTFGATVHTSYISSRSFCGTSVIHHYFCDILPLLNIACSRDYTKEFWVMIIVGFNVFASVFAIFISYAF
ILASILRIRSAEGRSKAFSTCSSHLAAVGVFYGSIIFMYFKPSTSDTTQEKVASVFYTTVIPMLNPLIYSLRNKDVKEAIKKAVNGGLFS*
703 >lcl|NP_001000792.1|Plus112349577..12350509 NW_047799 olfactory receptor Olr1321 Olr1321 __SEG__ Chr8 {Rattus norvegicus} MLAGNHSMVTEFSLAGLTSTPELQLPLFFLFLIIYAVTMVGNLGMITLILLSSHLHTPMYFFLSSLSFIDLCHSTVITPKMLVNFVAVRNTISYSECMTQLYFFLVFVIS
ECHMLAAMAYDRYVAICNPLLYNAMMSYQVCSWMIFGVYIMGFIGATAHTMCMLRVHFCKVDVINHYFCDLFPLLELSCSPTFINEVVVLCFSAFNILFPTLSILSSYIF
IIASILRIKSTEGRSKAFSTCSSHISAVAVFFESAAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNQLIYSLRNKGVKVALMKLYEKGFS*
704 >lcl|NP_001000793.1|Plus112271577..12272515 NW_047799 olfactory receptor Olr1316 Olr1316 __SEG__ Chr8 {Rattus norvegicus} MAEGNQSRVTEFILTGLTDKPELQLPLFLLFLGIYLLTVLGNLGMIILILLSSHLQTPMYFFLSGLSFIDLCYSTVIIPKMLVNFVTEKNIISYPGCMTQLYCFIAFVIS
ECYMLSAMAFDRYVAICNPLRYNVTMSYQVCFWMIGGVYSIGFIEATIHTVCMLQVLFCKANVVNHFFCDLLPLFQLACSSTFVNETVLLCLSTLNFCVPTLTILSSYSF
IIARIIRIKSTESRFKAFSTCSSHFSSVAVFFGSLGFMYFQPSSVSSKDQGKVSSVFYTTVVPMLNPLIYSLRNKDVKLALNKLFQKKTFHM*
705 >lcl|NP_001000794.1|Plus112162965..12163900 NW_047799 olfactory receptor Olr1313 Olr1313 __SEG__ Chr8 {Rattus norvegicus} MTNHTMVTEFTLLGIPETQGLENVLLFLFSTLYACALLGNLLLLTAVISSPQLHTPMYFFLGNLSIFDMGFCSTTAPKMLSYLSGWGGGISFQGCVAQLFFYHCLGCTEC
FLYTVMAYDRFVAICFPLRYTIIMNHRVCCVLATGSWMSGCVHATILTSLTFQLPYCGPSKVGYYFCDMPAVLPLACEDHSLAQRVGFTNVGLLSLICFFLILVSYTRIG
ISISKIRSTEGRQRAFSTCSAHLTAIICAYGPVIIIYLQPNPSPLLGAVIQILNNLVTPTINPLIYSLRNKDVKAALRHVFLKRSLSLESK*
706 >lcl|NP_001000795.1|Plus112101297..12102229 NW_047799 olfactory receptor Olr1308 Olr1308 __SEG__ Chr8 {Rattus norvegicus} MRNYTLLNEFILLGIPQTQGLETLLFVMFLFIYFFTLLGNSLIFTAIISSSTLHTPMYFFLGLLSIFDMLFPSVTCPKMLLYLSGRSPGISYKGCAAQLFFYHLLGSTEG
CLYSVMAYDRYVAICHPLRYMLIMKPGVCVSLVIIAWLVGCLHATILTTLTFQLVYCASNQVDYFFCDLPAVLPLACTDNKLAQKVGSINVGFLALMLLFSVCVSYVHIG
VAILRIRSAEGRQKAFSTCSAHLTAILCAYGPVIIIYLQRTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRSLRRVFQNIMFGGQK*
707 >lcl|NP_001000796.1|Plus1complement(11957566..11958492) NW_047799 olfactory receptor Olr1303 Olr1303 __SEG__ Chr8 {Rattus norvegicus} MAEGNYSIVSEFVFLGLTEKPELQLPLFLLFLVIYIVTLLGNLGMVMLILFSPHLHIPMYFFLSNLSFIDLCQSSVIIPKMLEKFIIVKSVISFAECMAQFYLFDVFAVS
ECHMLAAMACDRYVAICNPLLYNVTMSYKVCSWMVAAVYSVGLICATGETVCLLRLLFCKAEDINHYFCDLLPLLEQSCSSTFINEVVALSFSSLNVIVPALNILSSYIF
IMATILRIPSTEGRSKAFSTCSSHILAVAVFFGSLTFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVKVAFYKIVGRR*
708 >lcl|NP_001000797.1|Plus1complement(11204044..11205003) NW_047799 olfactory receptor Olr1291 Olr1291 __SEG__ Chr8 {Rattus norvegicus} MEDNMARNYCTVTEFFLAGLSQTPELQLPLFFLFTAIYLITVAGNLGMITLIVLSSHLHTPMYYFLSSLSFSDFCQSTVVIPKMLMSFLTEKNIISYPGCMTQLYFFITF
GIAECYTLAAMAYDRYVAICNPLLYNVTMSSQIYTSLISGVYIFAMLSSSVNTGFMIRIKFCKLDVINHYFCDLLPLLKLACSSIHINEMLMLSFGTVNIFVPMMTIIIS
YIFIIVSILRIRSREGRSKAFSTCSSHISAVAIFYGSAAFTYLQPSSVSSMDQGKVSSIFYMTVVPMLNPLIYSLRNKDVIVALKKILHVSRSHMRNIS*
709 >lcl|NP_001000798.1|Plus1complement(11147462..11148406) NW_047799 olfactory receptor Olr1288 Olr1288 __SEG__ Chr8 {Rattus norvegicus} MEDIAAGNHCTVTEFFLAGLSEKPELQLPLFLFFTGIYLITVAGNLGMITLIGLSSHLHTPMYYFLSSLSFIDFCQSTVVVPKMLVSFLTKKKLISYPACMVQLYFFLTF
GIAECYTLAAMAYDRYVAICNPLLYNVTMTDEKHCSLISGVYIFAVFCASVKTGFMGRIQFCQFDVIDHYFCDLLPLLKLASSSTYINQALILFFGTLNLFIPVMTIITS
YVFIIATILYIHSSEGKFKAFRTCSSHISAVGIFYVSGAFTYLHPSSLNSMNQVKLSSVFYTTIVPMLNPLIYSLRNKDVSIALKKIFERKKFM*
710 >lcl|NP_001000799.1|Plus1complement(11077473..11078432) NW_047799 olfactory receptor Olr1286 Olr1286 __SEG__ Chr8 {Rattus norvegicus} MAAGNHCTVTQFFLAGLSEKPELQLPLFLLFVGIYLITVAGNLCMITLIGLSSHLHTPMYFFLSSLSFTDFCLSTVVTPKMLMSFVTEKNIISYPGCLAQLYFVIIFGSA
ECYTLAVMAYDIYVAISNPLLYNITMSPPIYCSLISVVYVCAVFCASVIMGFMFSIHFCKSDVINHYFCDLLPLLQLASSNTYISEILILFFGTLNIFATVLTISTSYIF
IIASIFRIDSREGRSKAFSTCSSHISAVAVFFGSAAYMYLQPSSVSSMDQGKVSSVFYTTVVPMLNPLVYSLRNKDVSVALKKTLEKIYISRNHVKIIY*
711 >lcl|NP_001000800.1|Plus1complement(10838430..10839365) NW_047799 olfactory receptor Olr1275 Olr1275 __SEG__ Chr8 {Rattus norvegicus} MEKGNRSTVTKFFLSGLTDQPELQLPLFLLFLGIYLLTVLGNLGTIILILLSSHLKTPMYFFLSSLSFIDLCQSTVITPKMLMIFLMAKNDISYTECIIQLYFFVIFVVS
ECYVLAAMAYDRYVAICNPLLYSIIMSQHKCLSLVLGVYIIGIVCASVHVGCIFRVDFCKSDFIDHYFCDLISILHLSCSNVFVNESMILIFSVINTILPNLTILSSYVF
IIISILRIKSTEGRAKAFSTCSSHISVVAVFYGSAAVMYLNPSSSSPMGEGKVSSVFYTIIVPMLNPMIYSLRNKDIKIALKKLIGKKLLF*
712 >lcl|NP_001000801.1|Plus1complement(10819680..10820612) NW_047799 olfactory receptor Olr1274 Olr1274 __SEG__ Chr8 {Rattus norvegicus} MEKHNHSTVTKFFLSGLTDQPELQLPLFLLFLGIYLLTVLGNLGMIILILLSSHLKTPMYFFLSSLSFIDLCQSTVITPKMLVNFIVEENDISYPECMIQLYFFLLFAIS
ECYMLSAMAYDRYVAICSPLLYSIIMSQPKCLSLVLGVYIISIACASVHVGCVFRIDFCRPDLINHYFCDLISILQLSCSNIFVNELMILIFSGINIIAPTLTILSSYVF
IIISILRIKSTEGRSKAFSTCSSHISAVLVFFGSAAFMYLNPSSSSSMDDGKVSSVFYTIIVPMLNPLIYSLRNKDVNIALKKMIERLFF*
713 >lcl|NP_001000802.1|Plus110712712..10713647 NW_047799 olfactory receptor Olr1266 Olr1266 __SEG__ Chr8 {Rattus norvegicus} MTDGNYSLVTEFILEGLTDQPKLQMPLFFLFLGIYVVTIVANLGLITLISLNSHLHTPMYYFLFNLSFVDICYSSVFTPKMLINFVVEKNTISYTGCLTQLYFFCFFVIT
ECYILTAMAYDRYVAICKPLLYNVILSPRICALFMFGAYVMGFWGSLAHTLCMARLTFCDANLVNHYLCDILPVLQLSCTSTYNNEVVVFVLVGMNIVVSSSTTFVSYGF
IIANILRISSTQGRAKAFNTCSSHIMTISLFCGSAIFMYMQPSDVESMDKGKVASVFYTNVAPMLNPLIYSLRNKDVKLALKKTLKRKLFS*
714 >lcl|NP_001000803.1|Plus110646364..10647305 NW_047799 olfactory receptor Olr1262 Olr1262 __SEG__ Chr8 {Rattus norvegicus} MVLANGSTVTEFILLGLTDQPGLQMPLFLLFLLMYMITVFGNLTLIILIVLNAHLHTPMYFFLCNLSFVDLCYSSVITPKMLMNFILKKNLISYMGCMSQLYFFCFFIIS
ECYVLVSMAYDRYVAICNPLLYNTIMSPRVCSYLMLASYLMGFADAMIHTGCMLRLTFCDENIINHYFCDVLPLLQLSCTSTYVNETELYIVAGKDIILPSVIIFISYGF
IVSNIFQIKSTLGRSKAFSTCSSHIIAVSLFFGSCGFMYLKPPSAISIDQGKISSIFYTIVVPMLNPLIYSLRNKDVKVALRKILNMSKVFKL*
715 >lcl|NP_001000804.1|Plus110608086..10609027 NW_047799 olfactory receptor Olr1261 Olr1261 __SEG__ Chr8 {Rattus norvegicus} MVLANGSTVTEFILLGLTDQPGLQMPLFLLFLLMYMITVFGNLTLIILIVLNAHLHTPMYFFLCNLSFVDLCYSSVITPKMLMNFILKKNLISYMGCMSQLYFFCFFIIS
EFYVLVSMAYDRYVAICNPLLYNTIMSPRVCSYLMLASYLMGFADAMIHTGCMLRLSFCDENIINHYFCDFLPLLQLSCTSTYVNETEIFIVGGKDIILPSVIIFISYGY
ILSNIFQIRSTLGRSKAFSTCSSHITAVSLFFGSCGFMYLKPPSAISIDQGKISSIFYTIVVPMLNPLIYSLRNKDVKVALRKILNMSKVFKL*
716 >lcl|NP_001000805.1|Plus1complement(10401714..10402646) NW_047799 olfactory receptor Olr1253 Olr1253 __SEG__ Chr8 {Rattus norvegicus} MDSVNISLVTEFVLVGLTDQPHLQILLFFVFLAMYLVTVLGNLFLIILTVLNSHLHTPMYFFLFNLAFVDLCYSSVFTPQMLMNLITRKNTISYMECMTQLYFFCFFVIS
ECYVLTSMAYDRYVAICNPLLYNLVMSSKLCLKLMLGSYFIAFSESVAHTICIMRLTFCKANTINHYFCDIPPLLQLSCTTTYINKLVIFVASSINIIVPISTIFISYGF
ILSNIFHISSSEGRSKAFSTCSSHIIAAFLFFGSGAFMYFKPSSGGSMNEGKISSVFYTNVIPMINPLLYSLRNKDIKVALRKTLSKKNF*
717 >lcl|NP_001000806.1|Plus110362641..10363573 NW_047799 olfactory receptor Olr1250 Olr1250 __SEG__ Chr8 {Rattus norvegicus} MAFENGSVVIEFILLGITDQPELQIPLFLLFFVVYMITVLGNLTLIILIVLNSHLHTPMYFLLFNLSCIDLCYSSVITPKMLMNFIQKKNVISYMGCMTQLYFFCFFVIS
ECYVLTSMAYDRYVAICNPLLYNVTLSSKVCFYLMLGSYFMGFSGAMIHTGCILRLTFCDGNTINHYFCDLLPLLQISCTSTYVNEIELFIVAGKDIIVPTLIIFISYGF
ILFSILKIKSTESRSKTFSTCSSHMLAVSLFFGSGAFMYLKPTSALSINDGKFSSLFYTIVVPMMNPLIYSLRNKDVKVALRKTLSRRIF*
718 >lcl|NP_001000807.1|Plus110314990..10315910 NW_047799 olfactory receptor Olr1247 Olr1247 __SEG__ Chr8 {Rattus norvegicus} MVLTNGSVVTEFVLLGLTDNSDLQIPLFSVFLVMYMITAFGNLTLILLTVLNSHLHTPMYFFLFNLSFIDLCYSPKMLMNFVLKENIIGFAGCMTQLYFFCFFAISECYV
LTAMAYDRYVAICNPLMYNVAMSPKVCSYLMLGSYLMGFSDAMIHTGCILRLTFCDGNTINHYFCDLLPLMQLSCTSTYVNEVEIFIVGGKDITVPSIIIFISYGFILSN
ILQIKSNVGRSKAFNTCSSHIIAVSLFYGSGAFMYLKPSSAGSLNEGKVSSVFYTIVVPMMNPLIYSLRNKDVKLALRKTLSRKKL*
719 >lcl|NP_001000808.1|Plus110305589..10306521 NW_047799 olfactory receptor Olr1246 Olr1246 __SEG__ Chr8 {Rattus norvegicus} MVLKNGSLVTEFILLGLTDNPDLQIPLFLVFLVMYMITAFGNLTLILLTVLNSHLHTPMYFFLFNLSFIDFCYSSVFIPKMLMNFVLKENIIGFAGCMTQLYFFCFFIIS
ECYVLTAMAYDRYVAICNPLMYSVAMSPKVCSYLMLGSYLMGFFDGMIHTGCILRLTFCDGNIINHYFCDLVPLMQLSCTSTYVNEVEIFIVGGKDIAVPSIIIFISYGF
ILYSILQIKSNVGRSKAFNTCSSHIIAVSLFFGSCAFMYLKPSSAGSLNEGKVSSVFYTIVVPMMNPLIYSLRNKDVKLALRNTLSRKKV*
720 >lcl|NP_001000809.1|Plus110295515..10296447 NW_047799 olfactory receptor Olr1245 Olr1245 __SEG__ Chr8 {Rattus norvegicus} MGQENGSLVTEFILLGLTNDPDLQLPLFLLFLLIYTTTALANLALITLITLNSHLHTPMYFFLLNLSFIDLCYSSVITPKMLMNFLVKKNFISYVGCMTQLYFFCFFAIC
ECCVLTSMAYDRYVAICNPLLYNISMSPKVCSYLMLGSYIMGFSGAMIHTGCILRLTFCDRNIINHYFCDLFPLLQLSCTSTYANEIEILIVGGKDIIVPSVIIFTSYGF
ILSNILQMRSTAGMSKAFSTCSSHILAVSLFFGSCAFMYLQPSSPGSMDQGKISSVFYTIVVPMMNPLIYSFRNKDVKIALKKVYSKRRF*
721 >lcl|NP_001000810.1|Plus110288154..10289086 NW_047799 olfactory receptor Olr1244 Olr1244 __SEG__ Chr8 {Rattus norvegicus} MGLENGSLVTEFILQGLTNDPDLQLPLFLLFLLIYTATVLGNLALITLIALNSHLHTPMYFFLLNLSFIDLCYSSVITPKMLMNFFVKKNFISYVGCMTQLYFFCFFAVS
ECCVLSSMAYDRYVAICNPLLYNISMSPKVCSYLMFGSYIMGFSGAMIHTGWILRLTFCDRNIINHYFCDLLPLLQLSCTNTYANEVEIIVVGGIDIIVPSVIIFTSYAF
ILSNIFQMRSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLQPSSPESMDQGKRSSIFYTILVPMMNPLIYSLRNKDVKVALKKTFNRRKL*
722 >lcl|NP_001000811.1|Plus110217831..10218763 NW_047799 olfactory receptor Olr1239 Olr1239 __SEG__ Chr8 {Rattus norvegicus} MDSVNVSLVTEFILVGLTEQPDLQIPLFFLFLAMYLVTALGNLFLITITVLNSHLHTPMYFFLFNLSFIDLCYSSVFTPQMLMNFIIRKNTISYMECMTQLYFFCFFVIS
ECYVLTSMAYDRYVAICNPLMYNLVMSPKLCLHLILGSYFVAFSDAVAHTACMLKLKFCDANTINHYFCDIPPLLQLSCTSTYVNELVIFIVGCINIIVPSSTIFISYGL
ILSSIFRIRSSEGRSKAFSTCASHLIAVFLFFGSSAFAYFKSSSAGSWDEGKISSVFYTNVVPMMNPLIYSLRNKDIKVALRKSLSRKNI*
723 >lcl|NP_001000812.1|Plus110186560..10187495 NW_047799 olfactory receptor Olr1236 Olr1236 __SEG__ Chr8 {Rattus norvegicus} MASANDSTRVKEFILLGLTQQPELQLPFFFLFLAIYVVSMVGNLGLIVLIVLNPHLHTPMYYFLFNLSFIDFCYSSVITPKMLVSFVKQNIISYAECMTQLFFFAFFVID
ECCILTAMAYDRYVAICKPLLYKVSMSFQVCFLMTMSVYMMGFVGAIAHTICMLRLTFCNSNIINHYMCDIPPLLKLSCTSTSINDLVVFIVVGVNVIGPTLIIFTSYTL
IIFNISHIRSTAGRSKAISTCSSHIIAVSIFFGASAFMYLKPSPVGSEDEDKVSTVFYTIVGPMLNPFIYSLRNKDVHIALHKTLKKSNLI*
724 >lcl|NP_001000813.1|Plus110126527..10127477 NW_047799 olfactory receptor Olr1231 Olr1231 __SEG__ Chr8 {Rattus norvegicus} MVSMRAGNGSFVTEFILAGLTDLPELQLPLFYLFLIIYIITVVGNIGLITLISLNPHLHTPMYYFLFNLSFIDLSYSSVFSPKMLMNFVSEKNSISYEGCMTQLFFFLFF
VISECYMLTSMAYDRYVAICNPLLYKVSMSPQVCSILSFAAYGMGFAGASVHTGCMLRLTFCNANLINHYLCDILPLLQLSCTSTYVNEVVVLVVVGINITVPSCTILIS
YVFILANILNIKSTQGRSKAFSNCSSHIMAISLFFGSAAFMYLKYSSGSMEHGKISSVFYTNVGPMLNPLIYSLRNKDVKVALRKSLIKFQRKDKF*
725 >lcl|NP_001000814.1|Plus19959322..9960263 NW_047799 olfactory receptor Olr1220 Olr1220 __SEG__ Chr8 {Rattus norvegicus} MKQMIMENDSSVSEFILMGLADQPELQLPLFFLFLMNYTATVMGNLSLMSIIFLNSNLHTPVYFFIFNLSFIDFCYSFVFTPKMLMSFVLEKNTISFRGCMTQLFFFCFF
VNSESSVLTAMAYDRYVAICQPLMYKVVMSPGICFMLMFGSYLMGFAGAMAHTGCMIRLSFCDSNIINHYMCDIFPLLQLSCSSIYVNELVSFVVVGTVITLSSLIILIS
YGMILYNIIHISSGKGWSKAMGTCGSHIITVSLFYGSGLLAYVKPSSAETVGQGKIFSVFYTFLVSMLNPLIYSLRNKDVKIAMKRTMKRLNK*
726 >lcl|NP_001000815.1|Plus19211135..9212079 NW_047799 olfactory receptor Olr1213 Olr1213 __SEG__ Chr8 {Rattus norvegicus} MTLGRMTFSNDSSVKEFVLLGLTQQPELQPPLFFLFLGIYVVSRVGNLGLIVLIVLNPHLHTPMYYFLFTLSFIDFCYSTVITPRMLVGFVKQNIISHAECMTQLFFFCF
FVIDECYILTAMAYDRYAAICKPLLYQVTMSHQVCHLMMVGVYVMGLVGAMAHTGSMLTLTFCDGNIINHYMCDIPPLQKLSCTSTSTNELVVFIVVGVNVIIPSLTVFI
SYTLILSNILSIRSAEGRSKAFSTCGSHVIAVSLFYGASAFMYLKPSSASVDDDKVSTIFYTIVGPMLNPFIYSLRNKDVHIALRKTLKKSIFI*
727 >lcl|NP_001000816.1|Plus19040931..9041857 NW_047799 olfactory receptor Olr1206 Olr1206 __SEG__ Chr8 {Rattus norvegicus} MALGNASSVKEFILLGLTQQLELQMPLFFLFLGIYVVSVVGNLGLIILIVLNPHLHTPMYYFLFNLSFTDLCYSTVITPRMLVGFVKQNIISHAECMTQLFFFAFFVIDE
CYILTAMAYDRYAAICKPLLYQVTMSRQVCLLMTMGVYVMGFLGSMAHIVCMLRLDFCNGNIINHYVCDVLPLLKLSCTSTFINELVVFIVVGVNVIVPSLTLFVSYTLI
LSNILSIHSAEGRSKAFSTCGSHVIAVSLFFGAAAFMYLKPSSASVDDDKVSTIFYTIVGPMLNPFIYSIRNKDVHLALRKTMKRSFT*
728 >lcl|NP_001000817.1|Plus18925579..8926508 NW_047799 olfactory receptor Olr1202 Olr1202 __SEG__ Chr8 {Rattus norvegicus} MAPRNSSSVIEFILVGFSDQPALQLPLFFFFLGIYMLTVVGNLGLITLIGLNSGLHTPMYFFLFNLSFIDFCYSCVFTPKMLTDFVSENIISYVGCMTQLFFFCFFVNSE
CYVLVSMAYDRYVAICNPLLYTVTMSPQVCALLMFGSYVIGFAGAMAHTGSMLTLTFCESNRIHHYLCEVLPLLQLSCTSTYANELVFFIVVGLVITASSVSIFISYALI
ISNILKIPSAEGRSKAFGTCGSHVVAVALFFGSGAFTYLTTSFPGSMKEGRFASVFYTNVVPMLNPLIYSLRNKDVKLALNKTLQRVLF*
729 >lcl|NP_001000818.1|Plus18905701..8906633 NW_047799 olfactory receptor Olr1201 Olr1201 __SEG__ Chr8 {Rattus norvegicus} MATENASVPEFILAGLTDQPGLRMPLFFLFLGFYMVTVMGNLGLITLIGLNSHLHTPMYFFLFNLSLIDFCYSTVITPKMLVSFVSKKNIISYPGCMTQLFFFLFFVVSE
SFILSAMAYDRYVAICNPLMYTVTMSPQVCLLLLLGVYVMGFAGAMAHTAFMVRLTFCADKLVNHYMCDILPLLERSCTSTHVNELVVFIVVGIDIGEPTVTIFISYALI
LSSILRISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLNKSSFS*
730 >lcl|NP_001000819.1|Plus18743442..8744377 NW_047799 olfactory receptor Olr1199 Olr1199 __SEG__ Chr8 {Rattus norvegicus} MTAKNSSVTEFILAGLTNQPGLCMPLFFLFLGFYMVTVVGNLGLISLIGLNSHLHTPMYFFLFNLSLIDFCYSSTISPKMLMSFILKQNIISHSGCMTQLFFFCFFVISE
SFILSAMAYDRYVAICNPLMYMVTMSPQVCLFLLFGVYLMGFVGAMAHTISMGRLTFCADNLVNHYMCDILPLLEHSCTSTYVNELVVFIFVSFDIGVPIVTIFISYALI
LSSILRMHSTEGMSKAFSTCSSHMIAVCLFFGSGAFMYLQPPSVLSLDQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTTLGRRIFS*
731 >lcl|NP_001000820.1|Plus1complement(8591923..8592852) NW_047799 olfactory receptor Olr1194 Olr1194 __SEG__ Chr8 {Rattus norvegicus} MAAENHSTVTEFILGGLTHRPELQLPLFLLFLGIYTVTMVGNLGMITLIGLNTQLHTPMYFFLSNLSLVDLCYSSVITPKMLINFVSQRNLISYVGCMSQLYFFLVFVIA
ECYMLTVMAYDRYVAICHPLLYNIIMSPALCSLLVAFVYAMGLIGSTIETGLMLKLNYCEVLISHYFCDILPLMKLSCSSTYDVEMAVFFLAGFNIVVTSLTVLISYAFI
LSSILRISSTEGRSKAFSTCSSHFAAVGLFYGSTAFMYLKPSTASSLAQENVASVFYTTVIPMLNPLIYSLRNKEVKAALDKTLKRKLF*
732 >lcl|NP_001000821.1|Plus1complement(593563..594510) NW_047719 olfactory receptor Olr868 Olr868 __SEG__ Chr5 {Rattus norvegicus} MWVISGQNQSWVSEFILIGFSRDPVTNNILFFVFLLIYLSSVLGNGLIIMLVCLDTQLHTPMYFFLCTLSLLDMSYVTTTVPQMLVHLLAHSKTISFAGCGLQMYVFAAL
GITECTFFVVMAYDRYVAICYPLRYTVILSWGLCIRMAAGSWICGFLSSLLHTFFTMSLPYCGPNKVNHYFCEGPSVRSLACMDTHLIDMVDFVLSVFVVVIPISLIVAS
YIHIAMAILKIKSTQGRCKAFSTCASHLTVVTFFYAPAIYIYMRPNSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDIKRAFLKVMGHVRVDW*
733 >lcl|NP_001000822.1|Plus1complement(380956..381903) NW_047719 olfactory receptor Olr860 Olr860 __SEG__ Chr5 {Rattus norvegicus} MWLIPLHNQSWVSEFILIGFSRDPTTNSILFLVFLLIYLSSVLGNGIIVMLVCLDTQLHTPMYFFLCTLSLLDMGYVTTTMPQMLVHLLAHSQTISFAGCWLQMYMFGTL
GMTESILFIVMAYDRYVAICYPLRYTVILNWSQCIQLVSRTSACGFFFSLLHTSFTMSLPYCGPNRVDHYFCEGPSVRSLACMDTHLIEMVDLVLSVFVVLTPISLIVAS
YIHIAKAILKIKSTQGRCKAFSTCASHLTVVTLFYAPAICIYMLPNSSYSPEQDKQISLFYNVFTALLNPVVYSLRNRDLKRAFLKVMGHVMVDQ*
734 >lcl|NP_001000823.1|Plus12703483..2704406 NW_047653 olfactory receptor Olr427 Olr427 __SEG__ Chr3 {Rattus norvegicus} MNSSSTSDFILLGLSSDPWMQKPLFVIFIVMYLVTVVGNVLIILVIRSDTKLHTPMYFFLSNLSFMDICFTTVIVPKMLVNVLSKTKTISYVGCLVQMYFFIALANTDSY
LLASMAIDRLVAICNPLHYDVVMRPQHCLLMLLGSCTISHLHALFRVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTSSNQIVVMTETLAVIVTPFLCILFSYLRIIV
TVLRIPSAAGKWKAFSTCGSHLTVVSLFYGSVIYVYFRPLSMYSVVKDRVATIMYTVVTPMMNPFIYSLRNKDMKRGLRKLRDRFHS*
735 >lcl|NP_001000824.1|Plus1complement(2516412..2517404) NW_047653 olfactory receptor Olr421 Olr421 __SEG__ Chr3 {Rattus norvegicus} MATKNKTEVTEFVLLGLSNRPDMQPVIFGVILTMYLMSVLGNTLLVLVACSDPKLQTPMYFLLSQLSLIDISLTTITIPQMLVHTFSVDRSISYNRCMTQLFFFMAVGSM
EGHLLAAMAYDRYVAICDPLRYSAIISHRLCLRITLTSWVVVSLNSLLYSVLVTRLTFCGNQVTHFFCDITPLLKLSCTRPVLNEMLIFTEGVVVVVSPFFFILGSYVRI
GFAIAHMHSITALRKALSTCGSHILVVLLLYGSVIRMYLKPSSIYELDQDRQIAIFYTLITPMLNPLIYSLRNHEVKGAVRRLLRKLCIPGSFHIGSDKVRMMTIMRPSV
*
736 >lcl|NP_001000825.1|Plus1complement(2470776..2471708) NW_047653 olfactory receptor Olr418 Olr418 __SEG__ Chr3 {Rattus norvegicus} MERDNKTNIVSEFILLGLSTRPEDQKPLFILFLTIYLITLAGNLLIILVIHSDPHLQTPMYFFLSFLSLTDICFTTTIVPKMLVNFLSEKKTISYAGCLTQMYFLYALGN
SDSCLLAVMAFDRYVAICNPFHYVTIMNHHRCVLLVTFSCSFPHLHSLLHTLLLNLLTFCDSNVIHHFLCDLSPLIKLSCSSTFVNEIVIVTEGALVLVTPFLCIAFSYI
RILITVLKIPSAAGKCKAFSTCGSHLTVVILFYGSIFYVYLQPVSTYTVKDHIATIIYTVLSSMLNPFIYSLRNKDLKQGLRKLISRRRI*
737 >lcl|NP_001000826.1|Plus12407189..2408127 NW_047653 olfactory receptor Olr413 Olr413 __SEG__ Chr3 {Rattus norvegicus} MRKDNQSTVSEFILLGLPIKPEEQGMYSALFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLALTDISFSSVTVPKMLRNMHTQDSSIPYTECIAQMYFFILFTDL
DNFLLTSMAYDRYVAICHPLHYTAIMREELCILLVAMSWILSCVSALSHTLLLARLSFCADNTIPHFFCDLAALLKLSCSDISLNELVIFTAGTIVITLPLICILISYGH
IGATILKVSSNKGIYKALSTCGSHLSVVSLYYGAIIGLYLIPSSSTSSDKGVIASVMYTVVTPLLNPFIYSIRNRDMKEALKKLVNRAAIST*
738 >lcl|NP_001000827.1|Plus12336678..2337619 NW_047653 olfactory receptor Olr409 Olr409 __SEG__ Chr3 {Rattus norvegicus} MKSTRNQSSAFEFILLGLPIRPEEQGMYYAMFLATYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTAPKMLMNMLIHSQSISYAGCISQAYFFLFFAD
LDSFLLTSMAYDRYVAICHPLHYTRIMSQSVCILLVIASWFLSFAGALVHTLLLARLSFFRGNTLHHFFCDLSTLIKLSSSDTSINELVILVVGSLVITVPFICILVSYG
RIGATILRTPSIKGICKALSTCGSHLSVVSLYYGAIIGLYFVPSSNDTNDKDVIVAVMYTMVTPMLNPFIYSLRNRDMKGALRNTFSRATFSM*
739 >lcl|NP_001000828.1|Plus12266672..2267610 NW_047653 olfactory receptor Olr407 Olr407 __SEG__ Chr3 {Rattus norvegicus} MRRDNESIVYEFILLGLPIRAENQGMYSVLFLIMYLTTLLANLLIIVLIKLNSHLHTPMYFFLSHLAFTDISFASVASPKMVINMLTHSQSISYAGCITQVYFFSVFAVL
DSFLLTSMAYDRYVAICHPLQYSQIMNENLCVLLVVVSWALSTANSLVHTLLFAQLTHFRENIIPHYFCDLSTLLKHSTSDTTINELVILVLGNVVITLPFICILVSYGH
IGVTILKTPSIKGIYKALSTCGSHICVVSLYYGAIIGLYFVPSSNNTNDKDVIVAMMYTVVIPMVNPFIYSLRNRDMKGAIRNIFSRRLCSQ*
740 >lcl|NP_001000829.1|Plus11861586..1862524 NW_047653 olfactory receptor Olr401 Olr401 __SEG__ Chr3 {Rattus norvegicus} MRMDNESTVSEFILLGLPIRAEDQAVYSALFLTMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTAPKMLMNMLTHSQSISYAGCVSQVYFFSTFTDL
DSFLLTSMAYDRYVAICHPLHYTTIMSQNLRVLLVVVSWALSSANALVHTLLLARLSHFRNNIIPHYFCEPSALLNLSSSDTTVNEMVILPLGTLVITLPFICILVSYGR
IGVTILRTPSIKGICKALSTCGSHLSVVCLYYGAIIGLYLVPSSNNTNDKDVIVAVIYSLVTPMVNPFIYSLRNRDIKGALKNILSRRLCSQ*
741 >lcl|NP_001000830.1|Plus11754242..1755171 NW_047653 olfactory receptor Olr398 Olr398 __SEG__ Chr3 {Rattus norvegicus} MKSDNESTVSEFILLGIPIRAEDQAMYSALFLAMYLTTVLGNLLIILLIRLDPHLHTPMYFFLGHLAFTDMSLSSATAPKMLTNMLTHSHFISYAGCVSQVYFFTFLGSI
DSFLLTSMAYDRYVAICHPLHYTIIMSQSLCVLLVFMSWTLSLANALVHTLLLACLSHFRNNTIPHYFCDLSALLKLSSSDTTVNEMAILLLGIVVITLPFICILVSYVH
IGVTILKAPSIRGICKALSTCGSHLCVVSLYYGAIIGLYLVPSYNNNNNKDVIVSVMYGLVTPMLNPFIYSLRNRDMKGALRNILNRTK*
742 >lcl|NP_001000831.1|Plus11680703..1681641 NW_047653 olfactory receptor Olr396 Olr396 __SEG__ Chr3 {Rattus norvegicus} MRKENQSTVFEFLLLGLPIRPEHQNVFFTLFLAMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISLSSVTVPKMLMNIQAQQHSISYKGCISQMYFFVLFGCL
DNFLLAVMAYDRYVAICHPLHYITIMREELCFFLVAASWFFCCVHALLHTLLLIQLSFCASNIIHNFFCDLTPLLELSCSDISLNKLVIFTEGGLLFILPLSSVMGSYIL
IGCTALKAPSTKRFIKTFSTCGSHLLVVFLYYGTVACEYFFSSFQNSSDKDIVASVFYAVVTPLMNPFIYSLRNRDIKQALEIVVTRINCFK*
743 >lcl|NP_001000832.1|Plus1complement(3461848..3462804) NW_047453 olfactory receptor Olr1642 Olr1642 __SEG__ Chr15 {Rattus norvegicus} MKRNRNTSLDTVVTDFLLLGLAHPPNLRTFLFLVFFLIYILTQLGNLLILLTVWADPKLHARPMYILLGVLSFLDMWLSSVIVPQLILNFTPASKAIPFGGCVAQLYFFH
FLGSTQCFLYTLMAYDRYLAICQPLRYPVLMNGKLCTILVAGAWVAGSIHGSIQATLTFRLPYCGPNQIDYFICDIPAVLRLACADTAINELVTFVDIGVVAASCFLLIL
LSYANIVHAILKIRTADGRRRAFSTCGSHLTVVTVYYVPCIFIYLRAGSKSSFDGAVAVFYTVVTPLLNPLIYTLRNQEVKAALKRLRAGRGHVGGDK*
744 >lcl|NP_001000833.1|Plus1complement(3395587..3396528) NW_047453 olfactory receptor Olr1639 Olr1639 __SEG__ Chr15 {Rattus norvegicus} MERVNHTLLTEFVLTGVPRPPRLRTFLFVYFLLIYILTQLGNMLILITVCADTQLHARPMYVFLGARSVIDMGISTIIVPRLMMNFTPGIKPIPFGGCVAQLYFYHFLGS
TVCYLYTTMAYDRYLAICQPLHYPVLMSANLSILLVAGAWVAGSIHGAIQAILTFRLPYCGPNQVDYFFCDIPAVLKLACADTTVDELVTFVDIGVVVASCFSLILLSYI
YIIRAILRIRTADGRRRAFSTCGAHVTMVTVYYVPCAFIYLRPDSHSILDGAAALFPTAITPFLNPLIYTLWNQEVKTALRKMVGRQSTKSEV*
745 >lcl|NP_001000834.1|Plus1complement(3051000..3051935) NW_047453 olfactory receptor Olr1638 Olr1638 __SEG__ Chr15 {Rattus norvegicus} MERTNLSQEMEFELLGLTSDPQLQKLLFVVFLIMYSITVLGNLVMFFLIHVSTTLHTPMYSLLKSLSFLDFCYSSTVVPQTLMNFLVQRKVISYFGCMAQMFFYAGFATS
ECYLIAAMAYDRYVAVCNPLLYPTIVSPNVCASLIVGSYSAGFLNSLIHTSCIFSLNFCGAHVVTHFFCDGPPILSLSCVDTSLCEILLFIFAGFNLLSCTLTILISYFL
IFVAILRMHSTQGRFKALSTCTSHLTAVCFFFGTTLFMYLRPRSSYSLTQDRTVAVIYTVVIPMLNPLIYSLRNKDVKEALRRVWGWKSMR*
746 >lcl|NP_001000835.1|Plus1complement(2213421..2214353) NW_047453 olfactory receptor Olr1633 Olr1633 __SEG__ Chr15 {Rattus norvegicus} MNLSTTHVTEFVLLGFPGSWKTQIFLFVLFLVFYVLTLLGNGAIICAVRCDSRLHTPMYFLLGNFAFLEIWYVSSTVPNMLANILSKTKAISFSGCFLQFYFFSSLGTTE
CLFLAVMAYDRYLAICRPLHYPVIMTRRLCCILVSSCWLIGFLGYPIPVFSISQLPFCGSNIIDHFLCDMDPLMALSCAPAPITEFIFYAQSSFVLFFTISYILWSYILL
LRAVFQVPSAAGRRKAFSTCGSHLVVVSLFYGTVMIMYVSPTYGISTLMQKILTLVYSVMTPLFNPLIYSLRNKDMKLALRKVLLGMRIV*
747 >lcl|NP_001000836.1|Plus1complement(2184093..2185067) NW_047453 olfactory receptor Olr1632 Olr1632 __SEG__ Chr15 {Rattus norvegicus} MSFFPRRYVDTMNTSATYVTEFILLGFPGSWKIQIFLFVLFLVFYVLTLLGNGAIICAVICDSRLHTPMYFFLGNFAFLEIWYVSSTTPNMLANILSKTKAISFSGCFLQ
FYFFFSLGTSESFLLAVMAYDRYLAICRPLHYPVIMTRRLCCILVSSCWLIGFLGYPIPVFSISQLPFCGSNIIDHFLCDMDPLMALSCAPAPITKLIFYVQNSLFLFFT
ITYILRSYILLLRAVFQVPSAAGRRKAFSTCGSHLAVVSLFYGTVMIMYMSPTYGISTLMQKILTLVYSVMTPLFNPLIYSLRNKDMKLALSKVLLGMRIVKNI*
748 >lcl|NP_001000837.1|Plus1complement(2169734..2170708) NW_047453 olfactory receptor Olr1631 Olr1631 __SEG__ Chr15 {Rattus norvegicus} MSFSPLRYVETMNTSATHVTEFVLLGFPGSWKIQIFLFVLFLVFYVLTLLGNGAIICAVICDSRLHTPMYFFLGNFAFLEIWYVSSTAPNMLANILSKTKAISFSGCFLQ
FYFFFSLGTSECFFLTVMAYDRYLAICRPLHYPVIMTRRLCCILVSSCWLIGFLGYPIPVFSISQLPFCGPNTIDHFLCDMDPLMALSCAPAPITKLVFYVQNSFFLFFT
ITYILRSYILLLRAVFQVPSAAGRRKAFSTCGSHLAVVSLFYGTVMIMYMSPTYGISTLMQKILTLVYSVMTPLFNPLIYSLRNSDMKLALRKVLLGMRIVKKI*
749 >lcl|NP_001000838.1|Plus11915241..1916179 NW_047453 olfactory receptor Olr1622 Olr1622 __SEG__ Chr15 {Rattus norvegicus} MNKSEASTVTYFVLLGFPGPWKIQITLFSLILLVYMITLTGNMAIICAVRWNQQLHTPMYMFLANFSFLEIWYVTCTVPNMLVNFLSKTKTMSFSGCFTQFYFFFSLGTT
ECFFLCAMAYDRYLAICHPLHYPAIMTRQFCSILVSLCWIIGFSLYLIPIFFISQLSFCGPNIIDHFLCDVDPLMALSCTHTPIVKHVFYSISTLIITLTGLYILASYIL
VLRAVLQVPSDGRQKAFSTCGSHLLVVSLFYGTIVVMYVTPTSGKSVDMHKAITLIYSVVTPALNPFIYSLRNKDMKYALHNVFFGKMIMKN*
750 >lcl|NP_001000839.1|Plus11749656..1750591 NW_047453 olfactory receptor Olr1617 Olr1617 __SEG__ Chr15 {Rattus norvegicus} MKTFSSTINSSTITGFILLGFPCSREEQILLFVLFFIVYLLTLMGNISIICAVCCDQRLHTPMYILLANFSFLEIWYVTSTVPNMLANFLSETKVISFSGCFLQFYFFFS
LGSTECFFLAVMAFDRYLAICRPLHYPALMTRHLCNILVISCWVLGFLWFPIPITIISQMSFCGSRIIDHFLCDPGPLLALACSRAPLMEFFWTIITSLLLFIPFLFIMG
TYILVLRAVFRVPSRDGQKKAFSTCGSHLTVVSLFYGSVMIMYVSPTSEHEAGKQKLVTLFYSVGTPLLNPVIYSLRNKDMKNALQKILRI*
751 >lcl|NP_001000840.1|Plus11736281..1737216 NW_047453 olfactory receptor Olr1616 Olr1616 __SEG__ Chr15 {Rattus norvegicus} MKALSSPSNSSTITGFILLGFPCPREEQILLFVLFFIVYLLTLMGNASIICAVCCDQRLHTPMYLLLANFSFLEIWYVTSTVPNMLANFLSDSKVISFSGCFLQFYFFFS
LGSVECFFLAVMAFDRYLAICRPLHYPALMTGRLCNILVISCWVLGFLWFPVPITIISQMSFCGSRIIDHFLCDPGPLLALACSRVPLMEVFWAIISSMLLFIPFICIMG
SYILVLRAVFRVPSRDGQKKAFSTCGSHLTVVSLFYGSVMIMYLSPTSEHAAGMQKLVTLFYSVVTPLINPVIYSLRNRDMKHALQKILRT*
752 >lcl|NP_001000841.1|Plus11676832..1677770 NW_047453 olfactory receptor Olr1614 Olr1614 __SEG__ Chr15 {Rattus norvegicus} MNSARNVSHTVSHFILLGFPCRREIQIFLFSVFFMIYILTLLGNMAIVYAVHWDHRLHTPMYILLANFSFLEICYVNSDVPNMLVNFLSTTKTISFTQCLLQLYFFFSLG
TTECLFLSIMAYDRFLAICRPLYYPTVMTTRFCGNLVIFCWVYGFLWFLIPVILITQLPFCGPNVIDDFLCDLGPLLALASVCVPIPGTVLICGTMSSLLIFGTFFYIIG
SYTLVLRAVIRMPSSAGSKKAFSTCSSHLAVVFLFYGSVMITYVSPGSGQAKGMQKFTTLFYSVLTPFFNPMIYSLRNKEMKDALKKVVGGS*
753 >lcl|NP_001000842.1|Plus14198467..4199429 NW_047690 olfactory receptor Olr821 Olr821 __SEG__ Chr4 {Rattus norvegicus} MKENQTVVTEFILLGFCLGPRIHLVLFLLFSLFYMFTILGNGTILAMICLDSRLHTPMYFFLSHLAIVDMAYACNTVPQTLVNLLDETKPISFTGCMTQTYLFLTFAITE
CLLLVVMSYDRYVAICHPLHYSVIMNWRACSILAAVSWIVSFLLSLVHLLLILRLPFCGPHEINHFFCEILSVLKLACADTTLNQLVIFTACVFTLVGPLCFVLVSYMRI
LVAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSEHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKGALWRVLCKESHSCLVWCSHHKA*
754 >lcl|NP_001000843.1|Plus14164959..4165900 NW_047690 olfactory receptor Olr819 Olr819 __SEG__ Chr4 {Rattus norvegicus} MEENQTMVTEFILLGFCLGPRIHIALFALFSLCYIFTLLGNGFTLGLICVEPRLHSPMYFFLSNLATVDIAYACNTVPQTLVNLLDETKSISFAGCMMQTYLFLTFANTE
CVLLVVMSYDRFVAIRHPLHYTVIMNWKVCTILAAVSWIVSFLLALVHLVLILKLPFCGPHVINHFFCEILSVLKLACADTTLNQVIIFAACVFALVGPLCFVLVSYTCI
LVAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSQHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKSALRRSLCNKNHSQLV*
755 >lcl|NP_001000844.1|Plus14129695..4130627 NW_047690 olfactory receptor Olr818 Olr818 __SEG__ Chr4 {Rattus norvegicus} MGNNMTSITEFILLGFPLSPRMRMLLFVLFSLFYTFTLLGNGTIVGLICVDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLDPVKPISYAGCMTQTFLFLTFAITE
CLLLVVMSYDRYVAICHPLRYSVIMSWRVCSTMAVTSWIIGFLLALIHLVLLLPLPFCVSQKVNHFFCEITAILKLACADTHLNETMVLAGAVSVLLGPFSSIVVSYACI
LGAILRIQSGEGQRKAFSTCSSHLCVVGLFYGTAIVMYVGPRHGSPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTLKRVLGTQRAL*
756 >lcl|NP_001000845.1|Plus14091664..4092596 NW_047690 olfactory receptor Olr816 Olr816 __SEG__ Chr4 {Rattus norvegicus} MRGNQTWITEVTLLGFQADLPVECLLFGLFSLFYSFTLFGNGVILGIICLDHRLHTPMYFFLSHLAIVDMSYASNNVPKMLANLVTQRRTIFFIPCLMQTFLYLAFAHIE
CLILVVMSYDRFVAICHPLHYTVIMSWRVCTILAAVSWIFSFLLALVHLVLILRLPFCGPHEINHFFCEILSVLKLACANTMLNQVVIFAACVFILVGPLCLVLVSYTRI
LMAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSQHPEEQQKILSLFYSLFNPMLNPLIYSLRNAEVKGALRRSLWKERPM*
757 >lcl|NP_001000846.1|Plus14027892..4028833 NW_047690 olfactory receptor Olr813 Olr813 __SEG__ Chr4 {Rattus norvegicus} MGGNQTLITQFILLGFPLSPRMQMLLFVLFSLFYAFTLLGNGTILGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLMDPAKPISFAGCMTQTFLFLTFAHTE
CLLLVVMSYDRYVAICHPLRYTVIMSWRVCVIFVLTSWILGVLLALVHLVLLLPLPFCGSQKVNHFFCEIIAVLKLACSDTRINEVMVLAGAVSVLVGPFSSIVVSYTHI
LCAILKIKSQQGRQKAFSTCSSHLCVVGLFYGTAIVMYIGPQHGKSNEQKKYLLLFHSLFNPMLNPLIYSLRNKDVKSALKRMLIKEDTSSGC*
758 >lcl|NP_001000847.1|Plus14005519..4006451 NW_047690 olfactory receptor Olr812 Olr812 __SEG__ Chr4 {Rattus norvegicus} MTENQTWVPEFILQGFLLSPQMQMLLCGLFSLFYIFTLLGNGVILGLIWLDCRLHTPMYFFLSHLAIVDISYATNNVPKMLANLLAKKKSISFAPCIMQTFLYMAFAHTE
CLILVMMSYDRYVAICQPLQYSVIMAWKVCTIMAVASWTCGSLLALVHVVLILRLPFCGHHEINHFFCEILSVLKLACADTTLNQIVIFAASVLILVGPLCFVLVSYTRI
LTAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKTQHPETQQKILSLFYSLFNPMLNPLIYSLRNTEVKGAVKRVLWKQRSR*
759 >lcl|NP_001000848.1|Plus13945655..3946590 NW_047690 olfactory receptor Olr811 Olr811 __SEG__ Chr4 {Rattus norvegicus} MDVENQTRVTKFILVGFPGSLSMRTAVFLMFLVAYILTVAENVIIILLVQQNRPLHKPMYFFLANLSFLETWYISVTVPKLLFSFWSMSNSISFTHCMIQLYFFIALMCT
ECVLLAAMAYDRYVAICRPLHYPTIMSHGLCFRLALGSWIIGFGISLAKIYFISRLSFCGPNVINHFFCDISPVLNLSCTDMSIAELVDFVLALVIFLFPLSITALSYGC
ILATVLRMPTGKQKAFSTCASHLVVVTIFYSATIFMYARPRAIHAFNMNKVISIFYAIVTPALNPFIYCLRNREVKEALKKLIYCQAIQSG*
760 >lcl|NP_001000849.1|Plus13903528..3904463 NW_047690 olfactory receptor Olr809 Olr809 __SEG__ Chr4 {Rattus norvegicus} MGKKNQTWVSEFLLLGLSTDWGTQVSLFVLFLAMYLLTVLGNLLIIILIKLDSKLHTPMYFFLSILSFVDICYTNSTVPQMLVHFLSARKSIPFHSCVLQLYISLAMGST
EFFLLGAMAYDRYVAVCHPLHYMVIMHGGLCLRLASACLTAGLSNSLMQTLMIFQLPFCRTVINHFACEMLAVLRLSCVDISLNKVMVAISGFLVIMLPCILVLFSYAHI
VAAILRIRSSQGRRKAFGTCASHLTVVSMCFGTAIFTYMRPVGRSSAGQEKMVALFYAVVTPMLNPLIYSLRNNDVIGALKRTLEKLKENK*
761 >lcl|NP_001000850.1|Plus13883837..3884793 NW_047690 olfactory receptor Olr808 Olr808 __SEG__ Chr4 {Rattus norvegicus} MEQDNQTWVHEFILLGLSSDWNTQVSLFILFLLMYLLTVLGNFLIILLIRLDSRLHTPMYFFLNNLSLVDVSYATSIVPQLLAHFLATRKAIPFLSCAAQLFFSLGLGGI
EFLLLAVMAYDRYVAVCDPLRYSVIMHTGLCTRLVITSWVSGSLNSLVHTAITFQLPMCTNKYIDHISCEILAVVRLACVDTSSNEIVIMVSSIVLLMTPFFLVLLSYIQ
IISTILKIQSTEGRRKAFHTCASHLTVVTLCYGTTIFTYIQPHSSPSVLQEKLISLFYAILMPMLNPMIYSLRNKEVKGAWQKLLGNLSGFTSKLTSG*
762 >lcl|NP_001000851.1|Plus13850599..3851549 NW_047690 olfactory receptor Olr807 Olr807 __SEG__ Chr4 {Rattus norvegicus} MEANNETQMHEFILLGLSGDWDTHVSLFILFLLMYLVTVLGNFLIILLIRLDSRLHTPMYFFLINLSLVDVPYATSIVPQLLAHFLAIHKAIPFLSCAAQLFFSLGLGGI
EFLLLAVMAYDRYVAVCDPLRYSVIMHTGLCTWLAIASWVSGFINSLVHTVITFHLPMCAKYIDHIACETLAVVRLACVDTSSNKIAIMVSSIVLLMTPFFLVLLSYIQI
ISTILKIQSTEGRWKAFHTCASHLTMVVLCYGMAIFTYIQPHSSPSVLQEKLMSLFYAILTPMLNPMIYSLRNKEVKGAWQKLLGKFSGFTSKLST*
763 >lcl|NP_001000853.1|Plus1complement(3482547..3483485) NW_047690 olfactory receptor Olr803 Olr803 __SEG__ Chr4 {Rattus norvegicus} MGENMTWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYFFLCHLSVVDICYTSSGVPQMLAHFPMEKKTISFALCGTQHFFALALGGTE
FLLLAAMAYDRYVAVCDPLRYTVVMSPRLCMGLAGVSWFVGLVNSAVETAVTMRLPTCGHNVLNHVACETLALVRLACVDITLNQVVILASSVVVLLVPCCLVSLSYAHI
VAAIMKIRSTQGRHKAFETCASHLTVVSMSYGMALFTYMQPSSTASAEQDKVVVIFYALVTPMLNPLIYSLRNKDVKAAFHQVLKKNFESKN*
764 >lcl|NP_001000854.1|Plus11378875..1379819 NW_047690 olfactory receptor Olr799 Olr799 __SEG__ Chr4 {Rattus norvegicus} MFGNHTSATKFYLVGFPGSEKLHHILFATFCFFYLVTLVGNTVIIVIVCVDKRLQSPMYFFLVHLSILEILVTTVIVPVMLWGLLLPGIQVISLAGCVAQLFLQLALGTT
EFSLLGAMAVDRYVAVCNPLRYSVIMNSRTCNSVVIVSWVFGFLYQIWPVYATFHLNYCKSNVLDNFFCDRGQLLKLSCNNTIFIEFILFLMAVFVLFGSLIPTIVSYTY
IIATILKIPSASGRRKAFSTCASHFTCVVIGYGCCLFLYVKPKQTQAADYNRVVSLMISIVTPFLNPFIFTLRNDKVIEALRDGVNRCYHLFKS*
765 >lcl|NP_001000855.1|Plus17048605..7049558 NW_047713 olfactory receptor Olr844 Olr844 __SEG__ Chr5 {Rattus norvegicus} MDKNNQTFVSEFLLLGLSGYPKTEIIYFVIILVMYLVILTGNGVLIIASIFDPHLHTPMYFFLGNLSFLDICYTTSSVPSTLVSQISKKRNVSFSGCAVQMFVAFAMGST
ECLLLGMMAFDRYVAICNPLRYSIIMSKEVYVSMASASWFSGGINSVVQTSLVMRLPFCGNNVINDFTCEVLAVLKLACADISLNIVTIAISNMAFLVLPLLLIFFSYVF
ILYTILRMNSATGRRKAFSTCSAHLTVVGIFYGTLFIMYMKPKSQDLTGEDKFGISDKVISLFYGLVTPMLNPIIYSLRNKDVKAAIKYILKQKYIP*
766 >lcl|NP_001000856.1|Plus1complement(293342..294316) NW_047581 olfactory receptor Olr386 Olr386 __SEG__ Chr1 {Rattus norvegicus} MESPTPIPTANRTSVLEFLLLGVTEKRGLQLLLFGVLLVTYTLTLLGNLLIIALTLADRRLHTPMYFFLRHFSLLEVGFTSTVSPQMLAHLLAARGAISRHRCFAQMILY
FTLGAVETLLLAVMSTDRFLAICWPLRYPALMTPRVCSALVLACWGASLLALPGLFAWMLSLPFCGPRVLNHFFCDSSPLLELVCADTRLLQLVAFLVAVCTLLTATLIT
TLSYGCIISTILRLPTPGGRSKAFSTCSSHILVVSLTYGSCIIMYLNPTQTGRLDLNKGIAFFNTTVSPLLNPFIYCLRNQLVHRVCRDLLLRGRELSSKIFRA*
767 >lcl|NP_001000857.1|Plus1complement(5363831..5364772) NW_047333 olfactory receptor Olr1380 Olr1380 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVTEFLLLGLSSQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMYFFLSNLSFVDLCFSSTTVPKVLANHILGSQIISFSGCLTQMYFLFMFVDM
ENFLLAVMAYDRFVAICHPLHYTTKMTYKVCVMMVAGSWVTANLNVLLHTLLIAQLSFCGDNIIPHFFCDVTPLLKLSCSDTHINELLILTEGAVIMVTPFVCILTSYIH
ITSAVLRVSSPRGGWKAFSTCGSHLAVVCLFYGTIIAMYFNPSSSHSPEKDRAATVLYTVVTPMLNAFIYSLRNRDLKGALQKLVHRSTFSVQ*
768 >lcl|NP_001000858.1|Plus1complement(4954754..4955716) NW_047333 olfactory receptor Olr1364 Olr1364 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVSEFLLLGLSRQPQQQQLLFLLSLTMYLATVLGNLLIILAIIADSHLHTPMYFFLSNLSFVDVCFSSTTVPKVLANHILGSQVISFSGCLTQMYFLSVFADM
DNFLLSVMAYDRFMAICHPLHYTTKMTHQLCALLVVGSWVVANMNALLHTLLMARLSFCGENIISHFFCDVTPLLKLSCSDTHLNELMILTEGTMIIVTPFFCILISYVH
ITCAVLRVSSPRGGWKSFSTCGSHLAVVCLFYGTIISLYFNPSSSHSAGRDMAAAIMYTIVTPMLNPFIYSLRNRDMKGALRKLLTMNIHLQISVRKSYT*
769 >lcl|NP_001000859.1|Plus115984501..15985463 NW_047798 olfactory receptor Olr1192 Olr1192 __SEG__ Chr8 {Rattus norvegicus} MKPGNQTSTLEFLLLGFCQDPEHQPMLFGLFLFIFVVAVLGNLLIILAVSVDSHLHIPMYFFLCNLSFSDICFISTTIPKMLVNIQTQSKSITYAECITQMYFFMVFGGM
DTFLLTVMAYDRFVAICHPLHYPVIMNPHLSGLLVLVSWFISFSYSLIQSLLMLRLSFCTNQIIKHFYCEHATALTIACSDTLINHILLYIVTCVLGFVPFSGIIYSYSK
IVSSILKIPSTDGKYKAFSTCGSHLLVVSLFYGTGLGVYLSSDATSSSWKGMVASVMYTVITPMLNPFIYSLRNKDIKKALQTLGTNIFLSDKFSWCLDF*
770 >lcl|NP_001000862.1|Plus115788738..15789736 NW_047798 olfactory receptor Olr1186 Olr1186 __SEG__ Chr8 {Rattus norvegicus} MGRENHTEVSQFLLLGLSDDPKFQPILFGMFLFMYLITVLGNLLIILAVISDSHLHNPMYFFLSNLSFVDICFTTTTVPKMLVNIQTKNKNISYMQCLSQVYFFMVFAGM
DNFLLTVMAFDRFVAICHPLNYTVIMNPHFCCLLVLMCWMIILSVSMFHSLLMKQLTFSMGTEIPHFFCELAQILRVTNSDVLINNIALYVATALLCVFPVTGILYSYSQ
IVSSLLKMSSVVSKYRAFSTCGSHLCVVCLFYGTALGVYLSSAGTHVSQGSTIASVMYTVVTPMLNPFIYSLRNKDVKGALVRFLRVYSCPWWISIKKLSKHCHYLDKCC
GF*
771 >lcl|NP_001000864.1|Plus115602333..15603262 NW_047798 olfactory receptor Olr1179 Olr1179 __SEG__ Chr8 {Rattus norvegicus} MKMKNITHVSQFYLLRVSDDPELQPILCGLFLSMYLISVLGNLLIILTVSSFSHLHNPMYFFLSILSLVDIGFISTTVPNMVTELQTHNTAISYVGCLTQMSLFIIFACM
DSMLLAVMAYDRFVAICHPLHYAIIMNPCRCGTLVLISLLASLLESLLHNLVALQLKCFKDVAIANFFCHPSQLLNLGCNNTFNNNILMYAIGVILGVFPLSGILISYFK
IISSILSITSSSGRYKAFSTCGSHLAVVCLFYGTGLGEYFGSLLSHSSGNNMVASLMYTTVNPMLNPFIYSLRNQDISNSLKRLHFCTV*
772 >lcl|NP_001000865.1|Plus1complement(15474545..15475483) NW_047798 olfactory receptor Olr1177 Olr1177 __SEG__ Chr8 {Rattus norvegicus} MIHNDVKNLTDVLEFHLMAISEDPDLQLFLFGLFLSVYLVTVLGNLLIILLIIFDSHLHTPMYFFLSNLSLIDIFFISTTIPKMIVGLKIHSRVISYAGCLTQMSLFLLF
VCMDDMILTVMAYDRFVAICHPLRYTVIMNPQVCVILIVLSFPVSVFESQLHNLIAIQVTCFKDVEIANFFCHPSQLLNLACSNTLSSNIVIYFIGVILGIFPVLGIILS
YCKIVFSILKIPSSSRKYKAFSTCGSHLSVVCLFYGTGIGVYLGSAVSHSPQKNAVASLIYTAVSPMLNPFIYSLRNRDISSALKRFHSRVF*
773 >lcl|NP_001000867.1|Plus115130927..15131865 NW_047798 olfactory receptor Olr1166 Olr1166 __SEG__ Chr8 {Rattus norvegicus} MIHNDVKNLTDVLEFHLMAISEDPDLQLVFFGLFLSVYLVTVLGNLLIILIIIFDSHLHTPMYFFLSNLSLIDIFFISTTIPKMIVGLKMHSRVISYAGCLTQMSLFLLF
VCMDDMILTVMAYDRFVAICHPLHYTVIMNPQVCAVLILLSFSISVFDSQLHNLIAIQVTCFKDVEIANFFCHPSQLLNLACTNTLSSNIVIYFIGVILGIFPVLGIILS
YCKIVFSILKIPSSSSKYKAFSTCGSHLSVVCLFYGTGIGVYLGSAVSHSPQKNAVASLIYTAVSPMLNPFIYTLRNRDISNALKRFRSRFL*
774 >lcl|NP_001000868.1|Plus115093402..15094331 NW_047798 olfactory receptor Olr1165 Olr1165 __SEG__ Chr8 {Rattus norvegicus} MEPYNTTGNLEFILLGLSEDPELQPILFVLFVLIYLFTVLGNVLIILAISSDSHLHSPMYFFLYNLSLSDMGFSSTTIPKMLMNMHTNNKSITYAACLTQVSFFFLFACM
DSLLLTVMAYDRWVAICHPLHYQVILNPRLCKCLVIVSFCISLMDSQVHCLMVSQLKFCTNMNIPHFFCDVPELLKLACSDTSINNIVRFLFTIIFGFLPVSGIIYSYYK
IISSIIRVPSLFGKNKAFSTCGSHLSVVCLFYGTGIGVYLSSTVSNFSRDSVVASVMYSMLVPMMNPFIYSLRNRDMKKAVQSVFRQIA*
775 >lcl|NP_001000869.1|Plus1complement(15035489..15036427) NW_047798 olfactory receptor Olr1163 Olr1163 __SEG__ Chr8 {Rattus norvegicus} MEAENHTAIVQFLLIGLSEDPKIQSILFGLFLSMFLVTMLGNFLIVLLTSCDSHLHTPMYFFLCNLSFVDICLTSTTIPKMLVNIYMHTMEISYTECLTQVYFFNNFLGM
DNFLLTIMAYDRFVAICHPLNYTVIMNPRICGLLVLLSWIIMFWVSLIHMLLMKQLNFSTSTEIPHFFCELTELLRVARSDTHKNNIFLYLVTAVLGMFPVIGIAFSYFH
IVSALLKMSSIRNKYKAFSTCGSHLCVVSLFYGTGFVVHLSSVATHSSKRNAITSIMYTVVTPMLNPFIYSLRNKDVKGALVRLLRRVKFRL*
776 >lcl|NP_001000870.1|Plus114917102..14918031 NW_047798 olfactory receptor Olr1162 Olr1162 __SEG__ Chr8 {Rattus norvegicus} METYNLTRKLEFLLLGLSEDPELQFILFVLFLLIYLLTILGNVLIILAISSDSHLHSPMYFFLYNLSLSDLGFSSSTVPKMLINMQTHNKSITYAGCLTQVSFFILFGDM
DSLLLAAMAYDRWVAICHPLHYQVILNPRLCTYLLIVSFFISLLSSQVHCLMVSQLTFCTNMEIPHFFCDVPELLKLSCSDPSIDNIVRIVLSIILGFLPVSGILYSYYK
ITSSIFKVPSLLGKYKVFSTCGSHLSVVCLFYGTGIGVYLSSTVSSSSRENVVASVMYTMVVPMMNPFIYSLRNKDIKKALQKIVRKIL*
777 >lcl|NP_001000871.1|Plus114835705..14836634 NW_047798 olfactory receptor Olr1159 Olr1159 __SEG__ Chr8 {Rattus norvegicus} MEPYNLTGTFEFLLLGLSEDPELQPILFVLFLLIYLLTVLGNVLIILAISSDSQLHSPMYFFLYNLSLSDMGFSSTTIPKMLINMQTHDKSITFAACLTQVYFFFLFGGM
DSLLLAVMAYDRWVAICHPLHYQVILSPHLCKCLVIVSFFISLVSSQVHCLMVSQLTFCTNMEISHFFCDVPELVKLACSDTTISDIVMFLLSILVGFLPASGIFYSYYK
ITSSIFRVPSLLGKYKAFSTCGSHLTVVCLFYGTGIGVYLSSTVSSSSRESVVASVMYTMVVPMMNPFIYSLRNRDIKKALQKIFSKIS*
778 >lcl|NP_001000872.1|Plus1complement(14779002..14779943) NW_047798 olfactory receptor Olr1158 Olr1158 __SEG__ Chr8 {Rattus norvegicus} MEPENITTTSKFILLGLSKENDIQPLLFALFLFIYLVCIVGNMLIILIISSDAHLHTPMYFFLSNLSFTDICFISTTVPKMLVNIQAQNISITYEGCLTQMYFFMCFSGL
DSLLLTVMAYDRFVAICHPLHYMIIMSPHFCGTLLLLSWLFCLAYSLLQTLMFLRVSFCKKTEIPHYFCELAQILKLACSDTYANDVLLYCVTGLLGIIPLSGILFSYSK
IINSIVGISSARRKYKAFSTCGSHLSVVSLFYGTGLGVYLTSRTSYKSREGSITSVMYTVVTPMLNPFIYSLRNKDLKQALRRLFHTIRDRFH*
779 >lcl|NP_001000873.1|Plus114670166..14671104 NW_047798 olfactory receptor Olr1156 Olr1156 __SEG__ Chr8 {Rattus norvegicus} MEPQNQTFVLQFLLLGFTDDAEFQSLIFSLFLFIYLVTILGNLFIILGIAFESHLHTPMYFFLSNLSFNDISLSTATVIKMLVNIQANDQSITYTGCLTQLFFVLAFAYF
ENFLLTVMAYDRYAAICHPLRYNIIMNPKVCVLLSLISLFISIMDSLMHTLMVQRLSFCRNLEIPHYFCELDQVIKLSCSDTLIDNIVLFVATCVFGGVPLCGIIYSYYH
IVSAVLKIASLEGKYKAFSTCGTHLSVVSLFYGAGSMVYISSAISASPGKSAVASVMYSVVPQMMNPFIYSLRNKDMKVAIRNILSKTISLE*
780 >lcl|NP_001000874.1|Plus1complement(14438012..14438983) NW_047798 olfactory receptor Olr1149 Olr1149 __SEG__ Chr8 {Rattus norvegicus} MFHPLYQIYEQHEKRNQTAFPGFFLLGLTEDPKLQPVLVSLFFSIYLVTLLGNLLIIVISISDSHLHTPMYIFLSNLSLNDICLSTSTIPKMLVNIQENIQSITYKGCLT
QMSFVLIFSGMENCLLAVMAYDRYMAICHPLRYTVIMEPCFCVLLILLSLLISLVDSLMHSLMVLRLSFCRHLEIPNFFCELPKMLKLACSDTLIDNILIYISSCIFAGI
PLSGIVFSYIHIMSSIFRMPSSEGKHKAFTTCGSHLSVVSLFYGTGFGVYITSIIMDSSRKTAVASVMYSVVPQMLNPFIYSLRNREMKDAMRKFFKKMAYFL*
781 >lcl|NP_001000875.1|Plus114395827..14396765 NW_047798 olfactory receptor Olr1148 Olr1148 __SEG__ Chr8 {Rattus norvegicus} MEPANQTDISEFFLMGLTYVPEQQPLFFNLFLSMYLITIIGNLLIILVVSKDSRLHTPMYFFLCNLSFTDICTSTTTVPKLLLNIQIHDQSITYIGCLSQVCFVLTFFVL
ESCLLTVMAYDRYVAICQPLRYTIIMNPFLCIFLVLLSLLMSTVNALLHTLLLLPLSFCMKQNIPNFFCELGQITKLSCSNTFINILFIYTATMVFSVIPLSGIIFSYIQ
IMSSILKIPSAGGRHKAFSTCGSHLSVVTLFYGTGLGVYMNASVSNSSISNVITSMMYSVLPQMLNPFIYSLRSKEIKGSLRKLIVGIICFL*
782 >lcl|NP_001000876.1|Plus1complement(14168038..14168976) NW_047798 olfactory receptor 1144 Olr1144 __SEG__ Chr8 {Rattus norvegicus} MEKSNQTDFPVFLLLGLIEDTRLQPILVSVFFSIYLVTILGNLLIILISIYDSHLHTPMYLFLSNLSLNDICLSTSTIPKMLANIQENSQSITYKGCLTQMSFVLIFGGM
ENCLLAVMAYDRYIAICHPLRYTVIMEPCFCVLLILLSLVISVVDSLMHSLMVLRLSFCKHLEISNFFCELPQIIKLACSDILIDNILIYLSSCIFIGIPISGIVFSYVH
IISSVLRMASSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSIIMDSSRKTAVASVMYSVVPQMLNPFIYSLRNRDMKEAVRKFFSGMASFL*
783 >lcl|NP_001000877.1|Plus114115292..14116230 NW_047798 olfactory receptor Olr1142 Olr1142 __SEG__ Chr8 {Rattus norvegicus} MGAVNQTTISEFILLGLSDDPALQPFIFTLFLSIYLITTIGNLLIILAVCSDSQLHTPMYFFLCNLSFNDICLINTTIPKMLWNIQGENQTITYTGCLSQVCLILNFAGM
ENCLLVVMAYDRYVAICKPLKYTAIMNQYLCVMLLLFSLFLSIAHALFHTLMVMLLSFCTEIKIPHFFCELAQIIRLACSDNFINYVLIYTVSVLFFGVPVFGIILSYIN
ILSSVLRMSSLGGKYKAFSTCGSHLSVVSLFYSTGFGVHISSAFTDSPRKTVVASVMYTVVTQMLNPFIYSLRNKEMKKAFRKITSRIPFLL*
784 >lcl|NP_001000878.1|Plus1complement(13890951..13891889) NW_047798 olfactory receptor Olr1135 Olr1135 __SEG__ Chr8 {Rattus norvegicus} MDLKNQTAVSEFHLLGLTDNHKLLPLIFFMFLSMYLITVLGNLVIILAISSGSQLHTPMYLFLSILSINDICYSTVTIPKMLVNIQAHDDSISYIECLSQICFVSIFCGM
ENFLLAVMAYDRYVAICKPLRYTVIMNPIFCVLMILFSLFFSITDALLHSLMILKLSFCTELEIPHFFCELAQIIKLACSDTFLNNFLIFVAAFVFGGGPVCGIVFSYIY
IVSRVLRMPSSGGKHRAFSTCASHLSVVSLFYGTGFGVYISSALQDSLRNTAMASMMYSVVPPLLNPFIYSLRNREMKKALRTLVGRLIYLV*
785 >lcl|NP_001000880.1|Plus1complement(13721264..13722202) NW_047798 olfactory receptor Olr1126 Olr1126 __SEG__ Chr8 {Rattus norvegicus} MGFINQTIPSDFLLLGLSRDPELQPVMFGLFLFIYLVTVIGNMFIILAINLDSHLHTPMYFFISNLSLTDICTSTTTIPKMLVNMQEQNLSITFAGCLTQACFAMLFVSL
ECCLLAAMAYDRYVAICYPLRYTVIMNWYLCRLVILVSLLSSTANSLLLSLMMLWLSFCKNLEIPHFFCEITQVVKLACSDTSINIILIYIASFTFGGITFSGIIFSYIE
IVSSVLKIPSVKGRYKAFSTCGSHLSVITLFYGTGLSVCISSSVTDSPRMTAMASVMYTVVTQMLNPFIYSLRNKDMKEALTKVIGRMISLS*
786 >lcl|NP_001000881.1|Plus113655885..13656823 NW_047798 olfactory receptor Olr1125 Olr1125 __SEG__ Chr8 {Rattus norvegicus} MKRGNFSDPTEFHLMGLSDNQELQSVLFGAFLSIYLITVFGNILIILATAFDSNLHTPMYFFISNLSFIDICFTTTTIPKMLVNIQTQISSISYVGCLTQICFVLAFAGL
ENGILVMMAYDRFVAICHPLRYTVIMNPKFCGVMLLLSFLISILDALLHTLMALRLSFCTKVEIPHFFCELAHILKLACSNILINNILVYLVTSLLGVLPLSGIIYSYTR
IISSVLKIPSAAGKYKVFSTCASHLVVVILFYGTGFGVYLSSAGTHSTRKSAIASVMYTVVTPMMNPFIYSLRNKDMVEAFKKLISRITAPL*
787 >lcl|NP_001000882.1|Plus1complement(13566722..13567660) NW_047798 olfactory receptor Olr1122 Olr1122 __SEG__ Chr8 {Rattus norvegicus} MESKNQTDVSGFILMGITDDKALKPFIFSMFTSMYLLTILGNLLIILIVSTESNLQTPMYIFLSNLSFNDICLSTTIIPKTLVNIHAEEQSITYTGCLTQICFTLLFCSF
ESCLLSAMAYDRYVAICHPLNYMVIMSSQTCGQLILLSLIISLVNSGLLGLMMLRLSFCTNVEIPLFFCELAQVIKLACSDTLVNYILIYLATIILNGIPISGIIFSYTQ
IASSVFRMVSVKGKYKAISTCGSHISMVSLFYGTALGVYISSAVTTSVTNTAFAYVMCTLVPQMLNPFIYSLRNRDMEVALRKHISRVVCLL*
788 >lcl|NP_001000883.1|Plus1complement(12868410..12869375) NW_047798 olfactory receptor Olr1118 Olr1118 __SEG__ Chr8 {Rattus norvegicus} MQSRNHSTVLEFLLVGLTGDAQLQPLIFSLFLCIYLVTVLGNLLIILAVSSDLHLQTPMYFFLSSLSINDICLSTNTIPNMLINMITQNQSITYTGCLTQVWFVLVFTGL
ENCLLAVMAYDRYVAVCHPLRYSTIMNPSCCVLMVLVSLLLSLVFGLLHTLMVLHLSFCKDVEIPHFFCELAQLIKLSCSDTLINNILVYFASCIFGGIPISGIIFSYTH
ILSAVLRMPSSGRRYKIFSTCGSHLCVVSLFYGTILGVYISSSVTDSPEKSIVASVMYSVVPQMLNPFIYSLRNKDMKQALRKFITRLCAVLSSHVNFTEE*
789 >lcl|NP_001000884.1|Plus1complement(12846577..12847515) NW_047798 olfactory receptor Olr1117 Olr1117 __SEG__ Chr8 {Rattus norvegicus} MELKNQTAVSEFHLLGLTENHKLLPLIFIMFLSMYLITVLGNLIIILAISSGSQLHTPMYLFLSILSINDICYSTVTIPKMLVNIQAHDDSISYIECLSQICFVSIFGGM
ENFLLAVMAYDRYVAICKPLRYTVIMNPIFCALMILFSLFFSIMDALLHSLMVLRLSFCTELEIPHFFCELAQIIKLACSDTFLNNFLIFVAAFVFGGGPVCGIVFSYIY
IVSSVLRMPSSGGKHRAFSTCASHLSVVSLFYGTGFGVYISSAVTDSLRNTAMASMMYSVVPPLLNPFIYSLRNREMKKALRTLVGRLIYLV*
790 >lcl|NP_001000885.1|Plus1complement(12785239..12786177) NW_047798 olfactory receptor Olr1115 Olr1115 __SEG__ Chr8 {Rattus norvegicus} MELKNQTAVSGFHLLGLTDNHKLLPFIFAMFLSMYLITILGNLLIIMTISSVSQLHTPMYLFLSILSINDICLSTVTIPKMLVNNQAQDKRISYIECLTQICFASIFGDM
ENFLLAVMAYDCYVAICKPLRYTIIMNPIFCVVMVLLSLLFSITDALLHTLMILRLSFCTELEIPHFVCEMAQIIKLACSDTFLNNLLIFLAVIVFGGGPVCGIAFSYIY
IVSSVLRMPSSEGKHRAFSTCASHLSVVSLFYETGFGVYISSAVTDSLRNSAIASVMYTVVPPLLNPFIYSLRNREIKEALRKLFVKLTYLV*
791 >lcl|NP_001000886.1|Plus1856657..857595 NW_047596 olfactory receptor Olr1710 Olr1710 __SEG__ Chr20 {Rattus norvegicus} MIVKNITTMSGILLMGFSDNHELQILHALLLLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSLLDLSSLSVTVPQYVDSSLTRNGYISYGQCMMQVFSFIVLAWN
ELAILTVMSYDCYVAICLPLHYEVIMDPRKCTWAVTAVWLSGSISGTLYTASTLSIRFCGDKIIHQFFCDVPQLLKLSCSKDHLVIIGMIDFLSVIAFACFIGIIISYVH
IFSTVLRMPSAESRSKVFSTCLPHLFVFSLFLSSGACAYLNPTSDSPTALEFLFSVFYAVIPPTLNPLIYSLRNETIKSVVRKLLFSTKFTG*
792 >lcl|NP_001000887.1|Plus1792620..793558 NW_047596 olfactory receptor Olr1705 Olr1705 __SEG__ Chr20 {Rattus norvegicus} MIVKNITTMTGFLLMGFSDNHELQILQALLFLVTYLLGSAGNFIIITIITLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVESSLARSGYISYGQCMLQVFFFTALAWS
EMAILTVMSYDRYVAICLPLHYEVIMGPRKCTWAVAAVWLCGSIPGTLYTASILSIRFCGDKIIHQFFCDVPQLLKLSCSNDHLDIIGMIDFLSVITFACLIGIIISYVH
IFSTVLRMPSAESRSKVFSTCLPHLFVVSLFLSSGACAYLNPTSDSPTAFEFLFSVFYTVLPPTLNPLIYSLRNETIKSVVRKLLFSTKFTG*
793 >lcl|NP_001000888.1|Plus1complement(636663..637631) NW_047596 olfactory receptor Olr1692 Olr1692 __SEG__ Chr20 {Rattus norvegicus} MTARNITMSGFLLMGFSDNHDLQILQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMMQVFFFTALAWTE
MTILTVMSYDRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSITGTLYTASILSIRFCGDKIIHQFFCDIPQLLKISCSNDYIGVVKMTAFMSVLDFACFMGIAFSYCQI
FSTVLRIPSAEGRSKVFSTCLPHLFVVSFFLSTGICAYLKPTSDAPTALDHILSIFYTVLPPTLNPVIYGLRNESLKGAVKKLLLSAEFVGKNYFCSFVHDC*
794 >lcl|NP_001000889.1|Plus1complement(558685..559656) NW_047596 olfactory receptor Olr1689 Olr1689 __SEG__ Chr20 {Rattus norvegicus} MTARNITTMSGFLLKGFTDNHELQVLQALLFLVMYLLGSAGNFIIITITTLDPQLQSPMYYFLRHLSILDLSSLSVTVPQYVDSSLARSGYISYDQCMMQVFFFTAFAWT
EMAILTAMSYDRYVAICLPLHYEVIMSSRKCTWAVAAVWLSGSLTGTLYTASTLSIRFCGDKIIHQFFCDVPQLLKISCSNDYSGVLEVSTFVTVLAFACFVGIAFSYGQ
IFSTVLRIPSAEGRSKVFSTCLPHICVVSFFLSTGICAYLKPTSDSPTALDLILSIFYTVLPPTLNPVIYSLRNASLKGAVKKLLFREKFIGKNYFSSVVHAY*
795 >lcl|NP_001000890.1|Plus1complement(305479..306417) NW_047596 olfactory receptor Olr1682 Olr1682 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSILDPCLHSPMYFFLTNLSFLDICYTTSLVPQMLTNLGGSTKTISYMSCAVQLYFFHTMGVT
ECILLALMSFDRYVAICKPLHYTLIMNQRKCLLLVSIMWLTGITYAVTEATVTLQLPLCGHNKMDHLVCEIPVLIKIACGEKEMNELALSVVCIFLSAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFMSK*
796 >lcl|NP_001000891.1|Plus1complement(274512..275555) NW_047596 olfactory receptor Olr1680 Olr1680 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELSLFIILLVTYPTAVIGNIAIILVSILDPCLHSPMYFFLTNLSFLDICYTTSLVPQMLTNLGGSTKAISYMRCAVQLYFYHTMGVA
ECVLLALMSFDRYVAICKPLHYTLIMNQCNCLLLVSIVWLTGISFAITEATVTLQLPLCGHNKMDHLVCEIPVLIKIACGEKETNELALTVVSIFLSAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKRALANLFRNIFMQSEYLWMLYKVIYKLEAFST
THSLYKTHLSFYFYMFL*
797 >lcl|NP_001000892.1|Plus1complement(261423..262361) NW_047596 olfactory receptor Olr1679 Olr1679 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLSFADRPWLELPLFIFLLVTYPTAVIGNIAIILASILDPCLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLGGSTKAISYMRCAVQLYFYHTMGVA
ECVLLALMSFDRYVAICKPLHYTLIMNQCNCLLLVSIVWLTGISFAITEATVTLQLPLCGHNKMDHLVCEIPVLIKIACGEKETNELALTVVSIFLSAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKRALANLFRNIFMSK*
798 >lcl|NP_001000893.1|Plus1complement(247819..248757) NW_047596 olfactory receptor Olr1678 Olr1678 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELSLFIILLVTYPTAVIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLRSSTKTISYMRCAVQLYFYHTMGIT
ECVLLALMSFDRYVAICKPLHYTLIMKQRNCFLLVSIVWLTGISYSLTEATMTLQLPLCGHNKMDHLVCEIPVLIKIACGEKETNELALSVVCIFLLAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFMSK*
799 >lcl|NP_001000894.1|Plus1complement(212579..213517) NW_047596 olfactory receptor Olr1675 Olr1675 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSTIDPSLHSPMYFFLTNLSFLDICYTTSLVPQILTNLGSSTKTISYMSCAVQLYFFHTMGVT
ECVLLALMSFDRYVAICKPLHYSLIMNQHKCLLLVSIVWLIGISYGVTVATVTLQLPLCGHNEMDHLVCEIPVLIKIACGEKEKNELALSVVSIFLLAVPLCLILASYSS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYIQPPSSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFMSK*
800 >lcl|NP_001000895.1|Plus1164658..165596 NW_047596 olfactory receptor Olr1670 Olr1670 __SEG__ Chr20 {Rattus norvegicus} MTLTNTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSILDPCLHSPMYFFLTNLSFLDICYTTSLVPQMLTNLGGSTKTISYMRCAVQLYFFHTMGGT
ECILLALMSFDRYVAICRPLHYTLIMNQRKCLLLVSLVWLTGISYAFSEATVTLQLPLCGHNKMDHLVCEIPVLIKIACGEKETNELALSVVCIFLIAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPGISMYLQPPSSITKDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFKSK*
801 >lcl|NP_001000896.1|Plus1complement(1199859..1200788) NW_047596 olfactory receptor Olr1726 Olr1726 __SEG__ Chr20 {Rattus norvegicus} MNCTQAPGFILLGLSRDPEKWQLFFSIFLAFYLLGLSGNLLLLLAIGADVHLHTPMYFFLSQLSLVDLCFITTTVPKMLQTLWTGDGSISFSGCLTQFYFFAVFADMDNL
LLAVMAIDRYAAICHPLLYPLLMTPCRCEVLACGSWGVAHFVSLFYTLVLSQLYFQTNEGIPHFFCDIGPLLLLSCSETHLKDGLIMALSVVLGISALFCIISSYCCIFY
AVARVPSAEGKRKALATCSSHLSVVLLFYSTIFATYLKPPSTSHSSGEVVAAVMYTLVTPTLNPFIYSLRNKDVKSSLRRILNIEKSQD*
802 >lcl|NP_001000897.1|Plus1complement(356047..356994) NW_047712 olfactory receptor Olr837 Olr837 __SEG__ Chr5 {Rattus norvegicus} MESSNQTSPVSRFILLGLSAHPTLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGA
TECVLLSMMAFDRYVAICNPLRYPVVMSKAVYVPMATGSWAAGIAASLVQTSLAMRLPFCGDNVINHFTCEILAVLKLACADISINIISMGVTNVIFLGVPVLFISFSYI
FILSTILKIPSAEGRKKAFSTCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVLTPMLNPIIYSLRNKDVRAAVRNLVVLK*
803 >lcl|NP_001000900.1|Plus15983141..5984103 NW_047696 olfactory receptor Olr830 Olr830 __SEG__ Chr4 {Rattus norvegicus} MAKEAEVRMEAWNETTVLAFVLEGFLVAPRLGKALFLVHLLVYLASVTGNTLIIAITWADPRLQTPMYFFLRSFSICECCFISTVIPKLLSIFLFGDRTIHFAPCIIQAF
SFLFLGSTIFFHMAVMSLDRYLAICKPLHYPAIMNPRVCFLLVFLSYVLSFLLVTGVILKLSWLSFCGSNVIPHFFCDLGSLIHLSCSDTKSLEKMAFGVALVILFTSVL
AAIFAYSNILISIMRLPSAKERQKAFSTCSSHLMVLSLMYGSCVFIYVKPKQTSRFESNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDALSRVNLQK*
804 >lcl|NP_001000901.1|Plus15967414..5968397 NW_047696 olfactory receptor Olr829 Olr829 __SEG__ Chr4 {Rattus norvegicus} MEWLMAKEIKNGTLVLEFIFDRFPVAEHLRILFFLLHLLAYLASLMGNMLIITITCVDHRLQTPMYFFLSTFSFVECCFITTVIPQLLTIILSGRQKIPFMACISQAFVY
LVVGATLFFLMAVLSLDRYLAICKPLHYPTIMSPRMCFLLVTVSLFLGFLFMASPVVMLSQSFYCGPNIIPHFFCDFGPLANLSCSETRSIEMLFFTLAIIVLFASLLIA
IFAYSNIVVTIVRLPSARERQRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDTNREAALVNTVVTPLLNPVIYTLHNKQVHQALSDALSRVQLHRYQRSNAPSL*
805 >lcl|NP_001000902.1|Plus15907364..5908347 NW_047696 olfactory receptor Olr827 Olr827 __SEG__ Chr4 {Rattus norvegicus} MEWLMAEETRNGTLVQEFILEGFPVAEHLRILFFLLHLLAYLASLMGNMLIITITCVDHRLQTPMYFFLSSFSFVECCFITTAIPQLLTILLLGRQKIPFGACFSQAFVF
FFLGATVFFLMAVLSLDRYLAICKPLHYPTIMSPRMCFLLVTVSLVLGFLFMSSPVVMLSKTFYCGPNIIPHFFCDFGPLANLSCSETRSIEMLFFNLALIVVFTSFLIA
IFAYSNIVVTIVRLPSARERQRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDSNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDALSRVQIHRYQRSNVPSL*
806 >lcl|NP_001000903.1|Plus15885605..5886588 NW_047696 olfactory receptor Olr826 Olr826 __SEG__ Chr4 {Rattus norvegicus} MEWLMSEETRNGTLVQEFILEGFPVAEHLRILFFLLHLLAYLASLMGNMLIITITCVDHRLQTPMYFFLSTFSFVECCFITTVIPQLLTIILSGRQKIPFGACFSQAFVV
LFLGATVFFLMAVLSLDRFLAICKPLHYPTIMSPRMCFLLVTVSLVLGFLFMASPVVMLSQSFYCGPNIIPHFFCDFGPLANLSCSKTRSIEMLFFTLAIIVLFASLLIA
IFAYSNIVVTIVRLPSARERQRAFSTCSSHLIVLSLMYGSCVFIYLKPKQRSRVDTNREAALVNMVVTPLLNPVIYTLRNKQVHQALRDALSKVQLHRYQSRKAPLS*
807 >lcl|NP_001000904.1|Plus15861313..5862296 NW_047696 olfactory receptor Olr825 Olr825 __SEG__ Chr4 {Rattus norvegicus} MEWLMTEETRNGTLVLEFILEGYPVAEHLKILFFLLHLLAYLASLMGNMLIITITCVDHRLQTPMYFFLSTFSFVECCFITTAIPQLLTIILSGRQKIPFGVCFSQAFVY
LVVGATGFFLLAALSLDRFLAICKPLHYPTIMSPRMCFLLVTVSLVLGFLFMASPVVMLSQSFYCGPNIIPHFFCDFGPLANLSCSETRSIEMLFFTLAVIVLFASLLIA
IFAYSNIVVTIVRLPSARERQRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDTNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDALSKVQLHRYQRMKAPFL*
808 >lcl|NP_001000905.1|Plus15836040..5837023 NW_047696 olfactory receptor Olr824 Olr824 __SEG__ Chr4 {Rattus norvegicus} MEWVMAEETRNGTLVQEFILEGFPVAEHLRILFFLLHLLAYLASLMGNMLIITITCVDHRLQTPMYFFLSSFSFVECCFITTAIPQLLTILLSGRQKISFGACFSQAFVY
LVLGATVFFLMAVLSLDRFLAICKPLHYPTIMSPRMCFLLVTVCLFLGFLFMASPVVMLSQSFYCGPNIIPHFFCDFGPLANLSCSETRSIEMLFFTLAIIVLFASFLIA
IFAYSNIVVTIVRLPSARERQRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDSNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDALSRLQLHRYQRRKAPFL*
809 >lcl|NP_001000906.1|Plus1complement(3780730..3781689) NW_047784 olfactory receptor Olr1104 Olr1104 __SEG__ Chr7 {Rattus norvegicus} MGNVSAVSEFILLGLSADAQVQAVLFMVFLVIYVLTLTGNSMILLAISTDARLRSPMYFFLGHLSFLDLLYSSVSMPKMLENLVSERKTISVKGCLAQAFFVFAIGGTEA
LLLAVMAYDRYAAICHPLLYHQMMSNWFCQGLVWGSWSLAILNSLINTLLAVNLDFCHHGTVHNYNCELPSLFPLSCSDVSTNVTALLWTFLVHASGTFLLMVCSYGCVF
STILNMSSTRGRSKAFSTCSSHLTVVTLYFGSAFLRYVLPTSGSPVETFFSLQYSVITPLLNPFIYSLKNKEVKTAMRKLLGRCCQHFGYVGRRRRVKS*
810 >lcl|NP_001000909.1|Plus17435147..7436124 NW_047399 olfactory receptor Olr1602 Olr1602 __SEG__ Chr13 {Rattus norvegicus} MVIKVLQIDNWTVTTHFILLGFPTRPAFQFLLFSVFLVTYLLTLVENLLIILAIRSDGQLHKPMYFFLSHLSFLEMWYVTVISPKMLVDFLSKDKSISFNGCMTQLYFFV
TFVCTEYILLAVMAFDRYVAICNPLRYPVIMTNQLCGILAGGCWFCGLMTAMIKMVFIARLRYCGTPHINHYFCDISPLLNVSCEDSSQAELVDFFLALMVIAVPLCVVV
TSYAIILVTILKIPSAQGRQKAFSTCASHLTVVTLFYSTTLFTYARPKLMYAYNSNKVVSVLYTVIVPLLNPIIYCLRNRDVKMALKKTILCNRSEPGGDGGFSS*
811 >lcl|NP_001000910.1|Plus17336469..7337401 NW_047399 olfactory receptor Olr1598 Olr1598 __SEG__ Chr13 {Rattus norvegicus} MMINQTILKEFILVGFSVYPHVQTALFVIFFCLYMFTLAGNLVIMGLTWVDRSLHAPMYFFLSALSFSETCYTLTIIPKMLVDLLDKDSHISVTGCGLQMCFFLGIGGTN
CILLTLMGYDRFLAICNPLRYPLLMTNVACGQLVASAWVGGFFISLIETTLIFRVPFCIPNLIRHFFCHMRAVLRLSCTDSNFTEFIVTLMSASGLLGTFLLILLTYVFI
LSSVLKIPSAEGKQKAFSTCASHLTVVIIHFGFASVVYLKPENSGGDDTLIAVPYTVITPFLSPIIFTLRNKDMKNAFKKIMRKTVIMKK*
812 >lcl|NP_001000911.1|Plus1complement(7320443..7321384) NW_047399 olfactory receptor Olr1597 Olr1597 __SEG__ Chr13 {Rattus norvegicus} MIQNNATCLHDFVFLGFSSFGELQLLLFVLFLSLYLVTITSNIFIIIVIRLDSHLHTPMYLFLSFLSFSETCYTLGIIPRMLSGLVMGGQVISFMGCATQMFFSASWACT
NCFLLSVMGFDRYVAICAPLHYASRMNPTVCAQLVGTSFLSGYLFGMGMTLVIFRLSFCSSHEIQHFFCDTPPVLSLACGDTRLSELGILILSLLVLLVSFFLISVSYVY
ILVAILRIPSADGRRKAFSTCASHLTVVVIHYGCASFMYLRPKASYSLERDQLIAVTYTVATPLLNPIVYSLRNRAVQTALRNAFRGNLLGKG*
813 >lcl|NP_001000913.1|Plus17100645..7101583 NW_047399 olfactory receptor Olr1587 Olr1587 __SEG__ Chr13 {Rattus norvegicus} MDHVNYTWTRTFILAGFTTSGTLQQLSVFGTLCIYLLTIAGNIFIIVLVQADSGLSTPMYFFISVLSFLEIWYVSTSVATLLHTLLHGHSPIPSAACFIQLYVFHSLGMT
ECYLLSVMALDRYLAICRPLHYHALMSRQVKIQLVLITWVAGFSVALVPAGLTASLPYCLKEVAHYLCDLEPVIRLACVDTSWHARVYITVIGIIITCNLVSILGLYGGI
AKAVLRLPSAASRAKAFSTCSSHITVVTLFYGSAFIVYVGPPEIRAEGRDKLIALVYTLFTPFFNPIIYTLRNKEVKAAFKRVTQRIQGVLS*
814 >lcl|NP_001000914.1|Plus1complement(10526547..10527497) NW_047627 olfactory receptor Olr392 Olr392 __SEG__ Chr2 {Rattus norvegicus} MMTLSWENQTVIVEFVLRGFSSILQLNISLFIMFCIFYILTISGNILIVLLVLCNHALHTPMYFFLVNLSFLEVCYTSNIVPKMLLIIIADLKTISVVGCLAQFYFFGSL
AATECLLLAVMSYDRYLAICQPLRYPILMTGSLCFRLATGSWFCCFFLTAITMVLLCRQNFCGPNEIDHFFCDFAPLIHLSCMDTSLTETIAFATSSAVTLVPFFLITVS
YSCILTAILRIPSGTGRRKAFSTCSSHLTVVTVFYGTLIATYLVPSSNSSQYLHKGFSLLYTILTPMFNPIIYSLRNRDIHGALKKCLSKKSGFII*
815 >lcl|NP_001000915.1|Plus1complement(39231150..39232088) NW_047657 olfactory receptor Olr790 Olr790 __SEG__ Chr3 {Rattus norvegicus} MEGKNYSVVSEFMFVGLTNSWKMEILLFVFASVFYMGSMMGNSLIIFTVASHPHLHSPMYFLLANLSFIDLGVSCVTCPKMIYDLFRKQKVISFNGCITQIFFIHVIGGV
EVMLLVGMAYDRYIAICKPLHYLTIMNAKMCIFILVASWVVGLMHSLVQFVYIVNLPFCGPNILDSFYCDLPRLLRLACVDTNQLELMVSANSGFISVGSFFILVISYIV
IIVTVQKHSSSGSSKALSTLSAHISVVILTFGPMIFIYTWPSHSTHLDKYLAIFDAVGTPFLNPVIYTLRNQDMKMAMKGVCRQLLKYGKIS*
816 >lcl|NP_001000916.1|Plus139035154..39036089 NW_047657 olfactory receptor Olr786 Olr786 __SEG__ Chr3 {Rattus norvegicus} MKKVNYSVTSEFVFLGFTNSWDIQLLLFLVSSMFYVACIMGNCLIIFTVASDTHLHSPMYFLLANLSFIDVGISSATSPKMISDLLKKHKVISFRGCVIQIFFNQAIGGA
EMVLLIAMAFDRYVAICKPLHYLTMMSPQMCLFFLITAWVVGLMHSVIQLIFIVNLPLCGPNILDSFFCDLPQFIKLACMNTYRLELLVSISSGFMSLVSFFLLSISYIV
IILTVLKHSSSGAYKALSTLSAHVTVVVLFFGPAIFFYIWPSSTHLDKFLVLFDAVVTPFLNPVIYTLRNKEMKRAMRRVFRHLMGYRQIS*
817 >lcl|NP_001000917.1|Plus1complement(38910546..38911484) NW_047657 olfactory receptor Olr779 Olr779 __SEG__ Chr3 {Rattus norvegicus} MEGVNQSVVSEFVFLGLTNSWSIQLLLFVFSSMFYVASMMGNSLIVFTVASDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHKVISFTGCVTQIFFIHVIGGV
EMVLLIAMAFDRYVAICKPLRYLIIMSPRMCIFFSVTAWVVGLMHSLVQLAFVVNLPFCGPNMLDSFYCDLPRFIRLACIDTYQLEFMVTANSGFISVGSFFILIISYIV
IIMTVQKHSSSGSSKALSTLSAHISVVVLFFGPLIFFYTWPSPSTHLDKYLAIFDAVITPFLNPVIYTFRNQEMKIAMKRVCRQLISYRKTS*
818 >lcl|NP_001000918.1|Plus1complement(38777426..38778364) NW_047657 olfactory receptor Olr774 Olr774 __SEG__ Chr3 {Rattus norvegicus} MDRKNYTVVSEFVFLGLTHSWEIQLLLLVVSSVLYILSMTGNILIVFSVTIDPHLHSPMYFLLAGLSFIDLAACSVTSPKMVYDLFRKHKVISFGGCITQIFFIHLVGGV
EMVLLVAMAFDRYVAICKPLHYLTIMSPRVCTLFLAAAWGLGTSHSLFQLAFLIDLPFCGPNVLDSFYCDLPRLLRLVCKDTYKLQFMVTINSGFICVGSFLLLLISYIF
ILFSVWKHSSGGSSKALSTLSAHITVVFLFFGPTLFVYTWPHPHSQIDKFLAFFDAVLTPFLNPVIYTFRNKEMKVAIKRVFKALLTFRNIS*
819 >lcl|NP_001000919.1|Plus1complement(38581158..38582096) NW_047657 olfactory receptor Olr768 Olr768 __SEG__ Chr3 {Rattus norvegicus} MDEANQTVVSEFILWGLSNSKSIQLFLFVILLMLYLLIMSGNIVILILITTDPHLLSPMYFLLANLSFVDMWLSSVTTPKMITDFLRENKTISFAGCMSQVFFAHCIAAG
EMVLLVVMAYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTIGFTHGISHLLVVVQLPYCGPREIDSFFCDMPLVIKLACMDSHDLNTLMNVECGVVAVTCFILLLISYTN
ILITVCQSTKAGVLKALSTCAAHITVVMIFFLPCIFIYVWPLSITWLDKFFAVFYSVFTPLLNPTIYTLKNKKIKNAMKRFIGKYLGLNINS*
820 >lcl|NP_001000921.1|Plus138319927..38320844 NW_047657 olfactory receptor Olr753 Olr753 __SEG__ Chr3 {Rattus norvegicus} MEEANQTVVSEFIFQGLCASKELQIFLLLPFSTLYLLTVVGNLFVVILIIIDHHLHSPMYFLLANLSFIDFCLSSVTTPKLTTDLLKDNKTISFGGCMSQILCVHFFGGG
EMVLLVTMAYDRYVAICRPLHYSSIMDRQKCIWLVLISWIIGFIHAMSQLILILELPFCGPKVIDSFFCDIPLVMKLACMNTDTLGIVINADSGVLATTCFILLLISYTY
ILLTVQLHSKDGSSKALSTCTSHVIVVVLFFGPCIFIYLWPVSITWVDKFLAVFYTVVTPLLNPAIYTLRNKDIKNAIKKLMNHM*
821 >lcl|NP_001000922.1|Plus1complement(15972100..15973029) NW_047657 olfactory receptor Olr735 Olr735 __SEG__ Chr3 {Rattus norvegicus} MAAASNVTEIIFLGLSQSQHVQKVIFVMFLLMYTAIVLGNGLIVVTVMASKGLSSPMYFFLSYLSLVEVCYCSVTAPKLIFDSLLKRKVISLQGCITQIFFLHFFGGTEI
FLLTVMAYDRYVAICKPLHYVTIMNRRVCGLLVGAAWSGGLLHSAGQTFLIFQLPFCGPNVIDHYFCDVHPVLKLACSDTFLISLLVIINGGSISVISFAVLLVSYVVIL
HSLRSHTAEGRYRALSTCASHLAVVGLFFIPCSFVYMRPCVTLPVDKVVAVFYTVVTPLLNPIIYSFRNTEVKNAMRRLVGRKVTWEEK*
822 >lcl|NP_001000923.1|Plus1complement(15524731..15525684) NW_047657 olfactory receptor Olr714 Olr714 __SEG__ Chr3 {Rattus norvegicus} MGQSKIVTEFVLLGFTQDPAGQKALFVMFSLMYIATMVGNLLIVGTVIVSPSLGSPMYFFLASLSLMDAVYSTAISPKLIVDLLREKKTISFRACISQLFIEHLFGGVDI
VILVAMAYDCYVAICKPLHYLIIMNRRVCILFLVMAWAGGFAHALFQVLAVYNLPFCGPNIIDHFGCDIYPLLLLACTDTYLIGLTIIANGGAMCIVIFILLLLSYAIIL
RSLQNHSQEGRHKALSTCSSHITVFFLFFVPCILMYVRPVSSFPIDKSITVIYTVVTPVLNPLIYTLRNSEMKNSMEKLLQKILSPNRLRLLCCLYY*
823 >lcl|NP_001000924.1|Plus1complement(14527076..14528011) NW_047657 olfactory receptor Olr666 Olr666 __SEG__ Chr3 {Rattus norvegicus} MHNQSFVNEFILLGFSQNPQIKKISFVIFLLVYIATLVGNMMIVVTIVYSPALLGSPMYFFLAFLSFLDACVSSVVTPKMIVDMVYERKSISFECCMTQVFAVHFLSAVE
VTVLAAMAYDRYVAICKPLHYSFIMNRRLCGSLVGVAWAGGFLHSIIQIAFTLQLPFCGPNVIDHFICDLFPLLKLACTDIHIFIILVFANSGSFCIIIFSFLLISYGVI
LFSLRAHSSEGRRKALSTCGSHITVVVLFFVPCILIYARPTSAFSFEKNVFVFIDVLTPLLNPMVYTFRNKEMINAIRKMWKRLIVVSDKY*
824 >lcl|NP_001000925.1|Plus1complement(14375920..14376846) NW_047657 olfactory receptor Olr661 Olr661 __SEG__ Chr3 {Rattus norvegicus} MGYGNITEFILLGLFHDEDVKAICAVLFLLCYLAILCGNLIVLLTIKGSQLSEQPMYFFLSYLSFMDVCFTSTVAPKFIIGLLVQCNTISYNACIAQMFYAHFFGATEIF
ILVVMAYDRYVAICRPLYYMITMSRQVCYILVIGSVFGAFIHSLVHVLVIIRLPFCGTNEIDHYFCDIFPLLKLACTETRLLVIVIITTTGVMSILTFVALVISYIIILS
ILRTRSSEGRRKALSTCGSHITVVFMFFLPLIFTYVPMGDSVGDDKVFALFYTMIAPLFNPLIYTLRNTDMKNAMRKVWCQDKLFEGK*
825 >lcl|NP_001000926.1|Plus1complement(13355853..13356809) NW_047657 olfactory receptor Olr611 Olr611 __SEG__ Chr3 {Rattus norvegicus} MASEVTNQTSATTFILVGFSEYPQLQISLFLLFLAIYSVTLMGNLGILVVIKINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLQILIMEDRTISFTGCMIQFFFICTFV
ITEMFMLAVMAYDRFVAVCNPLLYTVVMPFQFCALLVAGTYMIGGLCALVLVYTLLQLSYCEYGIINHFGCEYSAVISVSCSDSSFSQITCLVISIFSEISSVLVTLASY
VFIVVTIIKMPSKGGLQKAFSTCTSHLTAITIFHGILLLLYCVPNSNSSQLFVKVATVLYTVMVPMLNPLIYSFRNKDVKDTVRRLISSKLNSHSIWL*
826 >lcl|NP_001000927.1|Plus113272016..13272957 NW_047657 olfactory receptor Olr606 Olr606 __SEG__ Chr3 {Rattus norvegicus} MSLENNTVKTEFLLLGFSDHPELQSLLFVVFFSIYSVTLMGNIGMILLITVSSNLHIPMYFFLCILSFIDACYSSVIAPKLLVNLISDKKVISYNGCATQLYFFCSLVDT
ESFLLSAMSYDRYIAICNPLLYTVIMSKRVCIQLAFGAFLGGTMSSIIHTTNTFQLSFCSKEINHFFCDISPLFSLSCSDTYTHDIILVVFASLVEALSLLTVLLSYMYI
IVAIFKIGSAEGRKKGFSTCASHLTVITIYHGTLIFIYLRPSTGHSMDIDKMASVFYTLIIPMLNPLIYSLRNKDVKFAFRKIISKKIVFLTK*
827 >lcl|NP_001000928.1|Plus112872851..12873783 NW_047657 olfactory receptor Olr583 Olr583 __SEG__ Chr3 {Rattus norvegicus} MDNRNCTSVPEFLLLGITNKPEMKVALFTVFLIVYLTILLTNVGMITLITMDPQLHTPMYFFLSHLSFSDLCYSTAVGPKMLLDLLEDNNPISFVGCFLQLLIVSIFIDV
ECMLLAVMAFDRYKAISNPLMYTVDMSSRVCYQFLTGIYLLGTIDSFIHTSLAFSLCFCHSTQINHFFCDLPPVLLLSCSDTHVNELVLFTLFGFIELSTISGVLVSYCY
IISSVLKISSTGEWFKAFSTCASHLTAVGIFQGTMLFMYFRPSSAYSLDQDKMTSVFYLLIIPMINPLIYSLRNKDVKEALVRLRSKRWL*
828 >lcl|NP_001000930.1|Plus1complement(11420683..11421609) NW_047657 olfactory receptor Olr520 Olr520 __SEG__ Chr3 {Rattus norvegicus} MKNITEATSFVFKGLTDNKELQIILFFLFLAVYLFTLIGNIGLIFLVVGDPQLHNPMYCFLSALSSVDACYSSDITPNMLVGYMSNSKIISIHGCATQMFFAVTFGTTEC
FLLAAMAYDRYEAIHNPLLYAVSMSPKVYVPLIVASYAGGILHAIIHTAATFSLSFCQSNEIKHIFCDIPPLLAISCSETYINELLLLLFVSFIELVTILIILFSYAFIF
LSILKMNSSEGRRKVFSTCGSHLTAVSICYGTSLFMYVRPSSNYSLEHDMIVSIFYTIGIPMLNPIIYSLRNKDVKEAMKRVLRKISN*
829 >lcl|NP_001000931.1|Plus1complement(10985875..10986816) NW_047657 olfactory receptor Olr499 Olr499 __SEG__ Chr3 {Rattus norvegicus} MENHNRTVVTEFILMGITDHHGLQPSLFCLFLLIYLISLVGNLGMIVLTMVDSKLQTPMYFFLRHLATADLGYSTAVGPKMLTNFIVHQNRISFNLCATQLTFFLLFIAC
ELFILSAMSYDRYVAICKPLFYTVIMSKRLCWVLVVIPYLYCTLVALLITTKIFTLSFCGSNVISHFYCDSLPLLSLVCSNTEEIEVIMLFLSAFNLISSLLLVLVSYLL
ILIAILRMNSAEGRRKAFSTCGSHLTVVTVFYGTLIFMYMQPKSSHSFDTDKVASVFYTLIIPMLNPLIYSLRNKDVKDALHRTGKRLRSVCF*
830 >lcl|NP_001000932.1|Plus1complement(10899657..10900595) NW_047657 olfactory receptor Olr491 Olr491 __SEG__ Chr3 {Rattus norvegicus} MEKRNFTVVTEFILMGITDRPELQAPLFGLFLIIYLISLMGNMGLIILTMVDSRLQTPMYFFLRHLAITDLGYSTAIGPKMLVNFIVNQNTITNHLCATQLTFFLVFIIC
ELFILSAMSYDRYVAICKPLLYTVIMSHRVCWVLVAVPYFYSVIISLLITIKIFALPFCGYKIISHFCDSLPLISLLCSNTHDIEIIILISAGFNLVSSLVVLLFSYLLI
LIAIFRMNSAEGRQKALSTCGSHLTVVIVFYGTLIFMYVQPKSSHSFDSDKVASIFYTLIIPMLNPLIYSLRNKDVKYALERLWKVLGNIFS*
831 >lcl|NP_001000933.1|Plus1complement(10887631..10888572) NW_047657 olfactory receptor Olr490 Olr490 __SEG__ Chr3 {Rattus norvegicus} MEQKNTTSLPGFILMGVTQSTELQLPLFGIFFIIYAVTVMGNLGMIILTKLDSRLQTPMYFFIRHLAFIDLGNSTVICPKMLVDFVMNEKNISFYACATQLSFFLLFIIS
EFFILSAMAYDRYVAICNPLLYGVIMSQRRCHMLVGIPYLYSTFQALLFTSKIFTLSFCGSNIISHFYCDDVFLLPMLCSNAEEMQLLIILFSALNLISSLLVVLGSYIL
ILLAICRMHSAEGRRKAFSTCGSHLTVVVVFYGTLFFMYLQPKSTHSLENDKIASVFYTLVIPMLNPLIYSLRNKEVKNAFYRVLKNQFKIKT*
832 >lcl|NP_001000934.1|Plus110499018..10499971 NW_047657 olfactory receptor Olr463 Olr463 __SEG__ Chr3 {Rattus norvegicus} MVRTLKGDQDKNDTEVTEFILLGLSDNPDLQCILFALFLVIYMVTLVGNLGMMALIKIDRSLHTPMYFFLSSLSFVDVSYSSSVTPKMLVNLMAEDKGISFNGCATQFFF
FGSFLGTECFLLAMMAYDRYAAIWNPLLYPVLVSGKICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNKINHFYCDTPPLLKLSCSDTRINGIVIMAFSSFNVISCVLI
VLISYLCILIAILKMPSAEGRHKAFSTCASHLMAVAIFFGTILFMYLRPSSSYSMQQDKVVSVFYTVVIPMLNPLIYSLKNKDVKKAVKKILQNCVL*
833 >lcl|NP_001000935.1|Plus115972067..15973047 NW_047561 olfactory receptor Olr36 Olr36 __SEG__ Chr1 {Rattus norvegicus} MENIACNGSGDSQTSFYLIGIPSLQKSLFLPVFFIFLLLYLLILVGNTLILVAVVAEPSLHKPMYFFLINLSALDIFSTTTTVPKLLALFLLEDHFLSFPACFLQMYLFH
GFNCSEAFILVVMAYDRYVAICCPLHYPVHMTPQTNTALAASAWITALLLPIPAVVQTSHMAFDNIAYIYHCFCDHLAVVQASCSDTSPQTLMGFCIAMVVSFLPLILVL
LSYVRILISVLRINSKEGRSKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLALDFHIVGNVVFAILTPVLNPIIYTLRNKDVKAAITKIIYIKIQAVIGILTFKSS*
834 >lcl|NP_001000936.1|Plus1complement(1668938..1669879) NW_047561 olfactory receptor Olr27 Olr27 __SEG__ Chr1 {Rattus norvegicus} MSNVSRITGFILMGFSDVPELQTVCGLFFLVMYLAVIMSNFLIITLITVDLKLQTPMYFFLKNLSLLDVLFISVPIPNFFINSITHNNSISILGCALQVILMTSFASGDL
FVLTAMSYDRYIAICSPLHYEAIMSRSNCVLMLGVSWATGVLFGTLYTAGTFSLPFCGSCVISQFFCDVPSLLRISCSDTLVVIYTSLGIGVCLGISCFICVVISYFYIF
STVLKIRTTKGQSKAFATCLPHLTVFSVFIVTACFVYLKPPSNIASISDRVFSVLYIVLPPALNPVIYSLRNTDIKCSLRSLQQNLCPRRYFT*
835 >lcl|NP_001000938.1|Plus16335592..6336527 NW_047773 olfactory receptor Olr995 Olr995 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIQLQILLFIFLLLSYMLSLSGNLTIITLTLIDPRLKTPMYIFLKNFSFLEISLTTACIPRFLYSISSGDKSITYIACVSQLSFIDLFAVTEFF
LLAIMSFDRYVAICKPLHYMTIMNSRVCKNFIFFCWVVALIIILPPISLGLCLEFCDSDIVDHFCCDAAPLLKISCSDTWLLEQMLIVGAVLTFIITFVCVVLSYVYIIK
TILRFPSAKQKKKAFSTCSSHMIVVSITYGSCIFIYIKPSSKNDAAVNKGISLIIISISPMLNPFIYALRNKQVKQAFNYSVKKIAFLSKV*
836 >lcl|NP_001000940.1|Plus1complement(3294433..3295368) NW_047773 olfactory receptor Olr894 Olr894 __SEG__ Chr7 {Rattus norvegicus} MNHTEIVEFILLGLSDDPDLQIVIFLFLLITYILSVTGNLTIIVLTFVDSHLQTPMYFFLLNFAFLEVSFTSVCIPRFLGSIVTRNKTISYNNCAAQLFFFIFMGVCEFY
ILTAMSYDCYVAICKPLHYTTIMNRKLCTLFVLCAWLGGFLTVFPPLMLLLQQDYCASNVIDHFACDFFPLLQLSCSDTLVLEVIGFYIALVALLFTLALVILSYMYIIR
TILRIPSTSQRKKAFSTCSSHMIVISLSYGSCIFMYVNPSAKEKASLTKGVAILNTSVVPMLNPFIYTLRNQQVKQAFKGVVHKLVFSVSR*
837 >lcl|NP_001000941.1|Plus1complement(12100017..12100946) NW_047773 olfactory receptor Olr1077 Olr1077 __SEG__ Chr7 {Rattus norvegicus} MEPRNNTRILEFILLGFSQDPNLQPVIYGLFLSMYLISVVGNLLIILTIISDANLHTPMYFFLSNLSFVDICFTSTTVPKMLVNIQTERKSISYAGCITQMYFFLTFVEL
DNFLLAVMAYDRYVAICHPLHYTSIMNCRLCGFLVLICWTVSVLHALLQSMMVLRLAFCTDLEIPHFFCELNQVAQLTCSDTFLNDVIMYFALVLLAVVPLLGILYSYSK
IVSSIRAISTVQGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAVSHSSQASATASVMYTVVTPMLNPFIYSLRNKDVKGALKRLLGVKL*
838 >lcl|NP_001000945.1|Plus1complement(4581102..4582031) NW_047355 olfactory receptor Olr1535 Olr1535 __SEG__ Chr11 {Rattus norvegicus} MGIENATLLTEFVLTGLSHLPQWKIPLFLLFLVIYLITIVGNLGLITLIWNDPHLHIPMYLFLGSLAFVDTWLSSTVTPKMLLDFFTKSKLISFSECMIQFFSFGISATT
ECFLLAAMAYDRYVAICKPLLYPVIMTNRLCVRLLTMSFIGGFIHVLIHEGFLFRITFCDSNVIHHFYCDIMPLLKISCSDPSLNYLMLFILSGSIQVFSILTILISYTL
VLFSILKQKSIKGIKKSFSTCGAHLLSVSLYYGSLLFMYVRPASPQVDDQDMMDSVFYTVIIPVLNPIIYSLRNKQVKNSLEKLLKRNT*
839 >lcl|NP_001000946.1|Plus18414136..8415068 NW_047562 olfactory receptor Olr260 Olr260 __SEG__ Chr1 {Rattus norvegicus} MDPGTHTTVTEFILLGLTNDPTLCVMFFVFFLGIYIVTLLGNISIINLVRSCPQLQTPMYMFLSHLAFVDIGYSTSVTPIMLIGFIVHGAVLSVHACEAQLCSVVTFGTA
ECFLLAAMAYDRYVAICSPLLYSTHMSSQICLLLVGASYVGGCINAWTFTGCLLNLSFCGANQIDHFFCDFSPLLKLSCSDVSIIGIIPSISAGSIIVVTVFVIAVSYIY
ILITILKMHSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSSYSTKQNRIVSLFYTVVIPMLNPLIYSLRNRDVKEVLRKATVRIYS*
840 >lcl|NP_001000947.1|Plus1complement(8292377..8293348) NW_047562 olfactory receptor Olr255 Olr255 __SEG__ Chr1 {Rattus norvegicus} MAFLEGENYTAVTEFILLGLTDDPVLRVILFTIIICIYLVTVSGNLSTILLIRVSSQLQHPMYFFLSHLGSADLGYSSSVTPNMLVNFLIKQNTISYLGCSIQFGSAAFF
GGLECFLLAAMAYDRFVAICNPLLYSTKMSTQVCIQLIVGSYIGGFLNASFATASFFSLFFCGPNRINHFYCDFAPLIELSCSDVSVPVVVTSFSAASITMLTVFIIAIS
YTYILITILKMRSIEGRQKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRSNEIKGALRRQLAKKMFFKSNILFCKP*
841 >lcl|NP_001000948.1|Plus1complement(5536772..5537722) NW_047562 olfactory receptor Olr194 Olr194 __SEG__ Chr1 {Rattus norvegicus} MALSNSSWRQPQPPFFLVGVPGLEESQHWIALPLGVLYLLALVGNVTISFIIWTDSSLHQPMYLFLAMLAAIDLVLASSTAPKALTVLLAHAHEIGYIVCLTQMFFIHAF
SSMESGILVAMALDRYVAICHPLHHSTILHPGIIGRIGMVVLVRGLVLLVPFPILLQKVVFCRATVISHAYCEHMAVVKLACLETTVNRAYGLSVALLVVGLDVLAISIS
YALILQAVLKVPGGEARLKAFSTCGSHVCVILIFYVPGIFSFLTHRFGHHVPHHVHVLLATLYLLVPPALNPLVYGVKTRQIRQRVLRVFYTKASS*
842 >lcl|NP_001000949.1|Plus1complement(5337820..5338758) NW_047562 olfactory receptor Olr179 Olr179 __SEG__ Chr1 {Rattus norvegicus} MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLIAVLGNVIILFVIYLEHSLHQPMFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFT
GIETFMLVAMAFDRYIAICNPLQYNTILTSLMICVIAGVGLLINFILVFPLIFLILRLSFCGHNIIPHTYCEHMGIARLACVSIKVNVLFGLILICMILMGVILIAISYV
KILHAVFRLPSWEARLKALNTCGSHVCVILAFYTPAFFSFLTHRFGHNIPRYIHILLANLYVMIPPALNPLIYGVRTKQIRDRVVIFFCKGF*
843 >lcl|NP_001000950.1|Plus14942489..4943448 NW_047562 olfactory receptor Olr162 Olr162 __SEG__ Chr1 {Rattus norvegicus} MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANILIVSVIYQEASLHQPMYHFLGILAIVDIGLATTIMPKILAIFWFNAKAISFNECFVQMYVI
HVFVTMESGIFVCMALDRYVAICRPLRYSSIVTESFVIKATVFMAVRNCVAPMSVPILAAQRNYCSRNQINHCFCTNLGVTSLACDDRKINSINQLLLAWTLMGSDLGLI
MVSYALILRSVLRLNSAEAASKALSTCTSHLILIFFFYTVIIVMSITHSAKMSVPVIPVLLNVLHNVVPPALNPMLYALKNKELKQGLYKVLRLDVKGG*
844 >lcl|NP_001000951.1|Plus1complement(3957118..3958062) NW_047562 olfactory receptor Olr114 Olr114 __SEG__ Chr1 {Rattus norvegicus} MSIFLMSNSSMSIFVLTGFPGLEVYFVLFAIPFSVIYAMVFLGNCMILHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWGFLQEISLDACIAQSYFIHGLS
CMESSVLLAMSFDRYIAICNPLRYSSILTNDRIIKIGVAILCRSSMLIPPGIIRLKFLNYCRSHILSHSFCLHQDLIRLSCSDIRFNSFYALSLVICTLLLDAVLILASY
VMILHTVLSIASREERIKSLQTCVSHISAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNVYILFPPLMNPIIYSIKTQQIRVRIQRLFSLNGT*
845 >lcl|NP_001000952.1|Plus1complement(3883508..3884461) NW_047562 olfactory receptor Olr109 Olr109 __SEG__ Chr1 {Rattus norvegicus} MEITNSSWFQPPTLLLTGIPGLEDVQIWFCIPLCIMYLIALLGNCTILFVIKTTSILHEPQYIFLSMLAATDVGLSVSTLPTVMNVFLLNHRDIEFHSCLTQMFFIHTFS
SMESAILLAMAFDRFVAIRNPLHYTVVLTPPRIIRMGLAVVVRGVVLMVPLPILLKRLPFCKGVILSHCYCYHPDIMKLACGPVRVNIIYGLSLVLCSFGVDSVLIVISY
ILILKTVLGIASGDGKLKALNTCVSHIFTVFIFYVPLIVLALIHRFGTFASPLLHVTMANLFLFLTPVLNPLVYSLKTKQIRSAVCKIFNVWGNLLK*
846 >lcl|NP_001000953.1|Plus17931165..7932133 NW_047817 olfactory receptor Olr1352 Olr1352 __SEG__ Chr9 {Rattus norvegicus} MAIEVHRNGSLSAMSLQGFVLLGFRGGAETQALLFTVFLVLYVVTVLGNLTMIMVITLDARLHSPMYFFLKNLSFVDLCLSTVVVPNALASIFFSSKTISFAGCATQFFF
FSLLAATEAVLLAVMAYDRFMAICSPLRYPVTMCPMTCVRLVLGTFCVACLNSIVQTSLTFRLPFCSSNRIDHFYCDVPPLLQLACASTALNELVMFGICGFIIVCAVFV
VIISYVYITVTILRMHSGSGRHKLFSTCGSHMTAVSLFYGTGFAVYGQPGGVASMEQGKVVSIIYILIIPMLNPLIYSLRNKDVKDALRRLGQRHSLAKESG*
847 >lcl|NP_001000954.1|Plus124493823..24494782 NW_047563 olfactory receptor Olr339 Olr339 __SEG__ Chr1 {Rattus norvegicus} MASMENITEVTEFILLGLTDDPNLQVPLLLIFLFIYLATLIGNGGMMVIIFSDSHLHTPMYFFLCNLSFVDLGYSSAVAPKMVAALQSGNKVISYNGCAAQFFFFVGFAT
VECYLLASMAYDRHAAVCRPLHYTTTMTTGVCTILTIGSYTCGFLNASVHAADTFKLSFCGSNKINHFFCDIPPLLALACSNTHTSKLVVFFVVGFNVFFTLLVIIISYL
FIYIAIQNMKSSEGRKKAFSTCASHLTAVSIFYGTIIFMYLQPSSGQSMDTDKIASVFYTVVIPMLNPLIYSLRNREVKSALLKILNKFYPQSFSVNGK*
848 >lcl|NP_001000955.1|Plus19203545..9204477 NW_047563 olfactory receptor Olr308 Olr308 __SEG__ Chr1 {Rattus norvegicus} MVSPNQTVVTEFVLQGFSEHPSLSLFLTGCFLSLYAMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKALVGLLSEENTISFKGCMTQLFYLLWSGSS
EMLLLTVMAYDRYVAICCSLHYSSRMSPQLCGVVAIGVWSVCALNASINTGLMTRLSFCGPKVITHFFCEIPPLLLLSCSPTNVNSIMTLVADIFYAGINFGLTLLSYGC
IIASILHMRSAEGKREAFSTCSSHLIVVAMYYSSVFFAYINPRSSYNPERSKFTTVLYSVLSPTLNPLIYTLRNKDVKLALGRIFASFSH*
849 >lcl|NP_001000956.1|Plus131839805..31840797 NW_047334 olfactory receptor Olr1456 Olr1456 __SEG__ Chr10 {Rattus norvegicus} MDKGNATTGFILLGLFDHTRAHLFLFVLVLTVAFNSVVGNALLLLLINQDRRLHTPMYFLLSQLSLMDMMLVSIVVPQMAAGYLMGKNYISAAGCGFQIFFFLTLGGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWQLCLRLTLGSWLLGAADGAMQAAATMSFQFCSRHEIDHFFCEAPVLLHLACGNTSAFEFVMYICCVLMLLIPFSLILASYGLIL
TAVLRMRSTEARKKAFATCSSHLTVVGLFYGAAAFSYMRPASARSANHDKVVSAFYTIVTPMLNPLIYSLRNSEVKGSLRKCLARCSALRSKDTLVGLDLAGATKEKGIQ
*
850 >lcl|NP_001000957.1|Plus131761436..31762365 NW_047334 olfactory receptor Olr1451 Olr1451 __SEG__ Chr10 {Rattus norvegicus} MKTPSNSTEVDFILLGLFSHTYAHLFLLSSVLVIFTTSLMGNTLMILLICREPRLHTPMYFLLSQLSFMDMMLASTIVPKMSANYLMNTRSISPAGCGSQIFLFLTLAGG
ECFLLAAMSYDRYVAICYPLRYHVLMSPKLCAYLTVGSWLLGAADGLMQAGTILSFPFCQSRTINHFFCEAPSLVRLACADTKAFEFFMYICCILMLLIPLSLVLASYSL
ILVAVLRMRSSAARKKAFATCSSHLAVVGLFYGAIIFIYIRPKSHQPGKSDKVVSAFYTIFTPVLNPLIYSVRNKEVKGALRKWLQKKV*
851 >lcl|NP_001000958.1|Plus131640108..31641028 NW_047334 olfactory receptor Olr1445 Olr1445 __SEG__ Chr10 {Rattus norvegicus} METGNHSCGTDFTLVGLFQYGHMDTFLFIVIAVLFAVALTGNLMLVHLIRLDRTLHTPMYFLLSQLSIIDMMYISTTVPKMAANFLSDTKTISFLGCAIQTFVFLTLGGS
EALLLGFMSYDRYIAICRPLHYPLLMSRKICCCMVASAWSSSVITASRHTVYVFQLPFCGSRIVNHFFCEVPSLLPLVCEDTSQYEHTLLISGFVFLLIPFLAILTSYAR
VLVVVFQMGSGKGQSKAVSTCSSHLTVASLFYVTGLCTYTQPHSLHSPGRDKLVAVVYSIITPVLNPFIYSLRNKEVMGALRRYLG*
852 >lcl|NP_001000959.1|Plus1complement(12001769..12002722) NW_047799 olfactory receptor Olr1305 Olr1305 __SEG__ Chr8 {Rattus norvegicus} MAEGNYSTVTEFVLIGLTEKPGLQLPLFFLFLGIYVVTVLGNLGMVMLILFSPHLHTPMYFFLSNLSLVDLCQSSVIMPKMLENFVMVKSVISYAECMAQFYLFDVFAVS
ECHMLAAMAYDRYVAICNPLLYNVTMSYNVCSCMVVAVYSVGLICATGETVCLLRLLFCKAEDINHYFCDLLPLLEQSCSSTFINEVLALSFSSFNIIVPGLTILSSYTF
IMATILRIRSTEGRSKAFSTCSSHILAVAVFFGSLTFMYLQPSSVSSMDQGKVSSVFYTIVVPMMNPLIYSLRNKDVKVAFYKIVRRRQFMGNEELG*
853 >lcl|NP_001000960.1|Plus1complement(11247133..11248044) NW_047799 olfactory receptor Olr1292 Olr1292 __SEG__ Chr8 {Rattus norvegicus} MEATAAGNHCTVTEFFLAGLSEKPELQLPLFLLFTGIYLITVAGILGMITLIGLSSHLHTPMYYFLSSLSFSDFCQSTVVIPKMLVNFVMEKNLITYPGCMTQLYFFTTF
GTAECYTLAAMAYDRYVAICNPLLYNVTMSYKMFCSLVSGVYIFALFCSSINTGFMLRIQFCKLHVINHYFCDLVPILKLASSNTYISEILVRFFCTLNMFCPMLTIITS
YIFIITTILYINSREGKFKAFSTCSSHISAAFIFYGSGAFMYFQPSSLNFMDKAKLSSVFYTIIVPMLNPLIYSLRNKDVCCI*
854 >lcl|NP_001000961.1|Plus1complement(10928597..10929544) NW_047799 olfactory receptor Olr1279 Olr1279 __SEG__ Chr8 {Rattus norvegicus} MEEINQTSVAEFILTGLIDNTELQFPLFLIFLTVYLVTVVGNLGMIILILISSQLHTPMYYLLSSLSFIDCCQSTVIIPKMLLSFVTETNVILYPECITQFYFFCAFAVS
ECHMLAAMAYDRYVAISNPLLYNVTMSYQVCSLMVAMVYSIGLISATTHTIFLLRVLFCKSDIINHYFCDLFPLLELSCSSTYINEVLALSFSAFNVIVPAITILSSYVF
IIVSILHIQSTGGRVKAFSTCSSHIMAVAVFFGSIAFMYLQPSSVSSIDQGKVSSVFYTIVVPMLNPLIYSLRNKDVRVSLKKLLQKISFLRTKI*
855 >lcl|NP_001000962.1|Plus110578083..10579015 NW_047799 olfactory receptor Olr1260 Olr1260 __SEG__ Chr8 {Rattus norvegicus} MALVNSSMVTEFILLGLTDQTDLQIPLFVVFLIMYMITALGNLALIILIVLNSHLHTPMYFFLFNLSFIDFCYSSVITPKMLMNFVITKNLISYVGCMTQLYLFCFCVIS
ECYILTSMAYDRYVAICNPLLYNIDMSPKVCSYLMLASYLMGFSGALIHTACILRLTFCDGNTINHYFCDLLPLLQLSCTSTYVNKVAIFIVTGKDIIVPTTVIFISYGF
ILSSIFQMKSTEGMSKAFSTCSSHIIADSLFFGSGAIIYLKPNSAGAINNVKTSSIIYTSVIPMMNPLIYSLRNKDVKLALRKTLSKKIF*
856 >lcl|NP_001000963.1|Plus110201013..10201942 NW_047799 olfactory receptor Olr1237 Olr1237 __SEG__ Chr8 {Rattus norvegicus} MDLENVTLVTDFILVGLTQQPDFQIPLFILFLAMYLVSALANLGLMILVLLNSHLHTPMYFFLFNLSFIDFCYSSVFTPKMLMNFTLRLNVISYMQCMTQLYFFCFFVSS
ECYVLTSMAYDRYVAICRPLSYNVVMSPQVCLNLMIGSYLLALSEAVALTVCMLRLTFCDSNINYYFCDILPLLQLSCTSTDVNKLVAYVIVIINIIVTTPTIFISYGFV
LSSIFHISSSKGRSKAFSTCSSHIIVVSLFFGSGAFVYFKPSSAGSMDGAKISSVFYTNVVPMMNPLIYSLKNNDVKIALRKMFTRWTV*
857 >lcl|NP_001000964.1|Plus110066983..10067924 NW_047799 olfactory receptor Olr1228 Olr1228 __SEG__ Chr8 {Rattus norvegicus} MKKMATENDSSVSGFILMGLTDQPELQLPLFFLFLLNHTAIVVGNLSLMSLIILNANLHTPMYFFLFNLSFIDFCYSFVFTPKMLMSFVSEKNIIPFSGCMTQLFFFCFF
AHSESYVLTVMAYDRYVAICKPLLYKAIMLPKICCLLMFVSYLIGFSSASVLAGLMIRLNFCNNKIINHYMCDIFPVLRISCSNTYVNELVSTAVVGTAIILCSLIILVS
YAMILFNILHMSSGKGWSKALGTCGSHIITVSFFYGSGLLAYVKPSSAETVGQGKFFSVFYTFLVPMLNPLIYSLRNKDVKVAVKRTLKRTTC*
858 >lcl|NP_001000965.1|Plus19954402..9955355 NW_047799 olfactory receptor Olr1219 Olr1219 __SEG__ Chr8 {Rattus norvegicus} MAMGNDSSVTEFILTGLTNQPELQLPLFFLFLVNYITTVVGNLSLMSLICWNSNLQTPMYFFLFNLSFIDLCYSFVFTPKTLMSFVLEKNVISFTGCMTQLFFICLFVNS
ECYLLTAMAYDRYVAICQPLLYMVIMSPVTCSLMMFGSYVMGFVAAIVHTGFMIRLSFCDSNIINHYMCDIFPLLQLSCSSTYANELVCSVFVSTVVLASSFLILTSYAL
ILFNIIQLSSGKGLCKAMSTCSSHIMTVVLFYGFGMLTHIKTSSDESVNQGKFFCLLCTFLMPLLNPFIYSLRNKDVKLALKRTLRRLTVSEPLGLP*
859 >lcl|NP_001000966.1|Plus18860974..8861909 NW_047799 olfactory receptor Olr1200 Olr1200 __SEG__ Chr8 {Rattus norvegicus} MTAENTSSVAEFILVGLTDQPDLQIPLFILFLGFYMVTLVGNLGLITLIGLNSHLHIPMYFFLLNLSFIDFSYSTTLTPKMLVGFVVRKNIISYAGCMTQFFFFCFFVFS
ESYILSAMAYDRYVAICKPLLYRVTMSPQVCSFLLSGVYGMGVFGAVAHMGNLQFITFCADNIINHYMCDIIPLLELSCNSSYINLLVVFIVVTIGIGVPIVTIFISYGF
ILSSILHISSKEGRSKAFSTCTSHIIVVSLFFGSGAFMYLKPPSSLPLDQGKVSSVFYTAVVPMFNPLIYSLRNKDVKIALKKTLSRKNFS*
860 >lcl|NP_001000968.1|Plus12482327..2483274 NW_047653 olfactory receptor Olr419 Olr419 __SEG__ Chr3 {Rattus norvegicus} MMTRNHSSVSEFLLLGLLEHQEQQHFLFGIFLIIYLVTVVGNMLIILVIFSDSHLHSPMYFFLANLSLTDLCLSSTTVPRMLVNLQTQKHSIPYAGCLSQIYFFLWFIGL
DVFLLAVMAYDRLVAICYPLHYTLVMSHRCCILLVTISLFLAHSYALTHIILLSQLSFCMDNIIPHFFCELLPILKLSCSNIFANQCVLLYWGGALTVLIPLLIIASYVR
IVATIVRVPSARGKWKTFSTCGSHLSAVCLFYVSAIGVYFIPSDADSASKDRIAAVMYAVVTPMLNPFIYSLRNKDMTSALRRFLNRSLLQPPQS*
861 >lcl|NP_001000969.1|Plus12343529..2344467 NW_047653 olfactory receptor Olr410 Olr410 __SEG__ Chr3 {Rattus norvegicus} MMETNQSTVSEFILLGLPIQPEDQAVYSVLFLAMYMTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTAPKMLMNMLTHSQSISYAGCVSQIYFFLLFGCI
DNFLLTSMAYDRYVAICHPLHYTTVMSQSLCVLLVMISWVFSSTNGLVHTLLFARLSHFKDNTVHHFFCDLSALLKLSISDTTINELVILTLAVVVITVPFICILISYGH
IGATILRTPTIQGICKALSTCGSHLCVVFLYYGAIIGLYFFPSSNNTNAKDVIASVLYTVVTPMLNPFIYSLRNRDMKGALKNTLSRRLCSH*
862 >lcl|NP_001000970.1|Plus1complement(2272787..2273773) NW_047453 olfactory receptor Olr1635 Olr1635 __SEG__ Chr15 {Rattus norvegicus} MLFSLLGYFLRYVDPMNLSTTHVTEFVLLGFPGSWKTQIFLFVLFLLFYVLTLLGNGAIICAVRCDSRLHTPMYFLLGNFAFLEIWYVSSTVPNMLANILSKTKAISFSG
CFLQFYFFFSLGTTECLFLAVMAYDRYLAICRPLHYPVIMTRRLCCILVSSCWLIGFLGYPIPIFSISQLPFCGSNIIDHFLCDMDPLMALSCALAPITEFIFYAQSSFV
LFFTISYILRSYILLLRAVFQVPSAAGRRKAFSTCGSHLVVVSLFYGTVMVMYVSPTYGISTLMQKILTLVYSVMTPLFNPLIYSLRNKDMKLALRKVLLGMRIVKNI*
863 >lcl|NP_001000971.1|Plus1complement(1994046..1994975) NW_047453 olfactory receptor Olr1625 Olr1625 __SEG__ Chr15 {Rattus norvegicus} MDYKNGSAVTEFILVGFSGDWQLQTFFFVTFTLIYGTTVVGNILIIVTVAATSTLHSPMYFLLGNLSFLDMCLSTVTTPKMITDLLAARKSISFQGCMAQMFFMHFFGGA
EMTLLIVMAFDRYVAICKPLHYRIIMSHRLLNRCIILSWTIGFIHTMSQMALTVNLPFCGHNIINNIFCDLPLVIKLACIETYTLELFVIADSGLLSFICFILLLVSYTV
ILVIVKHKSPGSLSKALSTLSAHIIVVTLFFGPCIFIYAWPFGSFASNTTLAVFYTVITPLLNPIIYTLRNREMKKAMRKLWIQHVSCT*
864 >lcl|NP_001000973.1|Plus1complement(1533063..1534043) NW_047453 olfactory receptor Olr1609 Olr1609 __SEG__ Chr15 {Rattus norvegicus} MERLNHSRVPEFVLLGLTDSPELQIFFFVAFSIFYLMTMLGNCLILFTVLSTSNLHSPMFFLLSNLSLIDICLSSFATPKMIMDFFAHHKTISFEGCISQIFLLHLFTGT
EIVLLISMSFDRYIAICKPLYYSTIMSQKVCVGLVVTSWMVGFLHTMSQLVFILYLPFCGPNVVDSFFCDLPLVIQLACIDTYVLGIFMVSTSGVIALISFLLLLTSYIV
VLVTIRGHSSIGSSKALSTCTSHFIVVLMFFGPCIFIYMWPFTNFLLDKILSVFYTIFTPFLNPLIYTLRNQEVRTAVKKKISNQYFSFGKINPHYTVKGLERSRE*
865 >lcl|NP_001000974.1|Plus14184049..4185011 NW_047690 olfactory receptor Olr820 Olr820 __SEG__ Chr4 {Rattus norvegicus} MEENQTMVTEFILLGFCLGPRIHLVLFLLFSLFYTFTILGNGTILALICLDSRLHTPMYFFLSHLAIVDMAYACNTVPQTLVNLLDETKSISFTGCITQTFLFLAFAHTE
CVLLVVMSYDRYVAICHPLHYTVIMNWRVCTILVAISWIFSFLLALVHIILILRLPFCGPHEINHFFCEILSVLKLACADTTLNQVVIFAACVLILVGPLCFVLVSYTCI
LMAILKIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSEHPEEQQKILFLFYSFFNPMLNPLIYSLRNAEVKGALWRVLCKESHSCLVWCSHHKA*
866 >lcl|NP_001000975.1|Plus13919837..3920769 NW_047690 olfactory receptor Olr810 Olr810 __SEG__ Chr4 {Rattus norvegicus} MGQEFVNQTWVNEFILLGLSSDQNTQVFLFVLILVMYIITVVGNSLILLLIRLDSRLHTPMYFFLSVLSIVDLCYGNSIAPQMLAHLVLAQKLISFHSCVLQLCVSLALG
GSEFFLLGAMSYDRYVAVCHPLHYSVIMDEGLCLGLAATCLVAGFLNSLMETVITFRLPLCHNVINHFACETLAVLRLACVDISFNKVMVAISGFLVIMLPCCLVLFSYT
RIVIAILHIRSTQGRHKAFGTCASHLTVVCMCFGATIFTYIGPHSASSEDKEKMVALFYAVVAPTLNPVIYSLRNKEVMAALRKLVEKLR*
867 >lcl|NP_001000976.1|Plus13832207..3833160 NW_047690 olfactory receptor Olr806 Olr806 __SEG__ Chr4 {Rattus norvegicus} MGTDNQTWMHEFILLGLSSDWNTQVSLFILFLLMYLVTVLGNFLIILLIRLDSRLHTPMYFFLTNLSLVDVSYATSIVPQLLVNFLAPHKAIPFLSCAAQLFFSLGLGGI
EFVLLAMMAYDRYVAVCNPLRYSAIMDTGLCSRMAIVSWVSGSMNSVMQTAITFQLPMCTNRYIDHISCELLAVVRLACVDISANEVAIMVSSIILLMTPFCLVLLSYIQ
IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQEKLISLFYAILTPMLNPMIYSLRNKEVKGAWQKLLGKFSGFTLKLKT*
868 >lcl|NP_001000977.1|Plus1complement(3470890..3471831) NW_047690 olfactory receptor Olr802 Olr802 __SEG__ Chr4 {Rattus norvegicus} MKKDNATWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYFFLCHLSVVDICYTSSGVPQMLAHFLMEKKTISFALCGTQLFFALTLGGT
EFLLLAAMAYDRYVAVCDPLRYTVVMSPRLCMGLAGVSWFVGLVNSAVETAVTMYLPTCGHNVLNHVACETLALVRLACVDITLNQVVILASSVVVLLVPCCLVSLSYAH
IVAAIMKIHSTQGRRKAFETCASHLTVVSMSYGMALFTYMQPRSTASAEQDKVVVLFYAVVTPMLNPLIYSLRNKDVKAAFSRVLMKNFESKN*
869 >lcl|NP_001000978.1|Plus1complement(5207476..5208417) NW_047333 olfactory receptor Olr1374 Olr1374 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSISEFLLLGLSRQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMYFFLSNLSFVDVCFSSTTVPKVLANYMLRSQAISFSGCLTQMYFIFKLTDM
DNFLLAVMAYDRFVAICNPLHYTTQMTYKVCVMLVAGSWVTASLNALLHTLLMAQLSFCGDNIIPHFFCDVTPLLKLSCSDTHLNELMILTEGAVIMVTPFVCILISYIY
ITDAILRVSSLRGGRKAFSTCGSHLAVVCLFYGTIIAVYFSPSSVHSSEKDTAATVLYTVVTPMLNPFIYSLRNRDLKGALRKLVSRGHFSVQ*
870 >lcl|NP_001000979.1|Plus1complement(5091255..5092196) NW_047333 olfactory receptor Olr1370 Olr1370 __SEG__ Chr10 {Rattus norvegicus} MSSTNHSSVSVFLLLGLSSQPQQQQLLFLLFLTMYLATVLGNLIIILAISIDSHLHTPMYFFLSNLSFVDVCFSSSTVPKVLANHILGSQEISFSGCLTQMYFLSVFADM
DNFLLAVMAYDRFVAICHPLHYTEKMTRQLCALLVVESWVAANLNALLHTLLMARLSFCGDNIIPHFFCDATPLLKLSCSDTHLNELMILTVAGLILLAPFVCILMSYIL
IACAVVRVSSTGGRWKAFSTCGSHLTVVCLFYGTIIAVYFNPASSHSAGRDMASAMMYTVVTPMLNPFIYSLRNRDMKGALRKVLTMRFPSKQ*
871 >lcl|NP_001000980.1|Plus1complement(5036679..5037623) NW_047333 olfactory receptor Olr1366 Olr1366 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVSEFLLLGLSRQPQQQQQLLFLLFLTMYLATVLGNLLIILAISTDSHLHTPMYFFLSNLSFVDVCFSSTTVPKVLVNHILGSQVITFSGCLTQLYFFCVFAD
MDNFLLAVMAYDRFVAICHPLQYTTKMTHQLCALLVMGSWVVANLNCLLHILLMAPLSFCADNIIPHFFCDATPLLKLSCSDTHLNELMILTEGAVIIVTPFVCILISYI
HITCAVLRVSSPRGGWKAFSTCGSHLAVVCLFYGTIIAEYFSSSSPHSAGRDMAGAMMYTVVTPMLNPFIYSLRNRDIKGILRKVLILRFPSKQ*
872 >lcl|NP_001000981.1|Plus115962978..15963907 NW_047798 olfactory receptor Olr1191 Olr1191 __SEG__ Chr8 {Rattus norvegicus} MIPGNQISTLEFLLLGFSQDPEHQPMLFGLFLLMFVVTVLGNLLIILVVSIDSHLHTPMYFFLSNLSFSDICFITTTIPKMLVNIQTQSKSITYAECIIQMYFFMVFSGM
DTFLLSVMAYDRFVAICYPLHYPVIMNPHLSGLLVLVSWFISFSYSLIQSLLMLRLSFCTNQIIKHFYCEHATALTIACSDTLINHILLYILICVLGFVPFSGIIYSYSK
IVSSILRIPSTDGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSDASSSSEKGMVASVMYTVVTPMLNPFIYSLRNKDFKKALQTLGTILF*
873 >lcl|NP_001000982.1|Plus115769281..15770207 NW_047798 olfactory receptor Olr1185 Olr1185 __SEG__ Chr8 {Rattus norvegicus} MSLSDNPELQPILFVLFLSFYMVTVLGNLLIILAVSSDFHLHTPMYFFLSNLSWSDICLISTTVPKMIWDIRTQSRVISYAGCLTQMSMFIIFGCMDSMLLTVMAYDRFV
AICHPLNYNIIMNPNLCALLLLASVLASLVDSQVHNLIVLQFTYFNDMEISNFFCEPSQLLNLKCSEMFTKNIVIRFIGVFFGLFSTSGIIFSYYKIVSSILRIPSTEGK
YKAFSTCVSHLSVVCLFYGTAIGVYIGSTASNSSENCKVASLMYTVVTPMLNPFIYSLRNRDIKTALWKLQKKAKLHNAFHHFLILSS*
874 >lcl|NP_001000983.1|Plus1complement(15312293..15313288) NW_047798 olfactory receptor Olr1172 Olr1172 __SEG__ Chr8 {Rattus norvegicus} MEIENHTLITEFLILGLSDDPELQPILLGLFIFMYLVTVLGNLLIILAVSSDSHLHNPMYFLLSNLSFIDICFISTTIPKMLVNMKSQTKDISYIECVTQVFFFNTFAGM
DNFLLTLMAYDRFVAICHPLNYTVIMNPRLCALLILMFWIIMFWVSLIHVLLMNELNFSRGTEIPHFFCELAQVLKVSNSDNHVNNVFMYVVTSLLGVIPMTGILMSYSQ
IVSSLLRISSTVRKYKAFSTCGSHLCVVSLFYGSGLGVYFSSSVFQSTQRRMVASLMYTVISPMLNPFIYTLRNKDVKGALGKLFTKVASSPSCINDIRNKLLLGSVRQI
L*
875 >lcl|NP_001000984.1|Plus115076429..15077370 NW_047798 olfactory receptor Olr1164 Olr1164 __SEG__ Chr8 {Rattus norvegicus} MEPYNLTNNLELRLLGLSEDPELQLILFVLFLLIYLLTVLGNVLIIVAISSDSHLHSPMYFFLYHLSLSDMGFSSTTIPKMLRNMQINNKSITYAACLTQVTFFFLFGCM
DSLLLTVMPYDRWVAICHPLHYQVILNPCQCKCLVIVSFCISLMDSQVHCLMVSQLKFCTNIEIPHFFCDVPELLRLACSDSSTNNIVIFLVSIIVGFLPASGIFYSYYK
IISSIIRVPSLLGKYKAFSTCGYLSIVYLFYGTGLGVYLSSSISSSPKDSVVASVMYTMVVPMMNPFIYSLRNRDIKKALQKSVSQITYYLPI*
876 >lcl|NP_001000985.1|Plus114857580..14858509 NW_047798 olfactory receptor Olr1160 Olr1160 __SEG__ Chr8 {Rattus norvegicus} METYNLTGTLEFLLLDLSEDTELQFIFFVLFLLIYLLTVLGNVLIILAISSDSQLHSPMYFFLYNLSLSDMGFSSTTVPKMLINMQTHNKSITYAGCLTQVFFFILFGGM
DSLLLTAMAYDRWVAICHPLHYQVILNPRLCRCLLILSFFISVLSSQVHCLMVSQLTFCTNMEIHHFFCDVPELLKLSCSDSFISNIVRIILSIILGFLPMSGILYSYYK
ITSSIFKFPSLLGKYKVFSTCGSHLSVVCLFYGTGIGVYLSSTVSSSYGESMVASVLYIMVVPMINPFIYSLRNKDIKKALQKIVRQIL*
877 >lcl|NP_001000986.1|Plus1complement(13828802..13829770) NW_047798 olfactory receptor Olr1132 Olr1132 __SEG__ Chr8 {Rattus norvegicus} MELKNQTAVSEFHLLGLTDNHKLLSLVLTMFLSMYLITILGNLLIIMTISSGSQLHNPMYLFLSLLSINDICYSTVIIPKILVNLQGQDNSISYIECLSQICFASVFGGM
ENFLLAVMAYDRYVAICKPLRYTVIMNPVFCVLIVLVSLLLSTMDALIHSLMVLRLSFCTDLEIPHFFCELAQIIKLACSDTFLNNFFIFVAAFFIVGVPFCGIVFSYIY
IVSSVLRMPSSGGKQRAFSTCASHLSVVSLFYGTGFGVYISSAVIESLRNTAMASMMYTVVPPLLNPFIYSLRNREMKEALRKLIGRLTYSVVISCDIHVSC*
878 >lcl|NP_001000987.1|Plus113737784..13738719 NW_047798 olfactory receptor Olr1128 Olr1128 __SEG__ Chr8 {Rattus norvegicus} MEGKNQTDVSHFFLLGLTDDPTVKPVIFCLFLFIYMVTILGNLLIILAVSCYSHLQTPMYFFISNLSFNDICLTTTVIPNMLLTIQTQDQSITYTGCLTQLCFVLLFAGF
ESCLLAAMAYDRYVAICYPLRYTVIMNFHSCALLILFSVFISILNMGLLGLMVLRLSFCTNLKIPLFFCELSQIMKLACSDTLINDILIYLATLIFGGIPISGIIFSYVQ
IASSVLRIPSVKGRYKAFSTCGSHLSVTSLSYGSGLWVYITSSVAILPKKTSVACIMYTVVPQMLNPFIFSLRNKDMKGTIKKLICRVASL*
879 >lcl|NP_001000988.1|Plus1complement(12939879..12940826) NW_047798 olfactory receptor Olr1119 Olr1119 __SEG__ Chr8 {Rattus norvegicus} MNLSNKSGISEFYLIGLTYGPDVESFIFSLFLCMYFVIIFGNFLIILAIISDSHLHTPMYFFIANLSFADICISTTIIPKILVNIQTQDKSISYGGCLSQVCFVLTFGGF
ESCLLGVMAYDRYLAICDPLRYTVIMSPCSCVLLVLLAVFISTVNGLLHSLMLLKLSFCTNQNILHVFCELVQVIKLACSDTFINTLLSYTVTSAFSGVFLAGIIFSYIQ
IVSSVLKIKSVQGRNKAFSTCGSHLSVVFLFYGTALGVYMSSSVSDSSAKNVIFSMMYIVVPQMLNPFIYSFRNREIKQAMRILIYSGYYFHKLN*
880 >lcl|NP_001000991.1|Plus15941961..5942944 NW_047696 olfactory receptor Olr828 Olr828 __SEG__ Chr4 {Rattus norvegicus} MEWLMSEETRNGTLVLEFILEGFPVAEHLRILFFLLHLLAYLASLMGNMLIITITCVDHRLQTPMYFFLSTFSFVECCFITTVIPQLLTIILSGRQKISFVACFSQAFIV
FILGATVFFLLGVLSLDRYLAICKPLHYPTIMSPRMCFLLVTVSLVLGILFMSIPVVLLSQSFYCGPYVIPHFFCDFGPLANLSCSETRSIEMLFFNFAVIVVFTSFLIA
IFAYSNIVVTIVRLPSARERQRAFSTCSSHLIVLSLMYGSCAFIYLKPKQRSRVDTNREAALVNTVVTPLLNPVIYTLRNKQVHQALRDALSNIQLHRYQRSNAPSL*
881 >lcl|NP_001000992.1|Plus15794421..5795347 NW_047696 olfactory receptor Olr823 Olr823 __SEG__ Chr4 {Rattus norvegicus} MRNQTLVTEFVLQGFSEHPQYQLLLFICFLSLYCVALSGNVLIILAITCNPGLHTPMYFFLFNLATMDVICTSSIMPKALKGLVSKRNPISYGGCMTQLYFLTWSASSEL
LLLTVMAYDRYAAICHPLHYSTMMSKAFCGVLAAGVWALCAFNTAIHTGLMTRLNFCGPNVITHFFCEVPPLLLLSCSSTYVNSVMIVLADAFYGILNFLMTIVSYGFII
SSILKMRTSEGKQKAFSTCSSHLTVVCMYYTAVFYAYISPVSSYNAEKSKLAGVLYTMLSPTLNPLIYTLRNKEVKAALRKIFPFLRN*
882 >lcl|NP_001000993.1|Plus13914224..3915159 NW_047784 olfactory receptor Olr1108 Olr1108 __SEG__ Chr7 {Rattus norvegicus} MARSNHSGITEFVLTGLSDDPLIQALLFALFLGIYILTMTGNLMMLVVIRADSHLHTPMYYFLSNLSFLDLCFSSVTVPKLLKDLLSAKKSISVEGCLAQVFFVFITAGT
EAFLLSMMAYDRYAAVCHPLLYGQMMSNELCLKLVLLSWGLASLSSVVIVLLAVNLDFCEAYTIHHYTCELPSLFPLSCSDISINVDVLICSTLLHGLGTFLPIFFSYAR
IVSTVLSMKSTTGRSKAFNTCSSHLIAVVLFFGSGLVRYLMPTSGSSLDLLSSLQYSAVTPMLNPLIYSLKNQEVKTAVKRTLGKCLRYLE*
883 >lcl|NP_001000996.1|Plus1complement(38522304..38523242) NW_047657 olfactory receptor Olr766 Olr766 __SEG__ Chr3 {Rattus norvegicus} MDGENQTVVSEFILWGLAHSKNTQVFLFAIFMMLYLFIVSGNIVILILITTDSHLHSPMYFLLANLSFIDMWLSSNTTPKMITDFLRENKTISFAGCMCQVFFAHCIAAG
EMVLLVAMAYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTIGFIHGIIYVAVIVHLPFCGPNKIDSFFCDMPLVIKLACMDYHYLNTLMNADCGLVAVTCFILLLISYTY
ILITVCQSSKDGASKALSTCTAHITVVLIFFVPCIFIYVWPLNITWLDKFFAVFYSVFTPLLNPAIYTLRNKDMKNAMKKFMGNFLSFKVNS*
884 >lcl|NP_001000997.1|Plus1complement(14970734..14971669) NW_047657 olfactory receptor Olr689 Olr689 __SEG__ Chr3 {Rattus norvegicus} MQNQSFVTEFILLGLSQNPNVENILCVVFLFIYLATIGGNMIIVVTIIYSPALLGSPMYFFLIFLSLLDACTSSTVTPKMIVDFFYERKTISFECCMTQLFAIHFFTGIE
VIILSAMAYDRYVAICKPLHYSSIMTQRLCGILVIVSWAGGFLHSIIQIIFTLQLPFCGPNVIDHYLCDLFPLLKLACTEPHIFVILVFSNSGSISIIIFSILLVSYGII
LFSLRAHSSEGRRKALSTCGSHITVVLLFFVPCFLIYARPTSAFSSEKNAFVFATIITPLLNPMVYTFRNKEMKNAIRKMWKRLIMVSCNY*
885 >lcl|NP_001000998.1|Plus112016230..12017165 NW_047773 olfactory receptor 1073 Olr1073 __SEG__ Chr7 {Rattus norvegicus} MKQQNDTQILQFLLLGLSENTELQPLIYWLFFSMYLVTVWGNLIIILATVLDFRLHTAMYFFLCNLSFVDICLISTTIPKMLANVHLNHKAITYEGCIMQIYFFTLFVGL
DNFLLAVMAYDRFVAICHPLRYTSIMTPHLCMSLVLVSWIASVLNSSLQSFLVLQLSFCTEVEIPHFFCELSMLVHLACSDTFLSDMAMNVLAALLGGGCLVGILYSYSK
IVSSIQAISSAEGKYKAFSTCVSHLSVVSLFYCTLLGVYLSSAVTQNSHSTAATSLMYTVVTPMLNPFIYSLRNDNIKRALKNFVKKKLEK*
886 >lcl|NP_001000999.1|Plus18473798..8474742 NW_047562 olfactory receptor Olr264 Olr264 __SEG__ Chr1 {Rattus norvegicus} MTFSEDRNYTAVTEFILLGLTDDPVLKVILFTIILCIYLLTMSGNLSTIFLIRVSSQLHHPMYFFLSHLASIDMGISSSVTPNMLVNFLIKQHTISYIGCSIQFGSAAFF
GTVECFLLAAMAYDRFVAICNPLLYSTKMSTAACIQLVIGCYIQGFLNASFFTLSFFLLFFCGPNKINHFYCDFAPLVELSCSDVSVSVVVISFSAGFITMITMFVIAIS
YSYIFITIMKMHSTDSRQKAFSTCVSHLTAVTLFYGTAIFIYVMPKSSYSTDQNKVLSVFYTVVIPMLNPLIYSLRNNEIKNTLKRHIGKKIFS*
887 >lcl|NP_001001000.1|Plus14928706..4929665 NW_047562 olfactory receptor Olr161 Olr161 __SEG__ Chr1 {Rattus norvegicus} MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANILIVSIIYQEASLHQPMYYFLGILAIVDMGLATTIMPKILAILWFNDNNISLPECFAQMYTI
HCFVAMESGIFVCMAIDRYVAICRPLRYSSIVTESFVIKATVFMTFRNFVAPISVPVLAAQRNYCSQNKIEHCLCSNLGVTSLACDDRKINSINQLFLAWTLMGSDLGLI
IVSYALILRSVLRLNSAEAASKALSTCTSHLILIFFFYTVIVVMSITHSVGMKIPLIPVLLNVLHNVIPPALNPMVYALKNKELKQGLYKVLRLDVKGG*
888 >lcl|NP_001001001.1|Plus12857223..2858167 NW_047562 olfactory receptor Olr46 Olr46 __SEG__ Chr1 {Rattus norvegicus} MSAINVTETHPMAFLLVGIPGLEHLHIWISIPFCFAYILALLGNCTLLFIIQADSALHEPMYLFLAMLATIDLVLSSTTLPKMLAIFWLRNQEISFHACLIQMFFLHSFS
IMESAVLLAMAFDRYVAICKPLHYTTILTKPLIIKIGLAAVTRAVTLMTPLPFLLRRFHYCRGVMIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLASQEARYKAFGTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMINPIIYGVKTRQIRDHVLSLFRRKDV*
889 >lcl|NP_001001002.1|Plus1complement(31048866..31049795) NW_047334 olfactory receptor Olr1417 Olr1417 __SEG__ Chr10 {Rattus norvegicus} MNNFTGQSGFTLVGFLSQSKHPALLAGVIFVVFLMALSGNTLLILLILSDTNLHTPMYFFISQLSLMDIMYISVTVPKMLIDQVLGNHRISAAACGVQMFLYLTLAGSEY
LILAAMSYDRYVAICHPLRYHVLMNRRVCLLLISSCWLLGSLDGFMFTPVTMTFPFCGSREIYQFYCEVLAVTKLSCSDTWLYETFMYVCCVIMLLIPVTVISGSYSSIL
LTVLRMNSTEGRKKALATCSSHMTVVILFYGTAIYNYMLPASLHTPEKDMVVSVFYTILTPLLNPLIYSFRNKNVTEAMRKRLGLSTLF*
890 >lcl|NP_001001003.1|Plus11712739..1713674 NW_047453 olfactory receptor Olr1615 Olr1615 __SEG__ Chr15 {Rattus norvegicus} MKALSSPSNSSTITGFILLGFPCPREGQILLFVLFFIVYLLTLLGNASIICAVCCDQRLHTPMYLLLANFSFLEIWYVTSTVPNMLANFLSDTKVISFSGCFLQFYFFFS
LGSTECFFLAVMAFDRYLAICRPLHYPALMTGRLCNILVISCWVLGFLWFPVPIIIISQMSFCGSRIIDHFLCDPGPLLALTCVRNSLLELTSSTLSSLLLFVPFFFIMG
SYALVMRAVLRVPSAAGRRKAFSTCGSHLTVVSLFYGSVMVMYVSPTSEHAAGVQKLVTLFYSVVTPLLNPVIYSLRNRDMKHAMKKLLKI*
891 >lcl|NP_001001004.1|Plus1complement(3459511..3460452) NW_047690 olfactory receptor Olr801 Olr801 __SEG__ Chr4 {Rattus norvegicus} MKKDNATWVSEFILMGLSSDKHIQAGLFVLFGVTYLLTLLGNGLIVLLIALDPRLHLPMYFFLCHLSVVDICYTSSGAPQMLAHFLMEKKTISFALCGTQHFFALALGGT
EFLLLAAMAYDRYVAVCDPLRYTVVMSPRLCMGLAGVSWFVGLVNSAVETAVTMRLPTCGHNVLNHVACETLALVRLACVDITLNQVVILASSVVVLLVPCCLVSLSYAH
IVAAIIKIRSTQGRRKAFGTCASHLTVVSMSYGMALFTHMEPTSTASAEQDKVVVVFYAVVTPMLNPLIYSLRNKDVKAAFSRVLMKSFESKN*
892 >lcl|NP_001001005.1|Plus1complement(15267897..15268835) NW_047798 olfactory receptor Olr1171 Olr1171 __SEG__ Chr8 {Rattus norvegicus} MIHNPVENLTDVLEFHLVALSEDPDLQLFLFGLFLSVYLVTLLGNLLIILIIIFDSHLHIPMYYFLSNLSLVDIFLISTTIPKMIVGLKMHSRLISYAGCLTQMSLFLFF
ACMDDMILTVMAYDRFVAICHPLRYTVMMNPQVCAILILLCFSFSIFDSQLHNLIVLQITCFKDVEIANFFCHPSQLLNLACTNTLSSNIVICFISVILGIFPVLGIILS
YCKIVFSILKIPSSSRKYKAFSTCGSHLTVVCLFYGAGIGVYLGSAVSHSPQKNAVASLMYTAVSPMLNPFIYTLRNRDISNALKRFHRRVF*
893 >lcl|NP_001001006.1|Plus1complement(289690..290628) NW_047596 olfactory receptor Olr1681 Olr1681 __SEG__ Chr20 {Rattus norvegicus} MTLINTSHPEEFILLGFADRPWLELPLFIILLVTYPTAMIGNIAIILVSTVDPSLHSPMYFFLTNLSFLDICYTTSIVPQMLTNLGGSTKTISYLRCAVQLYFYHIMGGT
ECVLLTLISFDRYVAICRPLHYTLIMNQRNCLLLVSIMWLIGISYAVSESTITLQLPLCGHNKMDHLVCELPVLIKIACGEKEMNELALSVVCVFLSAVPLCLILASYAS
IGHAVFKIKSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSITKDQPKFMALLYGVVTPTLNPFIYTLRNKDVKGALGNLFRNIFMSK*
894 >lcl|NP_001001007.1|Plus14746444..4747394 NW_047492 olfactory receptor Olr1664 Olr1664 __SEG__ Chr17 {Rattus norvegicus} MNLGNESAPKIFILLGFSNYPWLEMPLFIMVLVAYVCTVVGNISIIVVSKIDPQLDSPMYFFLSNLSFLDLCFTTTTIPQLLRNLWGPDKSISYRGCVTQFYIFHFLGAT
ECILLAVMSLDRYIAICKPLRYPAIMHQQFCILLMFMTWLSGLANSLLQSTLTVKLPFCGNNKVDNFLCEVPVMIKMSCANTAFNIAMLSIVGTFYSLVPLSLILVSYGF
IVATVLRIRSSEGKKKAFNTCGSHVVVVTLFYGPVISMYVQPSSSSSQDKNKLLSLFYSLVTPMLNPFIYTLRNKDVKGAMRRFLVSLFHKESEQT*
895 >lcl|NP_001001008.1|Plus13157350..3158294 NW_047562 olfactory receptor Olr53 Olr53 __SEG__ Chr1 {Rattus norvegicus} MSIFYNSTSPTFLLTGVPGLEWAHPWISIPFCCLYLTALSGNSLILFVVLTEPTLQEPMYYFLSMLSTTDIGLCISTIVTVLGIFWLDTREISFSACLSQMFFIHLFTFM
ESSVLLAMAFDRFIAISNPLRYAAILTHARIAQIGLAVITRATVILTPLVLLLKRLSFCRSHVLHHSYCFHPDVMKLSCSDTKINSAFGLTAIISTAGVDSIFILLSYVL
IIRSVLSIASPGERKKAFGTCISHITAVAIFYIPLISLSFVHRFGKHAPPYVPTLIANVYLLIPPVMNPIIYSVKTKQIQRAILRLVYCKGPRV*
896 >lcl|NP_001001009.1|Plus15084111..5085064 NW_047355 olfactory receptor Olr1560 Olr1560 __SEG__ Chr11 {Rattus norvegicus} MKKTNHSLTTQFILVGFSDHPGLKILLFLVFSAIYLVTMVGNLGLVALIYMEPRLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICNPLQYHTMISKKLSLQMSIGIFIASNVISIIHVGCLLRLTFCKSNRIDHFFCDILPLYRLSCTDPFINELMINIFSMPIQVFTIATVLVSYFC
ILFTIFKMKSKDGRGKALSTCASHFFSVSIFYTCLLMYIIPSEDGSKDIPMAIFYTIIIPLLNPFIYSLRNTEVVNALNKVIKTYSIFKKSSTSTAH*
897 >lcl|NP_001001010.1|Plus19107614..9108558 NW_047562 olfactory receptor Olr283 Olr283 __SEG__ Chr1 {Rattus norvegicus} MKGQNSSSVAEFVLLGFSNYPELQRQMFGAFLAIYLVTLTGNALIMSVILLDRSLHIPMYLFLQNLSVVETGFSTTVMPEMLVVLNTEKATISFGGCFAQMYFILLFGGT
ECFLLGAMAYDRFAAICHPLSYPVIMNKRVFMTLVTCSWLSGTMMTTLQTIWVFSFPYCGPNEINHISCETPAVLELACTDIFFFEIYAFTGTVLIILTPFVLILLSYIR
ILFSILKMPSTTGRQKAFSTCASHLTSVTLFYGMASMTYLQPKSKYSPDTKKLMSLAYSLLTPLLNPLIYSLRNKEMKRAVVKLWGRKVVLHTT*
898 >lcl|NP_001001012.1|Plus123378563..23379486 NW_047334 olfactory receptor Olr1405 Olr1405 __SEG__ Chr10 {Rattus norvegicus} MDRDNETMVAGFLLLGLSGKSEQEEVVFGMFLGMYMVTISGNLLIILAISCDPRLHTPMYFFLANLSSVDICFSSVTIPKALMNHVLGSKSISYTECMIQIYFFITFINM
DGFLLSVMAYDRYVAICHPLHYTMMMRPRLCVLLVAVSWVITNLHALLHTLLMVRLTFCSHNAVHHFFCDPYPILKLSCSDTFINDLMVFTVGGVIFLTPFSCIVVSYVY
IFSKVLKIPSARGIRKALSTCGSHLTVVSLFYGAILGVYMRPSSTYSLQDTVATVIFTVVTPLVNPFIYSLRNQDMKGALRKIILRS*
899 >lcl|NP_001001013.1|Plus110212662..10213591 NW_047799 olfactory receptor Olr1238 Olr1238 __SEG__ Chr8 {Rattus norvegicus} MDLVNVSLVTDFILIGLTHQPDLQIPLFLLFLAMYLVSALANLGLMILVLLNSHLHTPMYFFLFNLSFIDFCYSSVFTPKMLMNFTLRLNVISYMQCMTQLYIFSFFVSS
ECYVLTSMAYDRYVAICRPLSYNVVMSPQVCLNLMIGSYLMAFSEAVALTVCMLRLTFCDANINHYFCDILPLLQLSCTSTYVNELVAYVIVIINIIVTTPTIFISYGFI
LSSIFHISSSKGRSKAFSTCSSHIIVVSLFFGSGAFVYFKPSSAGSMDGAKISSVFYTNVVPMMNPLIYSLKNKDIKIALRKMFARWTV*
900 >lcl|NP_001001014.1|Plus12034084..2035022 NW_047653 olfactory receptor Olr402 Olr402 __SEG__ Chr3 {Rattus norvegicus} MWRDNESTVSEFILLGLPIRTEDQGMFSALFLIMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVSAPKMLMNMLTHRQSISYAGCVSQMYFYIVFADL
DSFLLTCMAYDRYVAICHPLHYTTIMSQSLCLFLVIVSWALSTANALVHTLLLARLSHFRNNTIPHYFCDLSAMLKLSSSDTTINELLILTLGTMVTIPPFICILVSYVR
IGITILKTPSIKGICKALSTCGSHLSVVSLYYGAIIALYFVPSPNNTNDKDVIVAVMYTVVTPMLNPFIYSLRNRDIKGALKHILRRRLFSQ*
901 >lcl|NP_001001015.1|Plus1complement(2118146..2119081) NW_047453 olfactory receptor Olr1629 Olr1629 __SEG__ Chr15 {Rattus norvegicus} MAHSNESTVSEFVLLGLSKSWGLQLLLFTIFSVIYVTSVLGNVMIIVIIFADSHLNSPMYFLLGHLSFIDICQSNFATPKMLVDFFVELKTISFEGCMTQIFLLHSFVGS
EMMLLVAMGYDRFVAICKPLHYNLIMNRRVCIIFVSISWSVGILHSVSHLAFTVNLPFCGPNEVDSFFCDLPLVIKLACMDTYRMEILTLANSGLISLSCFLALVISYII
ILVTVQRQSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTICTPLLNSIIYSLRNEGMKSALRKLRNSHVNPGKN*
902 >lcl|NP_001001016.1|Plus115408401..15409396 NW_047798 olfactory receptor 1174 Olr1174 __SEG__ Chr8 {Rattus norvegicus} MKMENHTLISEFFLLDLSDDPKLQPFLFGLFLSMYLVTMLGNLLIILAVSSNSQLHNPMYFFLSNLSFVDICFISTTVPKMLVNMQSQTKDISYIECLTQVYFFNTFVGM
DDVLLTLMAYDCFVAICNPLKYTIIMNPRVCTLLVLMFWIIMFCISLIHVLLMNELNFSRGTKIPHFFCELAQVLKVSNSDTHINNIFMYVLSSLLGVIPMTGILMSYSQ
IVSSLLRMSSTVSKYKAFSTCGSHLCVVCLFYGSVIGVYFSSSVVLSTQRIMVASLMYTVISPMLNPFIYSLRNKDVKVALGELFIRVAPCPSWINDIITKFILKNIRQN
L*
903 >lcl|NP_001001017.1|Plus114130463..14131401 NW_047798 olfactory receptor Olr1143 Olr1143 __SEG__ Chr8 {Rattus norvegicus} MGAVNQTTISEFILLGLSDDPALQPFIFTLFLSMYLITTLGNLLIILAVSSDSQLHTPMYFFLCNLSFNDICLINTTIPKMLWNIQGEDQTITYTGCLSQVCLILNFGGI
ENCLLAVMAYDRYVAICKPLKYTAIMNQYLCVMLLLFSLFLSIAHALFHTLMVLLLSFCTEIKIPHFFCELAQIIRLACSDNFINYVLIYTVSVLFFGVPVFGIILSYIN
ILSSVLRMSSLGGKYKAFSTCGSHLSVVSLFYSTGFGVHISSAFTDSPRKTVVASVMYTVVTQMLNPFIYSLRNKEMKKAFRKITGRIPFLL*
904 >lcl|NP_001001018.1|Plus1complement(6483976..6484926) NW_047562 olfactory receptor Olr205 Olr205 __SEG__ Chr1 {Rattus norvegicus} MEFRNSTLGSGFILVGILDDSGSPELLCATVTALYMLAITSNGVLLLVITMDARLHVPMYLLLGQLSFIDLLLTSVITPKAVMDFLLKDNTISFEGCAFQMFLELALGSA
EDLLLAFMAYDRYVAICHPLNYMIFMRPSVCWFIVGTTWFLASVIALVFTIYTMHYPFCQSRQIKHLFCEIPPLLKLACADTSTYELVVYLTSVSVLILPVAVIMASYVR
ILLTVFYMPSNEGRKKALVTCSSHLIVVGMWYGGSSLMYVLPSQFHSPKQDNILSIFYTVVTPALNPLIYSLRNKEVTGALRRILRRQLLPIQTTF*
905 >lcl|NP_001001019.1|Plus1complement(24703068..24703991) NW_047563 olfactory receptor Olr349 Olr349 __SEG__ Chr1 {Rattus norvegicus} MENNTKVTEFLLLGLTNDPGLQLPLFMIFLLIYTITMIGNLGLILLIFLDFRLHTPMYFFLGNLSLVDFCYSSAVTPKVMTGLLIGNKVISYNDCAAQMFFFVAFASVEN
YLLASMAYDRYAAVCKPLHYATTMTTSMCACLSIGSYVCGFLNASIHTGDTFSLSFCRSNIVHHFFCEIPAVMVLSCSDRHVSELVLFYVVSFNIFLALLVISISYILIF
ITIFKMHSSAGYGKAVSTCASHFTAVSIFYGTVIFMYLLPSSSHSMDTDPIASVFYTMIIPMLNPLVYSLRNKEVKSAFTKIFQVAK*
906 >lcl|NP_001001020.1|Plus110344669..10345601 NW_047799 olfactory receptor Olr1249 Olr1249 __SEG__ Chr8 {Rattus norvegicus} MVLTNGSLVTEFVLLGLTDNPDLQIPLFLVFLVMYMITAFGNLTLILLTVLNSHLHTPMYFFLFNLSFIDFCYSSVFIPKMLMNFVLKKNIISFAGCMTQLYFFCFFAIS
ECYALTAMAYDRYVAICNPLMYNVAMSPKVCSYLMLGSYLMGFSDAMIHTGCILRLTFCDGNTINHYFCDLLPLMQLSCTSTYVNEVEIFIVGGKDIAVPSIIIFMSYGF
ILSNILQIKSNVGRSKAFNTCSSHIIAVSLFYGSCAFMYLKPSSAGSLNEGKVSSVFYTIVVPMMNPLIYSLRNKDVKLALRKTLSRKKC*
907 >lcl|NP_001001021.1|Plus1complement(3122280..3123230) NW_047562 olfactory receptor Olr51 Olr51 __SEG__ Chr1 {Rattus norvegicus} MLILNNTNPHPPTFLLTGIPGLRAAQVWISIPFCLLYVIALSGNSMILLVILREQSLHEPMYYFLSMLSVTDLSLSLCTLSTTLGVLWFEAREINLNACIAQMFFLHGFT
FMESGVLLAMAFDRFVAICDPLRYTTILTNARIAQIGIIVLIRNVAVMLPVVLFVKRLSFCSSLVLSHSYCYHVDLIQLSCTDNRINSILGLFALFSTTGFDCPCILLSY
VLIIRSVLSIASSDERQKAFNTCISHISAVAIFYIPLISLSLVHRYGHSAPAFVHTIMANVFLLIPPVLNPIIYSVKTKQIRKAIIKVLNQKQSQL*
908 >lcl|NP_001001022.1|Plus13244251..3245213 NW_047562 olfactory receptor Olr61 Olr61 __SEG__ Chr1 {Rattus norvegicus} MISSQAFINISFFQPQSFLMTGIPGLEAVHGWISIPFSFMYTVALTGNCLILLAVRRTHSLHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRFIGFNACLIQMFFL
HSFSVLESSVLLAMSFDRFVAISNPLRYASVLTNTVIIRIGVAIVARATLSLFPGPFLLKRLNYCPGKILLSHSFCFHADVMKLACADITVNILYGLYVVLSTVGVDSLL
IVMSYSLILYTVMGLASPRERVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYSVKSKPIRGAMFRVLRGKDQT*
909 >lcl|NP_001001024.1|Plus1complement(3716836..3717780) NW_047562 olfactory receptor Olr95 Olr95 __SEG__ Chr1 {Rattus norvegicus} MGPANESQFSPSTFWLMGIPGLEHLHVWIGIPFCSMYMVALMGNVTILAVVRAERSLHEPMFLFLCMLSITDLVLSTSTLPRMLCLFWMAAHDITFDACLAQMFFIHSFT
AMESGFFLAMAIDRYVAICDPLRHTTILTNSRIAKMGAVVVLRGVGFFSPHPILLKQLPYCRTRIIAHTYCEFMAVVKLACVDTGATKRYSLSVASVIGSCDGFFIALSY
VLILRAVFRLPSREASLKALGTCGSHVCVILVFYSTAVFTFLTHRFGHNVAPQIHIFIANMYLLVPPFLNPIVYGIRTKKIREYVLSFLRIKVS*
910 >lcl|NP_001001025.1|Plus13727417..3728373 NW_047562 olfactory receptor Olr96 Olr96 __SEG__ Chr1 {Rattus norvegicus} MAPSNFSGIVSSTFYLTGIPGYEEFHHWISIPFCLIYIVGVTGNCSILHIVRTDPRLHEPMYYFLAMLSLTDMAMSLPATVSLFRVLWSISREIQFNLCVVQMFLIHTFS
FTESSVLLAMALDRYVAICHPLRYATILTPKLIAKIGIAALLRSAIPLIPLLVRLAFFSFCRSHVLSHSYCLHQDIIRLACNDIRFNVIYGMVVILMLWGMDSLGILITY
VFILHSVLRIASREGRLKALNTCASHICAVLILYVPMIGLSIVHRFGKHSSPFVHVFMAHIYLMVPPVLNPIIYSVKTNQIRQGILHLICPHKITSAM*
911 >lcl|NP_001001026.1|Plus1complement(4152314..4153261) NW_047562 olfactory receptor Olr127 Olr127 __SEG__ Chr1 {Rattus norvegicus} MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIPMYIFLAILAVTDIALSTCILPKMLGIFWFHMPQIFFDACLLQMELIHSFQ
ATESGILLAMALDRYVAICNPLRHATIFSPQLTTCLGAGALLRAFILVSPSIILIKCRLKYYRTTNISHSYCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFS
YVRIFITVFQLPQKEARLKAFNTCIAHICVFLQFYLLAFFSFFTHRFGAHIPSYVHILLSDLYLLVPPFLNPIVYGVKTKQIRDQALKMLFSKKY*
912 >lcl|NP_001001027.1|Plus1complement(4286945..4287880) NW_047562 olfactory receptor Olr129 Olr129 __SEG__ Chr1 {Rattus norvegicus} MWSNNSDAPFLLTGFLGLEMIHHWISIPFFVIYFSIILGNGTLLFIIWNDHSLHEPMYYFLAVLASTDLGMTLTTMPTVLGVLVLNQREIAHGACLIQSYFIHSLAIVES
GVLLAMSYDRFVAICTPLHYNSILTNSRVMKMALGLLLRGFVSIVPPILPLFWIPYCRSHILSHAFCLHQDVMKLACADITFNSIYPVVLVALTVFLDALIIVFSYVLIL
KTVMGIASGEERAKALNTCVSHISCVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSIKTKQIQRSIHHLLSRHSTT*
913 >lcl|NP_001001028.1|Plus1complement(5199547..5200503) NW_047562 olfactory receptor Olr174 Olr174 __SEG__ Chr1 {Rattus norvegicus} MSGANSSSVTTEYFILNGVPGLEDAHVWISLPFCFMYMIAVMGNCGLIYLIGHEEALHRPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNFKKIGFNSCLAQMFFVHMLT
AMESGVLMLMALDRYVAICYPLRYTTILTNPVIAKACLATFLRSVMLIFPFTLLTKRLPYCRGTLIPHTYCDHMSVAKVSCGNVKANAIYGLMAALLIGVFDICCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPALFTLFTHRFGGHTIPHHIHIIVANLYLLLPPTMNPIVYGVKTKQIRESIIKFLLGDKLGIT*
914 >lcl|NP_001001029.1|Plus1complement(5227844..5228809) NW_047562 olfactory receptor Olr175 Olr175 __SEG__ Chr1 {Rattus norvegicus} MSGANSSSLTPEFFILNGIPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIVHEEALHRPMYYFLTLLSFTDITLCTTTVPNMLCIFWFNLKKIGFKACLAQMFFVHTFT
ATESGMLMLMALDRYVAICYPLRYGTILTNPVIAKASLATFLRSVSFILPFTFLTKRLPYCRGNLIPHAYCDHMSVAKISCGNVKVNAVYGLLVALVVCAFDIFCITVSY
TMILRAVMNLSSADARHKAFSTCTSHICAIVITYVPAFFNFFTHRFGGHTIPHHIHIIVANLYLLLPATMNPIVYGVKTKQIRESVIKYFSGDKSGIADIK*
915 >lcl|NP_001001030.1|Plus1complement(5381860..5382798) NW_047562 olfactory receptor Olr181 Olr181 __SEG__ Chr1 {Rattus norvegicus} MSPGNSSWIHPSSFLLLGIPGLEESQFWLGFPFGTVYLTAVLGNVILLFVVHLEHSLHQPMFYLLAMLALTDLGLSTATVPRALGIFWFGFHKIAFRDCIAQMFFIHLFT
GIETFMLVAMAFDRYIAICNPLRYNTILTNRVICIIAGIGLFKNFILIFPLIFLILRLSFCGHNVIPHTYCEHMGIARLACVSIKVNVLFGLLLISMILLDVILIALSYV
KILHAVFKLPSWEARLKALNTCGSHVCVILAFFTPAFFSFLTHRFGHNIPQYIHILLANLYVMIPPALNPLIYGVRTKQIRDRVVIFFCKGV*
916 >lcl|NP_001001031.1|Plus15419754..5420695 NW_047562 olfactory receptor Olr186 Olr186 __SEG__ Chr1 {Rattus norvegicus} MLHSNKTQFHPSSFLLIGIPGLEDLHLWIGFPFFAAYLIAVLGNTIILFVIQTEHSLHQPMFYFLAMLACTDLGLSTATIPKMLGIFWFNLGEITFGACITQMYTIHLCT
GLESVVLTVMAIDRYIAICNPLRYSMILTNKVIAILGVVIIVRTLVFATPFIFLIFRLPFCGVRIVPHTYCEHMGLAKLACANIRVNVIYGLVAFSVGYIDLSVIGFSYI
RILQAVFRLPSWDARLKALSTCGSHVSVMLAFYLPALFSFMTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQIRERVVRMLNPKMH*
917 >lcl|NP_001001032.1|Plus15445259..5446197 NW_047562 olfactory receptor Olr188 Olr188 __SEG__ Chr1 {Rattus norvegicus} MPSINSTQFHPSFFILLGIPGLEVFHIWIAFPFCLVYLTSLVGNVTILFVIKTEHSLHQPMFYFLATLSMIDLCLSTSTIPKMLGIFWFNLQEISFGGCLAQMFFIHVFT
GMETVLLVVMAYDRFVAICKPLQYTTILTNKTISLLLSVVIGRNLVLVTPFVFLILRLPFCGHHTMPHTYCEHMGLARLACAPIKINIIYGLVVISHILVDMILIASSYV
LILQAVFRIPSQDARLKALNTCGSHVCIMLCFYTPALFSFMTHRFGQNIPHYIHILLANLYVVVPPALNPVIYGVRTKQIREKIIKIFIQKE*
918 >lcl|NP_001001035.1|Plus1complement(7006011..7006958) NW_047562 olfactory receptor Olr232 Olr232 __SEG__ Chr1 {Rattus norvegicus} MRQANQTQVTEFLLLGLSDDPHTQTLLFILFLGIYLVTVLGNLLLMFLVRADSRLHTPMYFFLCNLSFADLCFSTNIVPQALTHFLSRKKSISFRRCAAQLLLFLIFGCT
QCALLAVMSYDRYVAICNPLHYSSIMTWRLCIQLATVSWTSGILVSVVDTTFTLRLPYRGSNSIPHFFCEAPALLTLASIDTQTSEMAIFLMGVVILLIPVSLILVSYGH
IIVAVFRMKSAAGRFKAFSTCGSHLIVVILFYGSAIITYMTPKSSKEQEKLVSVFYAMVTPMLNPLIYSLRNKDVKGALWKVALKNFSSRPIITQ*
919 >lcl|NP_001001037.1|Plus18152793..8153740 NW_047562 olfactory receptor Olr250 Olr250 __SEG__ Chr1 {Rattus norvegicus} MAFLQDGNYTAVTEFILLGLTDDPVLRIVLFTIILCIYLVTVSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGISSSVTPNMLVNFLLDRNSISYIGCGIQLGSADFI
ASVECFLLAAMAYDRFMAICNPLLYSAKMSTQVCIQLVVGSYTGGFFNASLIVMVYFFSFLFCGPNIVDHFFCDFAPLVELSCSDVSDSVLLISFSAGSVTIITVFIIAV
SYSYILITILKIHSTEGRHKAFSTCTSHLTAVTLYYGTVTFIYVMPKSNYSTDQNKVVSVFYMVVVPMLNPLIYSLSNNEIKGALKRQLGMKTVS*
920 >lcl|NP_001001038.1|Plus1complement(8364155..8365099) NW_047562 olfactory receptor Olr257 Olr257 __SEG__ Chr1 {Rattus norvegicus} MACLEDGNHTVVTEFILLGLTDNLVLKVILFTIILCIYLVTMSGNLSTILLIRVSSQLHHPMYFFLSHLASVDIGYSSSVTPNMLANFLVTQNTISYIGCGIQLSLVDFF
GTAECFLLAAMAYDRFMAICHPLFYSTKMSPQVCVQLVLGSYIGGLLNASFAMAFFFSFLFCGPNIINHFFCDFAPVIELSCSDISVSVVVTSFSAGTVTMLTVFVIAIS
YTYILITILKMRSTEGRHKAFSTCTSHLTAVTLFYGTVTFIYVMPKSTFSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALRRQLGRKIFS*
921 >lcl|NP_001001039.1|Plus19048076..9049008 NW_047563 olfactory receptor Olr304 Olr304 __SEG__ Chr1 {Rattus norvegicus} MVNPNQTVLTEFVLQGFSEHPSLRLFLTGCFLSLYIMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIICTSSVLPKVLVGLLSEENTISFKGCMAQLFFLLWSGSS
EVLLLTVMAYDRYVAICFPLHYSSRMSQQLCGALAMGVWSLCAMNASVHTGLMTQLSFCGPKVITHFFCEIPPLLLLSCSSTYVNSIMTLVADAFYGGINFVLTLLSYGC
IIASILRMRSAEGKKKAFSTCSSHLIVVAMYYSSVFITYISPASSYSPERNKITSVLYSVLMPTLNPLIYTLRNKDVKLALSRILASFLH*
922 >lcl|NP_001001040.1|Plus19356693..9357628 NW_047563 olfactory receptor Olr313 Olr313 __SEG__ Chr1 {Rattus norvegicus} MLLNVNQTVVTEFMLQGFSEHPSLRLFLTGCFLSLYTMALMGNIVIIALVTSSTGLHSPMYFFLCNLATMDIVCTSSVIPKALVGLLSEENTISFNGCMAQLFFLAWSAS
SELLLLTVMAYDRYMAICFPLHYSSRMSPQLCGTLAMSVWSISAVNASVHTGLMTRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNSIMTLLGDAFFGGINFMLTLLSYG
CIIATILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVSSVLYSVLSPTLNPLIYTLRNKDVKLALGRILASFSH*
923 >lcl|NP_001001041.1|Plus1complement(23782536..23783477) NW_047563 olfactory receptor Olr334 Olr334 __SEG__ Chr1 {Rattus norvegicus} MIKERNITEIVQFILLGFSDFPHIKVLLLVMFLTLYITTLTWNLSLIVLIRMDSYLHTPMYFFLSNLAFIDICYISSTVPKMLSNLFQENQTISFVGCIVQYFIFSTMGL
SESCLMTAMAYDRYAAICNPLLYSSIMSPTLCSQMVMGSYTAGLIGSVSQVCTLLQLQFCGPNVIRHFFCDMPQLLNLSCTDTFFAQVVLLILTMLFCLSNALAIMVSYV
YIVLSIMKITSAKGRSKAFNTCASHLTAVSLFYTSSAFVYLSSSSGGSSSFDRFVSVFYTVVIPMLNPLVYSLRNKEIKDAVKRLQKKLGCCY*
924 >lcl|NP_001001042.1|Plus1complement(24536891..24537811) NW_047563 olfactory receptor Olr341 Olr341 __SEG__ Chr1 {Rattus norvegicus} MKNRTEVTQFILLGLTNDSSLQLPLFITFLLIYTITLVGNLGMILLIVLDSRLHTPMYIFLGNLSLVDLCYSSAVTPTVMTELLGGDKIISYNGCAVQMFFFGAFATVEN
YLLASMAYDRYAAVCKPLHYASIMTTSVYTGLIIGSYVISFMSASIHIGDIFTLSFCKSNVIHHFFCDVPAIIALTCFDNQARELVLLYIESLDVFFALIVICTSYMLIF
VTILNMHSTSGHRKAISTCASHFTAVSIFYGTVIFMYLQPSSSHYMDTDKVTSVFYAMVIPMLNPLVYSLRNNKVKNAFIKLILHY*
925 >lcl|NP_001001043.1|Plus124597911..24598846 NW_047563 olfactory receptor Olr344 Olr344 __SEG__ Chr1 {Rattus norvegicus} MDNNTKLSTFILLGLTDNPELQVPLFITFSLIYLITLIGNLGMIVLIWLDSRLHTPMYIFLSHLSLADCVYSSSVTPKVMAGFLTGDKVISYGGCVAQMFFFVAFASVDC
FLLAVMAFDRHAAVCKPLHYTTTMTTSVCARMVIACYAWGLFESAIHTGFTFSLPCCANVVHHFFCDIPPILALSCSDIYVNEIVLFILASFNVFFALIVILTSYAFIFI
AILRMRSAEGQKKAFSTCASHLTAVTIFYGTVIFMYLQPSSSHSMDNDQMASVFYTMVVPMLNPVVYSLRNKEVHNAFKKAVEKMNTLLSS*
926 >lcl|NP_001001045.1|Plus124811034..24811987 NW_047563 olfactory receptor Olr354 Olr354 __SEG__ Chr1 {Rattus norvegicus} MILMENTSEVTDFILAGLTDAPALQIPLFIIFTLIYFIALFGNLGMIMMILLDSRLHTPMYFFLCNLSLVDCVYASAITPKVMEGFLTGNKIISFNACAAQMFFFVAFGA
SESLILASMAYDRHAAVCKPLHYTTIMTSTTCILSVTCCYMCGILQSSIHVALAFRLSFCHSNMINHFFCDILPLLTISCSETHTNEIILLILATLDLVFTLLVILNTYL
LIFIAILRMRSAEAQRKAFSTCASHLITVSIFFGSLIFMYLQPRSSHSMDTDKIASVFYTMVIPMLNPVVYSLRNNEVKNAFKKIVGKLLSSLCSFD*
927 >lcl|NP_001001046.1|Plus125073747..25074691 NW_047563 olfactory receptor Olr365 Olr365 __SEG__ Chr1 {Rattus norvegicus} MTLMENISEVTEFILVGLTDAPELQIPLFIIFTLIYLITLFGNLGMIMLILLDSRLHTPMYFFLCNLSLVDCVYASAITPKVMEAFFTGNNTISFNGCAAQMFFFVAFIA
IESLILASMAYDRHAAVCKPLHYTTIMTSTTCIVIATCCYMCGILQSSIHVALAFRLSFCHSNMINHFFCDIPPLLTISCSDTHTNEITLLILATLDVVFTLLVILNTYL
LIFIAILRMRSAEAQRKAFSTCASHLITVSIFFGSLTFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPLVYSLRNKEVKNAFKKVVGKLMSSFS*
928 >lcl|NP_001001047.1|Plus125144817..25145752 NW_047563 olfactory receptor Olr367 Olr367 __SEG__ Chr1 {Rattus norvegicus} MQNISELTEFILLGLTDAQFLQVPLFIIFTLIYLTTLVGNLGMILLILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVIEGFLTEDKIISYNACAAQMFFFAAFATIES
FLLASMAYDRHAAVCKPLHYSTTMTTMICSVLLAGSYVSGLLQSSIHVAFTFHLSFCHSNVVNHFFCDIPPLLALSCSSIYTNEIILFMLAAFNVGFTLFIILTSYLLIF
VTILRMNSAESRKKAISTCASHLTTVFIFYGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKEVKNAFKKIAGKALSSLG*
929 >lcl|NP_001001048.1|Plus125297604..25298554 NW_047563 olfactory receptor Olr372 Olr372 __SEG__ Chr1 {Rattus norvegicus} MTWENHTLFMEFVFLAYPKHPVLRMLCFFGVSLAYGLIISGNILIVVSIKTEIRLHTPMYYFLGSLSGIELCYTAVVVPHILANTFQSEKTITLLSCATQMVFLIGLGSA
DCFLLAIMAYDRYFAICHPLQYPLIMTVTLCVRLVVASVVIGLFLSLQLVVFIFCLPFCQDRGIEHFFCDAPPMMRLVCATSHIHELSVLVAATIAIAVPFFFIATTYAL
IVAAVLKLHSAAGRHRAFNTCSSHLTVVLLQYGCCAFMYLRPVSSYHPKQDKFISLVYILGTPFLNPLIYTLRNNEMKGAIAKVLTRKYLSWKIIG*
930 >lcl|NP_001001049.1|Plus110242453..10243397 NW_047657 olfactory receptor Olr445 Olr445 __SEG__ Chr3 {Rattus norvegicus} MEEKNETTVSEFLFLGLTNHLHQKIVLFIMLFFVYLVTLGGNLGMITLIWVDPRLHTPMYFFLSHLSFVDMCSSSSIAPRMLCDIFIEKKIISFVGCAVQLWFAGLFVGT
ECFLLAAMAYDRYTAICKPLLYTLIMSKRVCAQFVLGPYLLAAINITTHTTLTFCLPFCGPNTINHFFCDISPMLSLACADSSINKIVLFVLDGTIGVLSGLIIIVSYIC
ILMAILKIQSTDGRMKAFSTCSSHLAAVSILYGTLFFIYVRPNTDSSLNTNKVISLFYTVMIPMLNPLIYSLRNKEVKDAFRRKVQRKHFPRVW*
931 >lcl|NP_001001050.1|Plus110247754..10248698 NW_047657 olfactory receptor Olr446 Olr446 __SEG__ Chr3 {Rattus norvegicus} MEEKNQTIITEFLFLGLTDHLHQKIALFITLLFVYLVTLGGNLGMITLIWVDPRLHTPMYFFLSHLSFVDLCSSSSIAPKMLCDIFAKKKKISFMGCAAQMWFFGFFVGT
ECFLLASMAYDRYTAICKPLLYTLLMSQRVCVHLVVGPYAFAIINITTHTTLTFCLPFCGSNTINHFFCDVSPLFSLACADSWINKVVLFVFSGAIGVFSGLIIIVSYVS
ILMTILKIQTADGKRKAFSTCSSHLAAVSILYGTLFFIYVRPSASFSLNINKMISLFYTVVIPMLNPLIYSLRNKEVKGAFRRKVQRKHFPAGM*
932 >lcl|NP_001001051.1|Plus1complement(11750608..11751552) NW_047657 olfactory receptor Olr531 Olr531 __SEG__ Chr3 {Rattus norvegicus} MKLPEIRAEDNATTVTQFLLLGFSDLPNLQGFLFGMFSIIYIIILIGNSFIIVITRIDPALQKPMYFFLANFSSLEICYVSVTLPRILFNIAAQDRHISVLRCATQMCFF
LILGATECFLLAVMSYDRYVAICNPLHYPLVMNPTKCTQLAAGSWLGGIPVQIGQTCQIFSLHFCNSNKINHFFCDIPPILKLACGDTSINELSVYLVAILFAAVPFMLI
LASYSKIIATILKLPTATGRAKAFSTCSSHLLVVFLFFGSATVTYLRPKSNHSPGTDKLFSLFYTIVTPMLNPLIYSLRNKEVIAALRKLLPIK*
933 >lcl|NP_001001052.1|Plus1complement(12010698..12011636) NW_047657 olfactory receptor Olr544 Olr544 __SEG__ Chr3 {Rattus norvegicus} MQYTNYTKPTEFIFIGFTDYLPLRLMLFLVFLIVYILTLVGNMGLIILVNIDLSLQTPMYHFLSNLSFLDISYSTAIAPKMLVDFLASKKSISFYGCAIQMFFFACFADA
ECLILAAMAYDRYAAICNPLLYSTLVSRKVSFSLVVLAYFSGSVTSLVHVSLTFMLPYCRSNIVNHFFCDIPPLLALSCADTHINELLLFALCGTIQTSTFMVILTSYVC
ILITVLSIKSSGGRSKTFSTCASHLIAVTLFYGTLLFMYLRPTTSYFPDTDKVVALFYTVLFPMLNPIIYSFRNKDVKNALKKLFDKQGTFR*
934 >lcl|NP_001001053.1|Plus1complement(12049086..12050051) NW_047657 olfactory receptor Olr545 Olr545 __SEG__ Chr3 {Rattus norvegicus} MNLQRANKFKITETNITIPIEFVLLGFSDIPKLHWLLFGIFLFIYTIILLGNGIIILITRVDPSLQTPMYFYISNFSFLEIYYVSVTLPRMLMDLFTLKGNISFLACATQ
MCLFLILGATECFLLAVMAYDRYVAICNPLHYPVVMSTKLCTQLVIASWVIGIPIQVGQTYQILSLPFCDSNQINHFFCDIPPLLKLACGNIFVNEIVVFIFAILIVTVP
FMLILASYSRIISTILKLPSNTGRTKAFSTCSSHLIVVILFFGSGSVTYLKPKSSKYEGTDKLLSLFYTVFTPMFNPLIYSFRNKDVTGALRKLFTKFLAL*
935 >lcl|NP_001001054.1|Plus1complement(12066031..12066969) NW_047657 olfactory receptor Olr546 Olr546 __SEG__ Chr3 {Rattus norvegicus} MRLWNHTGVKEFILVGLTENLNWQVGLFFLFSIVYFIILVANWGMILLIWLNAHLHTPMYFFLSNLSFCDICYSTVIAPKMLINFLSEYKSSTFFGCVIQSFFFAVYITT
EGILLSMMAYDRYVAIANPLMYTVIMTHSICSQMVLVCYLGGLINSLTHTIGLLRLDFCGPNIVDHFFCDIPPLLKLSCSDAQINEMLLLFFSGVIGIFTFIIVMVSYIQ
IIIAILRIRSAEGRRKAFSTCASHLTTVTLLYGSATFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAVKRSVYRERSGP*
936 >lcl|NP_001001055.1|Plus1complement(12243115..12244053) NW_047657 olfactory receptor Olr552 Olr552 __SEG__ Chr3 {Rattus norvegicus} MEVWNSTGVKEFILIGLTENPNWQVPLFLLFCIIYFIILVGNCGMIFLIWLNVQLHTPMYFFLSNLSFCDICYSTIIAPKMIINFLSEHKSTRLFACILQSFFFAVYATT
EVVLLSMMAYDRYVAIANPLMYTVIMTQSICTQMILASYLTGLINSLIHTIGLLKLNFCGPNIVNHFFCDVPPLLKLACSDSHINEILLLVFSGIIAISTLIIVIVSYIH
IIIAILRIRSAMGRGKAFSTCASHLTAVALFYGSLTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEAAQKLMLGKRNAC*
937 >lcl|NP_001001056.1|Plus113065387..13066313 NW_047657 olfactory receptor Olr596 Olr596 __SEG__ Chr3 {Rattus norvegicus} MDRGNCSSVDEFIFLGITNNPGKNVALFTTFLFVYLTTLLANLGMIILIRMDTQLHTPMYFFLSNLSFCDFCYSTAIGPKMLVDLLAAEKSIPFVGCALQFLIFCVFADS
ECLLLAVMAFDRYQAISNPLLYTVKMSNTVCSMLMVGVYLVATTDGLVHTTLAFRLCFCGSNEINHFFCDLPPLYLLSCSDIQVNELALFIVFGFIELSTISGVLVSYCY
IILSVLNIRSAEGRFKAFSTCTSHLTTVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEALKKLKMKM*
938 >lcl|NP_001001058.1|Plus1complement(13707053..13708003) NW_047657 olfactory receptor Olr629 Olr629 __SEG__ Chr3 {Rattus norvegicus} MESTNNITEFILLGLCQNKKIKTLCFLLFLFCYIAILGGNMIILISITYSQLVQQPMYFFLNYLALSDLCYTSTVTPKFLSDLIIERNIISYPSCMLQLFTMHFFGGIEI
LILTVMAYDRYVAICKPLHYTIIMSRGRCQAMVTACCAGAFVHSFFQNLLAISLPLCGHNEMDHYFCDIYPLLTLSCTNTYRVGLLVVANSGMMGLVTFLVLMWSYSFIL
YTIRAYPAESRRKALSTCSSHVTVVILFFVPVLFIYIRPATTYPEDKVFALFYTILAPMFNPLIYTLRNTEMKNALRKVWCHKLFLFERESYDIHC*
939 >lcl|NP_001001059.1|Plus1complement(13718925..13719863) NW_047657 olfactory receptor Olr630 Olr630 __SEG__ Chr3 {Rattus norvegicus} MGNFTVFILLGLSDNQNIEVLCFVLFLFCYIAIWMGNVLIMVSITCTQLMDQPMYFFLHYLSLCDLCYTSTVTPKLLTDLLAERKIISYNNCMTQLFLLHLLGAIEIFIL
TAMAYDRYVAICRPLHYTVIMSRQRCNELLAVCCTGGFVHSASQSLLIAFVSFCHHNEIDHYFCDVYPLLKLACTDTQRIGLFVIVDSGLIALVTFVVLMVSYFLILHTI
SVYPAESRSKALSTCGSHITIVVLFFVPVVFIYIRPNTTFPEDKVFALFYTIIAPMFNPLIYTLRNLEMKCAIKKIWYHQIPSYKKQILPKK*
940 >lcl|NP_001001060.1|Plus1complement(14386700..14387632) NW_047657 olfactory receptor Olr662 Olr662 __SEG__ Chr3 {Rattus norvegicus} MLLNNNVTEFILLGLTQDPFRKKVLFVVFLLFYMGTLLGNLLIIATIKTSQALGSPMYFFLFYLSLSDTCFSTTIAPRTIVDSLLKQASISFTECIIQVFTFHFFGCLEI
FILILMAVDRYVAICKPLHYMTIMSRRVCGMLVAIAWVGSCVHSLVQIFLALSLPFCGPNEIDHYFCDLQPLLKLACSDTYMINLLLVSNSGAICTVSFLMLMVSYVIIL
RSLRNHSAEGRRKALSTCISHIIVVILFFGPCIFIYTRPATTFPMDKMIATFYSIGTPLLNPLIYTLRNAEVKNAMKKLWRKRVVSEDRK*
941 >lcl|NP_001001061.1|Plus1complement(14618615..14619550) NW_047657 olfactory receptor Olr671 Olr671 __SEG__ Chr3 {Rattus norvegicus} MQNQSSVTEFIILGLSQNPKVEKILFVVFLLVYLATVGGNMIIVVTIMYSPALLGCPMYFFLAFLSFQDACVSSTVTPKMIVDFLHEKKTISFGWCMTQLFSVHFFSGAE
MIILAVMAYDRYVAICKPLHYSSILTRRLCSILVAISWAGGFLHAIIQIIFTLQLPFCGPNVIDHYMCDLFPLLKLACTDTHIFVLLIFANSGAICIIIFSLLLVSYGVI
LFSLRAHSSEGRRKALSTCGAHITVVVLFLVPCILIYARDTSAFSFEKDTLLFVNVLTPLFNPMVYTFRNKEMINAIRKMWKRLIVVLVRY*
942 >lcl|NP_001001062.1|Plus1complement(14806976..14807908) NW_047657 olfactory receptor Olr677 Olr677 __SEG__ Chr3 {Rattus norvegicus} MENHSIVNEFILLGLSQNPRIEKILFAVFLLVYLATVGGNIVIIATIIYSPALLGSPMYFFLIFLSLLDTCTSTVVTPKLILDFFYERKSISFKGCMTQLFAFHFFTGVE
VIVLAAMAYDRYVAICKPLHYSAIMTWRLCGVLVGVAWAGGFLHSITQIIFTLQLPFCGPNVIDNYICDLFPLLKLACTDTHIFVILVFANSGSICIIIFSLLLVSYGVI
LFSLRAHSTEGRLKALSTCGSHITVVVLFFVPCILIYARTTSPFPYEKYVVIFVNVLTPLLNPMVYTFRNKEIKNAIRKMCRRSKVVSDN*
943 >lcl|NP_001001063.1|Plus1complement(15132943..15133863) NW_047657 olfactory receptor Olr696 Olr696 __SEG__ Chr3 {Rattus norvegicus} MKGNRMNVTEFILMGLTQNPQLQRILLLMLLITYIVTVTGNLLIVGTIVCSQSLNSPMYFFLAFLSVIDACYSSSIIPKMLADLLSETKTISFHGCMMQLFVEHFLGASE
IVLLVVMAYDRYVAICRPLYYVTRMNHHNCCLLVGICWIMGFLHSFGQILVTLWIPFCGPNVMDHFCCDIFPLLQLACADTFLLGLLIAANGGVIPVITFMILLMSYMVI
LFSLRTHSTAGRKKALSTCSSHITVVVLFFVPCIYTYMRPVTTFHMDKAIAVFYTLVTPMLNPIIYTVRNAEVKNAIKMILKKNQF*
944 >lcl|NP_001001064.1|Plus1complement(15155808..15156731) NW_047657 olfactory receptor Olr697 Olr697 __SEG__ Chr3 {Rattus norvegicus} MEKNNVTEFILLGLTQNPEGQKILFVTFLLIYIVTVMGNLLIMVTIMASQSLGSPMYFFLAYLSFIDTVYSTAIAPKMIIDLLYETKTISFRACMTQVFIDHLFAGAEVI
LLVVMAYDRYVAICKPLHYLTVMNRRVCVLMLLGAWIGGFLHSLIQFIFIYQLPFCGPNIIDSFVCDMYPLLKLACTNTYLIGLCMIANGGAICTVTFLILLVSYGVILH
SLKAHSLEGKRKALYTCASHITVVVLFFVPCIFLYARPTSTFPIDKSVTVVLTFITPMLNPLIYTLRNAEMKNAMKKLWRKKNLAPL*
945 >lcl|NP_001001065.1|Plus1complement(15403055..15403978) NW_047657 olfactory receptor Olr707 Olr707 __SEG__ Chr3 {Rattus norvegicus} MGENNNITEFILLGLTQDPDGRKALFVIFFLIYIVTMMGNLLIVVTVIASPSLGSPMYFFLASLSLLDALFSTAISPKLIADLLYDQKTISFRACMSQLFIEHLFGGVDI
VILVAMAYDRYVAICKPLHYLAIMNRRVCITLLIFAWTGGFTHSLIQIVFVYNLPFCGPNVIDHFICDMSPLLVLACTDTYFIGLTVIANGGVMCIVIFTLLLGSYGIIL
RSLKTQSQEGRRKALSTCSSHILVVILFFVPCIFMYARPVYNFPIDKCITVFYTIITPMLNPLIYTLRNSEIKSCMKKLWCKMLHAD*
946 >lcl|NP_001001066.1|Plus1complement(15435714..15436658) NW_047657 olfactory receptor Olr709 Olr709 __SEG__ Chr3 {Rattus norvegicus} MGERNNVTEFVLLGLTKDPAGQKVLFVMFLLIYIVTMVGNLLIVVTVIASPSLGSPMYFFLACLSFLDIVYSTSISPKLIFDLLCDEKSISFTACMSQLFIEHLFGGTEI
VILVAMAYDRYVAICKPLHYLTIMNQKVCIILLGFSWVGGFTHSMIQIVFVFNLPFCGPNIIDHFMCDMSPLLGLVCTDTYVIGLALIANGGAMCIVVFIVLIVSYGIIL
RSLKNYSQEGRRKALSTCSSHIMVVTLFFVPCIFMYARPVYNFSSDKYITVFYTVFTPMLNPLIYTLRNSEMKSSMQKLWCTMLTMDTIRLPCH*
947 >lcl|NP_001001067.1|Plus1complement(15670150..15671079) NW_047657 olfactory receptor Olr720 Olr720 __SEG__ Chr3 {Rattus norvegicus} MEPKNNVTYFVLLGLSQNPKVQKGLFVLFLLSYILTMVGNMLIVMTVTISNSLGSPMYFFLASLSFVDIIYSSAISPKLISDLFFSQNTISFKFCMTQLFTEHFFGGSEV
FLLLVMAYDRYVAICKPLHYSTIMKQWVCVVLLILSWIGGFLHSVIQLSTIYGLPFCGPNVIDHFMCDMYPLLKLVCIDTYAIGLLVMANGGLICTVVFLLLLISYGVIL
YSLKSLNQEGRWKALSTCGSHITVVVSFFVPCIFMYARPAKTFPIDKLLSVFYTVITPMMNPLIYTLRNSEMTNAMKKLWRRKVISGHK*
948 >lcl|NP_001001068.1|Plus1complement(38196524..38197462) NW_047657 olfactory receptor Olr747 Olr747 __SEG__ Chr3 {Rattus norvegicus} MNESNYSEVSEFIFLGLSTYRPTQYFLFAFSIISYAITFLGNFSVVFIVIFDPHLHSPMYFLLANLSFVDFCFSTSTVPKLISDLYSDHSIISIQSCIFQMFVLHLLGGC
EMVLLVAMAWDRYVAICKPLYYLTIMNPRMCFLLLIGAWIIGLIHSVAQLAFVVHLPFCASNEIDSFYCDLPRFIKLACIDTYRMEFLVTADSGLISLSTFFLLIMSYIF
ILFTVRKQSLGSLSKALSTLSAHISVVILFFGPCIFVYIWPFPTVPVDKFLAILDFMIIPILNLAIYTLRNKDMKVAMRRLSVQLLNKKNIC*
949 >lcl|NP_001001069.1|Plus1complement(38452284..38453222) NW_047657 olfactory receptor Olr760 Olr760 __SEG__ Chr3 {Rattus norvegicus} MEGGNQTVVSEFIFWGLSRSQRIEVLLFVVFLMLYLLIVSGNIVILVLITNDPHLHSPMYFLLANLSFIDMWLSSVTTPKMITDFLREHKTISFAGCMCQVFFAHCIAAG
EMVLLVVMAYDRYVAICKPLHYFTIMNLKRCTGLVLTSWTTGFVHAMSHLTVIVELPFCGPKEIDSFFCDMPLVIKLACMESCDLDILMNADCGLVAVTCFILLLISYTY
ILITVCQSSKAGASKALNTCTAHITVVLIFFVPCIFIYVWPLNITWLDKFLAVFYSVFTPLLNPAIYTLRNKEMKNAMKRFISNYLGHKRNF*
950 >lcl|NP_001001071.1|Plus1complement(421518..422459) NW_047719 olfactory receptor Olr862 Olr862 __SEG__ Chr5 {Rattus norvegicus} MIPGQNESWVSEFILIGFSSDPTTNSILFIVFLLIYLSSVLGNGLIIMLVCLDTQLHTPMYFFLCTLSLLDMSYVTTTVPQMLVHLLAHSQTISFAGCWLQMFVFGALGT
SESILFVVMAYDRYVAICYPLRYTVILNWSLCIWLASGTCVCGFFSALLHTFFTMRLPYCGPNKVNHYFCEGPSVRSLACMDTHLIEMVDLVLSVFVVLTPISLIVASYI
HITKAILKIKSTQGRCKAFSTCASHLTVVTFFYAPATYIYMRPNSSYSPERDKQISLFYNVFTALLNPVVYSLRNKDIKRAFLKVMGHVKVDS*
951 >lcl|NP_001001073.1|Plus15177963..5178907 NW_047773 olfactory receptor Olr964 Olr964 __SEG__ Chr7 {Rattus norvegicus} MSNHTETTVFILLGLSDDPKLQVVIFIFLFITYTLSITGNVTIITLTLVDSHLQTPMYFFLRNFSVLEVSFITVTIPKFLGTIISGDKTISFNNCIAQLFFFILLGVTEF
YLLAAMSYDRYIAICKPLHYLTIMSQNVCTMLVFASWLVSFLIIFPALMLLLQLDYCGSNVIDHYTCDYFPLLQLSCSDTKFLERMGFSCAVFTLMFTLVLIFLSYTHII
RTIVKIPSASQRSKAFSTCSSHMIVISISYGSCIFMYIKPSAADRASLTKGVAILNTSVAPMLNPFIYSLRNQQVRRAFMSMVRKMVFFQKYMK*
952 >lcl|NP_001001074.1|Plus1complement(5905306..5906241) NW_047773 olfactory receptor Olr984 Olr984 __SEG__ Chr7 {Rattus norvegicus} MNHTEIAEFILLGLSDDPDLQIVIFLFLLITYILSVTGNLTIIVLTFIDSNLQTPMYFFLRNFAFLEVSFTSVCIPRFLGSIVTRNKTISYNNCAAQLFFFIFMGVCEFY
ILTAMSYDRYVAICKPLHYTTIMNRKLCTLFVLCAWLGGFLTVFPPLMLLLQQDYCASNVIDHFACDFFPLLQLSCSDTLVLEVIGFYIALVALLFTLALVILSYMYIIR
TILRIPSTSQRKKAFSTCSSHMIVISLSYGSCIFMYANPSAKEKASLTKGVAILNTSVVPMLNPFIYTLRNQQVKQAFKGVVHKLIFSVSK*
953 >lcl|NP_001001075.1|Plus1complement(7038716..7039654) NW_047773 olfactory receptor Olr1022 Olr1022 __SEG__ Chr7 {Rattus norvegicus} MKNYTIITEFVLLGISGNRKLQVVIFVFLLITYIVSIIGNLTIIMLTLLDSHLKTPMYYFLCNFSFLRNYFHQCFHSQILASIITQVKTISYNNCLAQLFFFIFMGVTEI
FLLTTMSFDRYVVICKPLHYTLIMNQKACTLFVLTSWLAGFLTIFPPLMLVLKLDFCASNVIDHFCCDYFPLLQLSCSDTWLLEVTGFYVALVSLLSTLALVILSYMCIF
RTILRIPSASQRKKAFSTCSSHMIVISMSYGSCIFIYVKPSANERASLTKTVAILSTSVAPMLNPFIYTLRNHQVKQAFKDLVHKVGFYRNK*
954 >lcl|NP_001001076.1|Plus18104864..8105802 NW_047773 olfactory receptor Olr1064 Olr1064 __SEG__ Chr7 {Rattus norvegicus} MSNHTAVTVFILLGLTDDLQLQIVVFVLLFLTYMLSVTGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTTVCIPKFLVSIATGDKTISYNECAAQLFFTILLGATEF
FLLAAMSYDRYVAICKPLHYMTIMNSRICNLLVFLSWLSGFLIIFPPLLMGLQLDFCAANTVDHFFCDVSPILQLSCTDTHIIELMMLLSAILTLLVTLVLVNLSYTNII
RTILRIPSSQQRRKAFSTCSSHMVVVSISYGSCIFMYVKPSARERVALNKGIALLSTSVAPMLNPFIYTLRNKQVKDAFKNMTKKMELLSMK*
955 >lcl|NP_001001077.1|Plus1complement(8255727..8256674) NW_047773 olfactory receptor Olr1068 Olr1068 __SEG__ Chr7 {Rattus norvegicus} MKLQQSSNDTELTDFILLGFWTSSEARVPLFLLFLLIYLVIVLGNISMLTVIKIDSRLHTPMYFFLQNLSFLDLCYSTVIAPKTLATFLSKEKKISYNECATQFFFFALF
VGTEGFLLAVMAYDRFSAICSPFLYPVHMSQPACIRLVAGSYICGCINSMVQTGFTFSLRFCGENRLDHFFCDVPALIKISCVDTFVNEIVLFILSALIIISTITIILVS
YAYILSTVLKIPSSHGRSKTFSTCGSHIAVVSLFYGTVFFMYAQPGSISSPEKSKIVAVFYTLIIPMLNPLIYSLRNTEVKNALKKTLLRKILWH*
956 >lcl|NP_001001078.1|Plus1complement(3804876..3805793) NW_047784 olfactory receptor Olr1105 Olr1105 __SEG__ Chr7 {Rattus norvegicus} MRNHSAVREFVLVGLSTDPHIQPALFVLFLLVYLLTVVGNSLMLFVIAADSHLHTPMYFFLRQLSFLDLCHSSVTAPKMLENLLSEEKTILVESCLAQAFFVFATGGTEA
CLLAAMAYDRYVAIGSPLLYSQVMSSQLCVGLVWLSWGLAIVDALLNILLAVSLDFCEDQTIPHFSCELSSLFPLSCSDTAANFTLLLCSSVVHFFGTLVMIVCSYGRIV
SAVLRVSSSTGRSKAFSTCLSHLTTVILFYGSGFISYLLPVSGSPLEMVFSLQYSLITPMLNPLIYSLKNKEVKAAMGRMIRKHF*
957 >lcl|NP_001001079.1|Plus1complement(13963316..13964245) NW_047798 olfactory receptor Olr1137 Olr1137 __SEG__ Chr8 {Rattus norvegicus} MELRNQTTILEFHLLGLTSDPELEMLIYGIFLSIYLITILGNIIIFLAICSDSHLHTPMYFFLSILSINDMCLSTSTIPKMLVNIQAQNNTINYIQCISQLCFVSIFSGM
ENFLLAVMAYDRYVAICKPLRYTITMNPCCCVLLVLLCLLFSIMDALLHSLMVLQLSFCTNLEIQNFFCELTQVLKLACSDAFLNNLLILVAVFVFAGGAFCGVIFSYIY
IILSVLRMTSQTGKKKAFSTCTSHVSVVFLFYGTGFGVYFSSSVTEFTRYSAVASVMYTVVPQMLNPFIYSLRNRDMRKSFGKFIGWIS*
958 >lcl|NP_001001080.1|Plus1complement(13976658..13977599) NW_047798 olfactory receptor Olr1138 Olr1138 __SEG__ Chr8 {Rattus norvegicus} MEFSNQSGISEFFLIGLTYAPDIQSFIFGLFLCIYFVTIFGNILIILAVILDYHLHTPMYFFIANLSFTDICICTTIIPKMLLNIKTQNQSITYTGCLSQVCFVLIFGGL
ESCLLAVMAYDRYLAIVHPLRYTVIMNPCHCVLLALLSLIISTMNALLHSLMLLKLSFCTDQNILHFFCELVQVIKHACSDTFINNLLIYTVTSVFAGVPLAGIIFSYIQ
IVSSILKISSIQGRNKAFSTCGSHLSVVSLFYGTAFGVYMSSAVSDSSVKNIVFSIMYIVVPQMLNPFIYSLRNREMKQAMRHLLFSVVTSIS*
959 >lcl|NP_001001081.1|Plus1complement(8620439..8621368) NW_047799 olfactory receptor Olr1195 Olr1195 __SEG__ Chr8 {Rattus norvegicus} MAVENHSTVTEFILGGLTHRPELQLPLFLLFLGIYTVTMVGNLGMITLIGLNTQLHTPMYFFLSNLSLVDLCYSSVITPKMLINFVSQRNLISYVGCMSQLYFFLVFVIA
ECYMLTVMAYDRYVAICHPLLYNIIMSPALCSLLVAFVYAVGLIGSAIETGLMLKLNYCEDFISHYFCDILPLMKLSCSSTYDVEMAVFFLAGFDIIVTSLTVLISYAFI
LSSILHISSTEGRSKAFSTCSSHFAAVGLFYGSTAFMYLKPSTASSLAQENVASVFYTTVIPMLNPLIYSLRNKEVKAALDKTLRRKLF*
960 >lcl|NP_001001082.1|Plus18964729..8965676 NW_047799 olfactory receptor Olr1203 Olr1203 __SEG__ Chr8 {Rattus norvegicus} MTLERMALGNDSSVTEFILLGLTQNPELQLPLFFLFLGIYVVSVVGNLGLIVLIVLNPHLHTPMYYFLFNLSFIDFCYSTVITPRMLVGFVKQNIISHAECMTQLFFFCF
FVIDECYILTAMAYDRYAAICKPLLYQVTMSHRVCLLMTVGVYVMGLLEAITHTGNMLSLTFCDGNIINHYMCDISPLLQLSCRSTSMNEVVVFIVVGFNVTVPSLTIFI
SYTLILSNILSIHSTAGRSKAFSTCGSHVVALSLFFGAVAFMYLKPSSASVDDDDKVSTIFYTIVGPMLNPFIYSIRNKDVHIALRKTLKRSTFP*
961 >lcl|NP_001001083.1|Plus110036410..10037393 NW_047799 olfactory receptor Olr1225 Olr1225 __SEG__ Chr8 {Rattus norvegicus} MHMTMENGSSVSEFILMGLTDQPELQLPLFVLFLVNYTATVMGNLCLMNLICLNSNLHTPMYFFIFNLSFIDLCYSMVFTPKMLMSFVLEKNTISFRGCMTQLFFFLFFV
NSESYVLTAMAYDRYVAICKPLLYKVVMSPGICCLLIFGTYLMGFVSALFHTGFMIRLNFCDSNIINHYMCDIFPLLRLSCSSTYVNELVSSAVVGTAIILCCLIILISY
AMILFNIIHMSSGKGWSKALGTCGSHIITVSLFYVTGLLAYVKPSSAETVGQGKFFSVFYTFLVPMLNPLIYSLRNKDVKLAVKKNLEETHILVYPLISFLASSNPV*
962 >lcl|NP_001001084.1|Plus110152117..10153058 NW_047799 olfactory receptor Olr1233 Olr1233 __SEG__ Chr8 {Rattus norvegicus} MKPMRMENDSSVSEFILMGLTYQPDLRWPLFVLFLVNYTATVMGNLTLMTLICLNSHLHTPMYFFILNLSFIDFCYSFVFTPKMLMGFVSEHNTISFTGCMTQLFFFCLF
VNSECYVLTAMAYDRYVAICRPLLYTVVMSPRACCLLMLAAHLMGVSSAIVHTGCIIHLRFCGSKVINHYMCDTFPLLELSCGSNHASELVSSVSVAVVVVMSSLIIVSS
YSLILINVIHLSSSKGWSKAVSTCSSHIITVALFYGFGLLAHIKPSSSESVVQRKFFSVVYTFVLPLLNPLIYSLRNKDVKLAVKRTLKRVTT*
963 >lcl|NP_001001085.1|Plus1complement(10406454..10407386) NW_047799 olfactory receptor Olr1254 Olr1254 __SEG__ Chr8 {Rattus norvegicus} MDSVNISLVTEFILVGLTDQPYLQIPLFIVFLAMYLITALGNVSLIILTVLNSHLHTPMYFFLFNLSFVDLCYSSVFTPQMLMNFIKRKNTISYMECMVQLYFSCFFVIS
ECYVLTSMAYDRYVAICNPLLYKLVMSSKLCLNLMLGSYFIAFSESVAHTACMLRLTFCDANTINYYFCDIPPLLQLSCTTTHVNELVIFVVGSINIIVPISTIFISYGF
ILSSIFRMSSSEGRSKAFSTCSSHIIAAFLFFGSGAIRYFKPSSAGSMDEGKISSVFYTNVIPMINPLLYSLRNKDIKVALRKTLKKRNF*
964 >lcl|NP_001001086.1|Plus110435156..10436088 NW_047799 olfactory receptor Olr1256 Olr1256 __SEG__ Chr8 {Rattus norvegicus} MAVANGSLVLEFILLGITEEPKLQMPLFLLFLIIYVVTTLGNLALIILIALNSHLHTPMYFFLFNLSLIDLCYSSVITPKMLMNFILKKNVISYMGCMTQLYFFCFFAIS
EYYTLTSMAYDRYVAICNPLSYTIAMSPKVCSYLMLGSYLMGLLGATIHTGCMLRLTFCDGNTINHYFCDLLPLLQLSCTSTYVNEIELFIVAGKDIIVPTAIILTSYGF
ILCSIFQVRSTDSRYKAFSTCSSHIFAVSLFFGSSTFMYLQPSSTGSMDEGKISSIFYTIVVPMMNPLIYSFRNKDVKDALRKTLSRRMY*
965 >lcl|NP_001001087.1|Plus112295132..12296040 NW_047799 olfactory receptor Olr1318 Olr1318 __SEG__ Chr8 {Rattus norvegicus} MAKDNQSRVTEFILVGLTDKPELQLPMFLLFLGIYLFTVLGNLGMIILILLSSHLHTPMYFFLSNLSFIDLCYSTIVTPKMLVNFVTTKNVISYQECMTQLYFFLAFVIS
ECHMLAAMAYDRYVAICNPLLYNVTMSYQVCSWMVGGVYAMGYIGAAVHTLCMLRVVFCKANIINHYFCDLFPLMELACSSTYVNEVVLLCLSAFNIFIPTLTILGSYVF
IIASILRIKSTEGRFKAFSTCSSHFCAVSVFFGSLAFMYLQPFSVSSKDKGKVSSVFYTTVVPMLNPMIYSLRNRACQTSTK*
966 >lcl|NP_001001088.1|Plus1complement(7806171..7807109) NW_047817 olfactory receptor Olr1343 Olr1343 __SEG__ Chr9 {Rattus norvegicus} MRGENITKVSMFILLGFPTGPELQYLLFLLFLLAYLFVLVENLAIILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFAGCMTQLYFFSSLVCT
ECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFISSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGH
ITLAVLRIPSATGRWRAFSTCASHLTVVTFFYMAMIFMYVRPQAIDTRSSNKLISAVYTVLTPMMNPLIYCLRNTEFKDAARRTLGLGNIPQ*
967 >lcl|NP_001001089.1|Plus121642477..21643406 NW_047334 olfactory receptor Olr1391 Olr1391 __SEG__ Chr10 {Rattus norvegicus} MGTFNASLWEGFILVGFSDFPQLEVFLFVFILVFYLLTLFGNTTIIALSRLDVRLHTPMYFFLSHLSFLDLCYTTSTVPQLLINLCGFDRTISYGGCVAQLLIFLALVST
ECLLLGVMAFDRYAAVCRPLHYTTIMHPQLCQGLAISSWVSGLVNSVIQTGLVLAMPLCNHRLNHFFCEMPIFLKLACEDTNGTEVKMFVARTIILIFPAALILGSYGHI
ARAILRIKSMAGRRKAFGTCGSHLIVVSLFYGSGIYTYLQPIHRYSENEGKFVAVFYTILTPILNPLIYTLRNKDVKGALWKVLGKAQT*
968 >lcl|NP_001001090.1|Plus121656458..21657393 NW_047334 olfactory receptor Olr1392 Olr1392 __SEG__ Chr10 {Rattus norvegicus} MGTFNSSSYGAFFLVGFSDWPDLELVFFIVISIFYSLTLVGNSSIIALSQLDLRLQTPMYFFLSHLSFLDLCYTTSTVPQLLINLHGLDRTISYGRCVAQLLIFLALAST
ECVLLGVMAFDRYAAVCHPLHYTTIMHPQRCHALAISSWVGGLVNSLIQTGLMMVMPLCGHRLNHFFCEMPIFLKLACEETKRTEAKMFVARTIVLVCPAALILGSYACI
TRAVLKVKSAAGRRKAFGTCGSHILVVSLFYGSAIYTYLQPTHTYSESEGKFVAVFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRGTDSE*
969 >lcl|NP_001001091.1|Plus121687104..21688033 NW_047334 olfactory receptor Olr1394 Olr1394 __SEG__ Chr10 {Rattus norvegicus} MDSFNATLEERFILVGFSDWPQLELILFVFISIVYSLTFFGNTTIIALSRMDLRLHTPMYFFLSHLSFLDLCFTTSTVPQLLINLHGIDRTISYGGCVAQLFIYLALGST
ECVLLVVMAFDRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMTMPLCGRRLNHFFCEMPVFLKLACKDTGDTEAKMFVARAIILVFPATLILASYGHI
ARAVLKVKSMAGRRKAFGTCGSHLLVISLFYGSAIYTYLQPKSTYSESKGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRGTD*
970 >lcl|NP_001001092.1|Plus121710360..21711289 NW_047334 olfactory receptor Olr1395 Olr1395 __SEG__ Chr10 {Rattus norvegicus} MDSFNATLEEKFILVGFSDWPQLELILFVFISIVYALTLFGNTTIIAVSRMDLRLHTPMYFFLSHLSFLDLCLTTSPVPQLLINLHGLDRTISYGGCVAQLFICLALGST
ECVLLVVMAFDRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMTIPLCGRRLNHFFCEMPVFLKLACKDTGDTEAKMFVVRAIILVFPATLILASYGHI
ARAVLKVKSMAGRRKAFGTCGSHLLVVSLFYGSAIYTYLQPKSTYSESKGKFVALFYIIVTPMLNPLIYTLRNKDVKGALWKVLGRGTD*
971 >lcl|NP_001001093.1|Plus121731466..21732401 NW_047334 olfactory receptor Olr1396 Olr1396 __SEG__ Chr10 {Rattus norvegicus} MDSFNATLEERFILVGFSDWPQLELILFVFISIVYSLTLFGNTAIIALSRMDLRLHTPMYFFLSHLSFLDLCYTTSTVPQLLINLHGLDRIISYGRCVAQLFISLALGST
ECVLLVVMAFDRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMTIPLCGRRLNHFFCEMPVLLKLACKDTGDTEAKMFVARAIILVFPATLILGSYGHI
ARAVLKVKSMAGRRKAFGTCGSHLLVVSLFYGSAIYTYLQPKGSYSESDGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRSTGQE*
972 >lcl|NP_001001094.1|Plus121745533..21746465 NW_047334 olfactory receptor Olr1397 Olr1397 __SEG__ Chr10 {Rattus norvegicus} MRSFNLSLEGFLLVGFSDWPRLELILLVLLSIFYSLTLCGNITIIVLTQQDLQLQTPMYFFLAHLSFLDLCFTSSTVPQLLISLSQSDQMISYAGCMTQLFIALLLGGAE
CVLLVVMAFDRYVAVCRPLHYTSIMHPLLCHTLAISSWVGGLVNSLTQTSLIMTIPLCGHHLNHFFCEMLVLLKLACGDTGGTEADLFVAGAIILVCPVALILGTYAHIA
HAVLKIKSRAGRRKALGTCGSHLTVVSLFYGSAMYTYLQPVHMYSGSEGKFAALFYTIVTPMLNPLIYTLRNKDVKGALCKVLRKGRDKE*
973 >lcl|NP_001001095.1|Plus121777479..21778414 NW_047334 olfactory receptor Olr1399 Olr1399 __SEG__ Chr10 {Rattus norvegicus} MEYLNTSSEDGFILVGFSDWPHLEPIFFALISIFYSLTLFGNTVIIILSQLDLRLHTPMYYFLCHLSFLDLCYTASTVPQLLVNLSGLDRTISFGRCVAQLFIMLSLGGI
ECVLLVTMAIDRYAAVCRPLHYTSIMHPVLCRALVVFSWVGGLVNSLIQTSLVMAMPLCGHQLNHFFCELPVLLKMACEDTGGTEANLFVARVIILVCPLVLILGSYAHI
ARAVLNIKSMAGRRKAFGTCASHLTVVAMFYGSAISTYLQPVHRYSDSEGKFVALFYTVVTPMLNPLIYTLRNKDVKGALWKVLGRGTDSR*
974 >lcl|NP_001001096.1|Plus121793100..21794035 NW_047334 olfactory receptor Olr1400 Olr1400 __SEG__ Chr10 {Rattus norvegicus} MEYLNTSSEEGFILVGFSDWPHLEPIFFALISIFYSLTLFGNTVIIILSRLDLRLHTPMYYFLCHLSFLDLCYTTSTVPQLLVNLSGLDRTISFGRCVAQLFIISSLGGN
ECVLLVTMAIDRYAAVCRPLHYTSIMHPVLCRALVVFSWVGGLVNSLIQTSLVMAMPLCGHQLNHFFCELPVLLKMACEDTGGTEANLFVARVIILVCPLVLILGSYAHI
ARAVLNIKSMAGRRKAFGTCASHLTVVAMFYGSAIYTYLQPVHRYSDSEGKFVALFYTVVTPMLNPLIYSLRNKDVKGALWKVLGRGTDSR*
975 >lcl|NP_001001097.1|Plus1complement(32703856..32704812) NW_047334 olfactory receptor Olr1462 Olr1462 __SEG__ Chr10 {Rattus norvegicus} MRSANQSCFWDTPKDFILLGISDRPWLELPVFVVLLVFYILAVLGNISIILVSQLDPQLQSPMYVFLSHLSFLDLCYTTTTVPQMLFNMGSSRKTISYGGCTVQYAIFHW
LGCTECVVLAAMALDRYVAICEPLRYAIIMHRPLCQRLVATAWLSGFGNSLVQVILTVQLPFCGRQVLNNFFCEVPAMIKLSCADTTANDATLAVLVAFFVLVPLALILL
SYGFIAQAVMRIQSSRGRRKAFGTCSSHLLVVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFIYTLRNKDVKGALGRLLARTGRLCGR*
976 >lcl|NP_001001099.1|Plus14442612..4443532 NW_047355 olfactory receptor Olr1528 Olr1528 __SEG__ Chr11 {Rattus norvegicus} MDPLNRTQMTEFVLRGITDRPELQVPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFLNKNDMISVGECFAQFYFFCFSATT
ECFLLVAMAYDRYVAICNPLLYLVVMSNRLCIQFITVSYLIGFLHGLLHVGLLFRLTFCSSNVIDHFYCEILPLYTISCTDPSINALVAFIMAIFIQVNTFISIIVSYAR
VLFAILRTKSERGRRKAFSTCSSHLLSVSLFYGTLFIIYVLSGSDTDNYQGKMYSLFYTIIIPLLNPFIYSLRNKEVIGALRKLTK*
977 >lcl|NP_001001100.1|Plus14451868..4452788 NW_047355 olfactory receptor Olr1529 Olr1529 __SEG__ Chr11 {Rattus norvegicus} MEVNSTLLTEFVLRGITDRPELQVPLFLVFFLIYATTMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACISTTVTPKMLMKILNKNDMISMGECFAQYYFFCISATTE
IFLLVAMAYDRYVAICNPLLYLVVMSKRLCTVLISMSYIIGFVNCGLNIGLLFRLTFCKSNVIDHFYCEILQLYTISCTDASLNSLVVFICASSIQISTSVTIVVSYARV
LFAVLNMKSEKGRRKAFFTCSAHLLSVSLFYGTLLFMYVSPGSGSGKQKDKMYSLFYTVVIPLLNPFIYSLRNKEVLGALKKIIKC*
978 >lcl|NP_001001101.1|Plus14459911..4460828 NW_047355 olfactory receptor Olr1530 Olr1530 __SEG__ Chr11 {Rattus norvegicus} MGGNSTQLTEFVLRGITDRPELQVPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFLNRNDMISMGECFAQYYFFCFSATTE
IFLLVAMAYDRYVAICNPLLYLVVMSKRLCTVLISMSYIIGFLNPIVHVGLLFRLTFCRSNVIDHFYCEILPLYTISCTDPTLNALVIFIFASSIQISTSVTIVVSYARV
LFAVLYMKSEKGRRKAFFTCSSHLFSVSLFYGTLLFMYVSHGSAPGENQDKMYSLFYTVVIPLLNPFIYSLRNKEVLCALRKVIK*
979 >lcl|NP_001001102.1|Plus14476548..4477465 NW_047355 olfactory receptor Olr1531 Olr1531 __SEG__ Chr11 {Rattus norvegicus} MGGNSTLLTEFVLRGITDRPELQVPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACSSSSVTPKMLMKFLNRNDVISMGECFAQFYFFCFSGTTE
CFLLVAMAYDRYVAICNPLLYLVLMSKRLCTVLISMSYIIGFLNPIVHVGLLFRLTFCRSNIIDHFYCEIMPLYVISCTDPSLNELVAFIFASSIQISTSVTIVVSYARV
LFAVLNMKSEKGRRKAFFTCSAHLLSVSLFYGTLLFMYVSHGSVAGENKDKMYSLFYTVVIPLLNPFIYSLRNKEVLCALRKVIR*
980 >lcl|NP_001001103.1|Plus14504214..4505131 NW_047355 olfactory receptor Olr1532 Olr1532 __SEG__ Chr11 {Rattus norvegicus} MGGNSTLLTEFVLRGITDRPELQVPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMYLFLGNLAFADACTSSSVTPKMLMKFLYRNDMISIGECFAQFYFFCFSATTE
IFLLVAMAYDRYVAICNPLLYLVVMSKRLCTVLISMSYIIGFLNPIVHVGLLFRLTFCRSNVIDHFYCEIMPLYVISCTDPSLNGLVAFIFASSIQISTSVTIVVSYARV
LFAVLNMKSEKGRRKAFFTCSAHLLSVSLFYDTLLFMYVSPGSGSGKQKDKMYSLFYTVVIPLLNPFIYSLRNKEVLGALKKLIK*
981 >lcl|NP_001001104.1|Plus14761823..4762743 NW_047355 olfactory receptor Olr1543 Olr1543 __SEG__ Chr11 {Rattus norvegicus} MEVNRSQLTEFVLRGITDRTELQVPLFLVFFLIYVTTMVGNLGLILLIWKYSHLHTPMYYFLGSLAFADACTSSSVTPRMLVNILDNGKMISLFECMAQYYVFGSSATTE
CFLLVAMAYDRYVTICNPLLYLVVMSNRVCTCLISGSYIIGFLHPLVHVGLLFRLTFCKSNVIDHFYCEILPLYTISCTDPSVNAFVVFVFSAVIQAITFMSIAVSYAHV
LFSILKTKSQKSRRKAFSTCSAHLLSVSLFYGTLFFMYVSPGSGPSKYKNKMYSLFYTIVIPLLNPFIYSLRNKEVLGALRKIIRS*
982 >lcl|NP_001001105.1|Plus14798744..4799667 NW_047355 olfactory receptor Olr1545 Olr1545 __SEG__ Chr11 {Rattus norvegicus} MEKTTLLIQFVLTGLVHLPQWKIPLFLLFLVIYLITVVGNLGLITLIWNDPHLHIPMYLFLASLAFVDTWLSSTVTPKMLQDIFAKSKLISFSECVTQFFSFVMSATTEC
FLLAAMAYDRYVAICKPLLYPVIMTNRLCVRLLTLSLVGGFIHALIHGGFLFRLIFCNSNIIYHFYCDVMPLLKISCNDPSLNYLMIFIFSGSIQVFTITTILVSYTLVL
FSVLKQKSIKSIKKAVSTCGAHLLFVSLYYGPLLFMYVRPAPPQVGDQDMMDSVFYTIIIPVLNPIIYSLRNKQVKKSLAKFLKRHT*
983 >lcl|NP_001001106.1|Plus14821978..4822901 NW_047355 olfactory receptor Olr1546 Olr1546 __SEG__ Chr11 {Rattus norvegicus} MENTTLLIQFVLTGLVHLPQWKIPLFLLFLVIYLITVVGNLGLITLIWNDPHLHIPMYLFLASLACVDTWLSSTVTPKMLQDIFAKSKLISFSECVIQFFSFVVSATTEC
FLLAAMAYDRYVAICKPLLYPVIMTNRLCVRLLTLSLVGGFIHALIHGGFLFRLIFCNSNIIYHFYCDVMPLLKISCNDPSLNYLMIFIFSGSIQVFTITTILVSYTLVL
FSVLKQKSIKSIKKAVSTCGAHLLSVSLYYGPLLFMYVRPASPQVDDQDMMDSVFYTIIIPVLNPIIYSLRNKQVKKSLAKFLKRNA*
984 >lcl|NP_001001107.1|Plus14832683..4833606 NW_047355 olfactory receptor Olr1547 Olr1547 __SEG__ Chr11 {Rattus norvegicus} MENTTLLIQFVLTGLVHLPQWKIPLFLLFLVIYLITIVGNLGLITLIWNDPHLHIPMYLFLGSLAFVDTWLSSTVTPKMLQDIFAKSKLISFSGCMTQCFSFVMSATTEC
FLLAVMAYDRYVAICKPLLYPVIMTNRLCVHFLTLSLVGGFIHALIHEGFLFKLIFRNSNIIYHFYCDIIPLLKISCNDPSLNYLMLFIFSGSIQVFTITTILVSYTLVL
FSILKQKSIKSIKKAFSTCGAHLLSVSLYYGPLLFMYVRPAPPQVDDQDMMDSVFYTIIIPVLNPIVYSLRNKQVKKSLAKFLKRNT*
985 >lcl|NP_001001108.1|Plus14843632..4844555 NW_047355 olfactory receptor Olr1548 Olr1548 __SEG__ Chr11 {Rattus norvegicus} MKNSTVWTEFVLTGLTESPELQRPLFLLFLVIYLITIAGNLGLIALIWSDSHLHIPMYFFLGHLAFVDACLSSTVTPKMLLNFLQMSKMISFSDCMTQFFFFAVFVTTEC
FLLAAMAYDRYVAICKPLLYPMIMTNRLCICLLVLCFVGGFLHSSIHEGFLFLLTFCNSNIVHHFYCDIIPLLKISCTDSTLNFQLLFVFAGIVQVFTIVVVLFSYTLVL
FTILQRKSLQGIRKAFSTCGAHLLSVSLYYGPLLFIYVFPMSQEADDQDIIVSLLYAVIIPVLNPIIYSLRNKQVMDSLRKIFKKRV*
986 >lcl|NP_001001109.1|Plus17087046..7087984 NW_047399 olfactory receptor Olr1585 Olr1585 __SEG__ Chr13 {Rattus norvegicus} MDHVNCTWNWIFILAGFNTSGTLQQLAVFGTLCIYLLTLAGNLFIIVLVQADSGLSTPMYFFISVLSFLEIWYVSTTVPTLLHTLLHGHSPIPSAACFIQLYVFHSLGMT
ECYLLGVMALDRYLAICRPLHYHSLMSRQVQRELVLITWVAGFSAALVPAGLTATLPYCLKEVAHYFCDLGPVMQLACVDTSWHARVYIAVIGMINTCNLVFILGLYGGI
VKAVLRLPSAASRAKAFSTCSSHITVVTLFFGSAFIVYVGPPEIRAEGRGKLIALVYTLFTPFFNPIIYTLRNKEVKAAFKRVTQRIKGVLG*
987 >lcl|NP_001001110.1|Plus1complement(664414..665358) NW_047596 olfactory receptor Olr1694 Olr1694 __SEG__ Chr20 {Rattus norvegicus} MWIINQSSVDGFILLGFSDRPWLETPLFVIFLVAYIFALFGNISIILVSRLDPQLDSPMYFFVSNLSLLDLCYTTSTVPQMLVNLRGPEKTISYGGCVAQLYIFLALGST
ECILLAIMAFDRFAAICKPLHYPIIMSQRRCIHMATGTWISGFANSLVQSTLTVVAPRCGKRVIDHFFCEVPALLKLACTDTTVNEAELNVLGALLLLVPLSLILGTYVF
IAQAVLKLRSAESRWKAFNTCASHLLVVFLFYFTAISMYVQPPSSYSHDRGKIMALFYGIVTPTLNPFIYTLRNKDVKAALRRALTKEFWVKTR*
988 >lcl|NP_001001111.1|Plus1complement(710764..711729) NW_047596 olfactory receptor Olr1697 Olr1697 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFTKFSEVPGECFLLFTLILLMFLVSLTGNALIALAIYTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISQVGCATQMFFF
IFFGITECCLLAAMAFDRYMAICSPLHYATRMSREVCAHLAIVSWVMGCIVGLGQTNFIFSLNFCGPCEIDHFFCDLPPLLALACGDTSQIEASTFVVVVLCISSPFLLI
IYSYVRILVAVLVMPSPEGRHKALSTCSSHLLVVTLFYGSGSVTYLRPKSSHSPGTDKLLALFYTAVTSMLNPIIYSLRNKEVKAALKRTLGLEKILSINT*
989 >lcl|NP_001001112.1|Plus1complement(738121..739086) NW_047596 olfactory receptor Olr1699 Olr1699 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFAKFSEVPGECFLLFTLILLMFLVSVTGNTLIALAICTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEVREISQEGCATQMFFF
IFFGITECCLLAAMAFDRYMAICSPLHYATRMSRGVCAHLAIVSWVMGCIVGLGQTNFIFSLNFCGPCEIDHFFCDLPPLLALACGDTSQNEAAIFVVVVLCISSPFLLI
IYSYVRILVAVLVMPSPEGRHKALSTCSSHLLVVTLFYGSGSVTYLRPKSSHSPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRRILALKKILSINK*
990 >lcl|NP_001001113.1|Plus1complement(747810..748775) NW_047596 olfactory receptor Olr1700 Olr1700 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFAKFSEVPGECFLLFTLILLMFLVSLTGNTLIALAVCTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISREGCATQMFFF
TFFGITECCLLAAMAFDRCMAICSPLHYATRMSREVCAHLAIVSWGMGCIVGLGQTNFIFSLNFCGPCEIDHFFCDLPPLLALACGDTSQNEAAIFVAAILCISSPFLLI
LYSYVRILVAVLVMPSPEGRHKALSTCSSHLLVVTLFYGSASFTYLRPKSSHSPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRRTLDLRKIMSINR*
991 >lcl|NP_001001114.1|Plus1complement(757027..757983) NW_047596 olfactory receptor Olr1701 Olr1701 __SEG__ Chr20 {Rattus norvegicus} MSVNCSLWQENSLSVKRFAFAKFSEVPGECFLLFTLILLMFLVSLTGNTLIALAICTSPSLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISREGCATQMFFF
TFFGITECCLLAAMAFDRCMAICSPLHYATRMSREVCAHLAIVSWGMGCTVGLGQTNFIFSLNFCGPCEIDHFFCDLPPLLALACGDTSQNEAAIFVAAILCISSPFLLI
IYSYVRILVAVLVMPSPEGRHKVLSTCSSHLLVVTLFYGSGSVTYLRPKSSHSPGMDKLLALFYTAVTSMLNPIIYSLRNKEVKAALRRTLGLKKFCQ*
992 >lcl|NP_001001115.1|Plus1823732..824670 NW_047596 olfactory receptor Olr1707 Olr1707 __SEG__ Chr20 {Rattus norvegicus} MIVKNITTMSGFLLKGFSDNCELQILHALLFLVTYLLGSTGNFIIITITTLDSQLQSPMYYFLKHLSILDLSSLSVTVPQYVDSSLARSGYILYGQCMLQIFFFTGFAWG
EVAILTVMSYDRYVAVCLPLHYEVIMCPRKCRWAVTAVWLSSGIPGTLYVATIFSIKFCRAKIIHQFFCDVPQLLKLSCSNDHLVIMGVADFLSAMAFACFIGIVISYVH
IFSTVLRMPSAESRSKVFSTCLPHLFVFSLFLSTGSCAYLNPTSDSPTALEFLFSAFYTVLPPTLNPLIYSLRNETIKSVVRKLLFSTKFAG*
993 >lcl|NP_001001116.1|Plus1complement(1142795..1143724) NW_047596 olfactory receptor Olr1720 Olr1720 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPDFILLGLSSDPEKWQLFFSIFLAFYLLGLSGNLLLLLAIGADVHLHIPMYFFLSQLSLVDLCFITTTAPKMLQTLWTGDGSISFSGCLTQVYFIAVFADMDNL
LLAVMGIDRYAAICHPLLYPLLMTPCRCGVLASGSWGVAHCASLVYTLCLSQLSFHSNQEIPHFFCDSRPLLWLSCSDTHLNEFLMMTLSAVLGISALLCIVSSYGCIFC
AVARVPSAKGKRKALATCGSHLSVVLLFYSTVFANYLKSPSSSHSSGEVVAAVMYTLITPTLNPFIYSLRNKDVKNSLRRTLNMEKSQD*
994 >lcl|NP_001001117.1|Plus1complement(1160966..1161895) NW_047596 olfactory receptor Olr1722 Olr1722 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPDFILLGLSSDPEKWQLFFSIFLAFYLLGLSGNLLLLLAIGADIHLHTPMYFFLSQLSLVDLCFITTTAPKILQTLWTGDGSISFSGCLTQFYFFALFADMDNL
LLAVMAIDRYAAICHPLLYPLLMTPCRCELLACGSWGLAHCVSLIYALLLSQLYFHTNEGIPHFFCDFGPLLLLSCSDTHLTESLMMGLSAVLGISALFCIVSSYASIFH
AVFRVPSAQGKRKALATCSSHLSVVLLFYSTVFATYLKPPSTSHSSGEVVAAVLYTLVTPTLNPFIYSLRNRDVKSSLRKILNIEKSWD*
995 >lcl|NP_001001119.1|Plus11336577..1337518 NW_047596 olfactory receptor Olr1734 Olr1734 __SEG__ Chr20 {Rattus norvegicus} MLNQTSVKEFVLLGVTDLQEPQPFLFAIFLIIYFVNITGNGAILMIVILDQKLHSPMYFFLGNLACLDICYSTVTVPKMLKNLLSTSKAISFLGCITQLHFFHFLGTTES
LLLAVMAFDRFVAICKPLHYPIIMNWQICILMAVTIWTIAFLHALLHSVMTSRLSFCGPNHVHHFFCDVKPLLELACGNTELNLWLLNTVTGTVASVPFFLTFLSYFYII
TYLFLKTRSCSMLHKALSTCASHFMVVILFYAPVLFTYIRPASGNSLDQDRIIAIMYSVVTPALNPLIYTLRNKEVRNALNRKVRRCLFLEEI*
996 >lcl|NP_001001120.1|Plus18695635..8696567 NW_047799 olfactory receptor Olr1197 Olr1197 __SEG__ Chr8 {Rattus norvegicus} MTVKNSSVTEFILAGLTDQPGLRLPLFFLFLGFYMVTVVGNLGLIFLIGLNSHLHTPMYFFLFNLSVVDFCFSSTIIPKMLMSFISKKNIISHSGCMTQLFFFCFFVVSE
TFILSAMAYDRYVAICNPLMYTVTMSPQVCLLLLLGAYLMGFSEAMAHTGNLMNLTFCADNLVNHFMCDILPLLELSCNSTFINELVVFIVVAIDIAVPIVSIFISYALI
LSSVLRMHSTEGRSKAFSTCSSHLIVVCLLFGSGAFMYLKPPSILPLDQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLGKKILS*
997 >lcl|NP_001001121.1|Plus17889287..7890258 NW_047817 olfactory receptor Olr1347 Olr1347 __SEG__ Chr9 {Rattus norvegicus} MATQVHRNGSLSAVSLQGFVLVGFGGSAETQVLLFAVFLSLYVVTVLGNLTMIVVITLDARLHSPMYFFLKNLSFVDLCYSSVIAPKAMTIFLSSSKVISFAGCATQFFF
FSLLVTTEGFLLAVMAYDRFMAICSPLKYPVTMCPMACTRLVLGAYCGGCLNSIVETSLTFQLPFCSSNRINHFYCDVPPLLQLACADTTLNELVMFGICGLIIVSTTLV
VLVSYGYITVTILRMHSGSGRHKLFSTCGSHMTAVSLFYGTVFVMYAQPGALTSMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKDALRRLGQRHSLVKEDVR*
998 >lcl|NP_001001122.1|Plus116048..16974 NW_047487 olfactory receptor Olr1652 Olr1652 __SEG__ Chr17 {Rattus norvegicus} MTNFTHVSEFILLGFKGGPGIQMLLFLIFLFLYVIAVVGNFGMIIIIRMDAHLHTPMYAFLQSLSFLDICYSSTIAPRALINCLKQDHTISFGGCATQFFFLSLFGTTEA
FLLAAMAYDRFIAICNPLLYSVSMSGWVCGLLVSGSYSWGAVNAVTQTTMTFTLSFCGSNEINDFFCDVPPLLSISCSDTFINQLVLLALCGSIIVSTFLTVFVSYIYII
STILKIRTVQGRQKAFSTCASHLIGVCLFFGTVFFMYAQPSAVSSMEQSKVVSIFYTIVIPMLNPLIYSLRNKDVKQALKRSRQRFSS*
999 >lcl|NP_001001123.1|Plus110235006..10235950 NW_047657 olfactory receptor Olr444 Olr444 __SEG__ Chr3 {Rattus norvegicus} MEEKNQTVMPAFLFLGITDNLHQKIVIFIIFSFVYLVTLGGNVGMITLIWLDPRLHSPMYFFLSHLSFVDVCSSSSIAPKMLCDIFAENKTISFVGCAAQMWFFGLFVAT
ECFLLAAMAYDRYAAICKPLLYTLIMSPHLCVLLVIGPYAIALISTMTHTTLTFCLPFCGPYIINHFFCDISPLLSLACTDTKFNKVVLFVLAGAVGVFSGLIILMSYVC
ILMAILKIQTANGRCKAFSTCSSHLAAVSILYGTLFFIYVRPNASSSLNINKVISLFYTQVIPMLNPVIYSFRNKEVKDAFRRNLQKKHFLVGA*
1000 >lcl|NP_001001124.1|Plus110566695..10567633 NW_047657 olfactory receptor Olr468 Olr468 __SEG__ Chr3 {Rattus norvegicus} MLKKNYTAVTEFILLGLTDRAELQPVLFLVFLLIYLITVTGNVSMIFLIRSDSKLHTPMYFFLSHLSFVDLCYATNVTPQMLVNFLSKRKTISFIGCFIQFHFFISLVIT
DYYMLTVMAYDRYMAICKPLLYTSKMSRSVCRSLVAAPYIYGFANGLAQTILMLRLTFCGPNEINHFYCADPPLMVLACSDTYVKETAMFVVAGSNLSCSLIIILISYIF
IFTAILRIRSAEGRRKAFSTCGSHLAAVTVFYGTLFCMYLRPPSEKSVEQGKIVAVFYIFVSPMLNPLIYSLRNKDVKRAIRKVVKKEVFLK*
1001 >lcl|NP_001001125.1|Plus110598038..10598976 NW_047657 olfactory receptor Olr471 Olr471 __SEG__ Chr3 {Rattus norvegicus} MVRGNYSMVTEFILLGLTDRPELQPLLFVLFLVIYLITVGGNLGMMVLIRIDSRLHTPMYYFLASLSCLDLCYSTNVTPKMLVNFLAEKKTISYAACLVQCYFFIAMVIT
EYYMLAVMAYDRYMAICNPLLYSSKMSKGVCVRLIAGPYIYGFLSGLMETMWTYRLTFCGSNIINHFYCADPPLIRLSCSDTFIKETSMFVVAGFNLSNSLLIILISYLF
ILIAILRMRSAEGRRKAFSTCGSHLVAVTVFYGTLFCMYVRPPTDKSVEQSKIIAMFYTFVSPMLNPIIYSLRNKDVKHAFQKLVRRNVLSK*
1002 >lcl|NP_001001126.1|Plus113874969..13875898 NW_047657 olfactory receptor Olr637 Olr637 __SEG__ Chr3 {Rattus norvegicus} MMHNNSVTEFILLGLTQDSEKQKAIFGVFLILYLMTLLGNFLIVVTIKLSQTLGGPMYFFLFYLSFADACFSTTTAPRLIVDSLFQKKIITYNECMTQIFAGHFFGCMEI
FVLILMAFDRYVAICKPLRYTTIMNQRICGILVILAWVGSCVHSSAQIFLALRLPFCGPNVIDHFSCDLQPLLKLACMDTYVINLLVVSNSGAICTVSFIVLLISYIVIL
YSLRNHSAEGRRKALSTCTSHFIVVVIFFGPCIFIYTRPLITLPIDKMVSVFYAIATPLLNPLIYTLRNAEVKNAMKKIWCGKALIKNI*
1003 >lcl|NP_001001269.1|Plus1complement(3398210..3399151) NW_047562 olfactory receptor Olr70 Olr70 __SEG__ Chr1 {Rattus norvegicus} MVLLYNSSLQKATFFLTGFQDLEKFHGWISIPFCSIYLIVILGNLTILHVIRTDATLHEPMYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREIGIPACFTQLFFIHTLS
LVESSVLLSMSFDRYVAICNPLRYSTILTSRRIVKMGLSSVLRSALLILPLPFLLKRFHYCRSHVLAHAYCLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSY
TLILHAVLGKASRQERLRALNTCISHICAVLLFYIPMIGLSLVHRFGEHLPRIVHILMSYVYLLVPPLMNPIVYSIKTKQIRQRIIKKFEFVK*
1004 >lcl|NP_001001270.1|Plus1complement(3521146..3522099) NW_047562 olfactory receptor Olr80 Olr80 __SEG__ Chr1 {Rattus norvegicus} MTLPNDTQFHPSTFLLLGIPGLESIHIWIGFPFCVVYMIALLGNLTILSVIKTESSLHQPMFYFLAMLAAIDLGLSTATIPKMLGIFWLNLREILFEDCLIQMFFIHKFT
LMESSVLLAMAYDRYVAICIPLRYSTILTNKVVSIIGIVVLVRAIIFVIPFIFLILRLPFCGHHIIPHTYCEHMGLARLSCASVKANVIYGLCAICNLLFDIVAIALSYI
QILRIVFHLPSLEARLKSLSTCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQIYDRVKKMLLQVQGKEKD*
1005 >lcl|NP_001001271.1|Plus13532081..3533019 NW_047562 olfactory receptor Olr81 Olr81 __SEG__ Chr1 {Rattus norvegicus} MTIQSNRSVFHPATFFLIGIPGLEEIHAWISLPFCCIYLVALVGNTMILVVIKTGRSLREPMFYFLAILSSVDLALSTTSVPRMLGIFWFDAHEINFGGCVAQMFLIHAL
TGMEAEVLMAMAFDRYVAICVPLHYTTILTSHVLMGISICVVVRPTLFICPMIYLIYRLPFCQAHVIAHSYCEHMSIAKLSCGNIHINAVYGLFVVSFFLLNLVLIGISY
GYILHAVFRLPSHDARLKALSTCGSHVAVLCVFYIPSVFSFLTHRFGHNIPHYIHILVANLYLVIPPFLNPIIYGVRTKQIRERVLHIFTKR*
1006 >lcl|NP_001001272.1|Plus1complement(4296532..4297455) NW_047562 olfactory receptor Olr130 Olr130 __SEG__ Chr1 {Rattus norvegicus} MWSNNSDAPFLLTGFLGLEMIHHWISIPFFVIYFSIILGNGTLLFIIWNDHSLHEPMYYFLAVLASTDLGMTLTTMPTVLGVLVLNQREIAHGACFIQSYFIHSLAIVES
GVLLAMSYDRFVAICTPLHYNSILTNSRVMKMALGLLLRGFVSIVPPILPLFWFPYCHSHVLSHAFCLHQDVMKLACADITFNRIYPVVLVALTFFLDALIIVFSYVLIL
KTVMGIASGEERAKALNTCVSHISCVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSIKTKQIQRSILRLLCV*
1007 >lcl|NP_001001273.1|Plus14326953..4327900 NW_047562 olfactory receptor Olr132 Olr132 __SEG__ Chr1 {Rattus norvegicus} MPTMWLNISSSPFLLTGFPGLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPMYYFLGMLAATDLGVTLTTMPTVLGVLWLNHREIGHGACFSQAYLIHTLSI
VESGVLLAMAYDRFIAIRNPLRYTTILTDTRVIKIGIGVVMRAGLSIMPIIIRLYWFPYCRSHVLSHAFCLHQDVIKLACADISFNRLYPVVVVFAMVLLDFLVIFFSYI
LILKTVMGIASTDERAKALNTCVSHICCILVFYVTVVGLTFIHRFGKHVPHVVHITMSYIYFLFPPFMNPVIYSIKTKQIQSGLLRLFSLPWSKT*
1008 >lcl|NP_001001274.1|Plus1complement(4466150..4467100) NW_047562 olfactory receptor Olr141 Olr141 __SEG__ Chr1 {Rattus norvegicus} MGAENNESLDLLSVFLTGIPGLEAQHGWFSIPFFIMYMVAIVGNSLIMAAVQEDSALHEPMYLFLSMLAITEVGVSVSTLPTVMGILWFDAYRIDFDGCLAQMFFIHTFS
GMESGVLLAMSYDRFVAIYNPLRYTAILTLPRIISMGLGITLKSVALMAPLPILLKQLPYCHINILSHSYCLHSDLIQLPCADTRLNSILGLAIVLATFGLDSLLIVVSY
GLILYTVMGIASGEGRKKALNTCVSHICAVLIYYVPMIGVSVMHRVAKHASPVVHTLMSSIYLFVPPVLNPIIYSVKTRPIQQGIANLFSFKKGLI*
1009 >lcl|NP_001001275.1|Plus125329433..25330383 NW_047563 olfactory receptor Olr373 Olr373 __SEG__ Chr1 {Rattus norvegicus} MTWENHSVLMEFVFLAYPNHLELRMLCFLGVSLAYALIISGNILIVVSIQTETRLHAPMYYFLGSLSGIELCYTAVVVPHILTNTLQSEKTITLLSCATQMVLFIGLGSA
DCFLLASMAYDRYVAICHPLQYPLFMTVTLCVRLVVASVIIGMVLSLQLVIFIFCLPFCQDRGIEHFFCDVPPVMQLVCATSHIYELSVLVAAALAIVVPFFFIATTYAL
IGAAVLKLHSATGRHRAFNTCSSHLTVVLLQYGCCAFMYLRPKSSFHPKQDQFISLVYTLGTPFLNPLIYTLRNNEMKGAIEKVLTRNYFSQKIVQ*
1010 >lcl|NP_001001276.1|Plus1complement(25424941..25425885) NW_047563 olfactory receptor Olr377 Olr377 __SEG__ Chr1 {Rattus norvegicus} MAGKNYTFVTQFFLTAFTEHPEWGLPLFLLFLSFYLSTLLGNTGMIILIQKNRRLQTPMYFFLSHLSFVDICYSSVIIPQMLAVLWEHGTTISQVRCAVQFFLFTFFASI
DCYLLAIMAYDRYVAVCQPLLYVTIMTEKACVGLVTGAYVAGFSSGFIRTVTAFTLSFCGSNEINFIFCDLPPLLKLVCGNSYVQEVVIIVFAIFVMPACIVVISVSYLF
IIVAIMQIRSAGGRAKTFSTCTSHLTAVALFFGTLIFMYLRNNTDQFSERDRVVSVFYTVVTPLLNPLIYSLRNKEVKEAIIKSLRRSKISRGN*
1011 >lcl|NP_001001277.1|Plus1complement(25462157..25463104) NW_047563 olfactory receptor Olr380 Olr380 __SEG__ Chr1 {Rattus norvegicus} MADNGTRLTEFILMGFQLQAELRLGLFFMFLSFYLITIVGNLGMIMLIQSDPQLHTPMYFFLSHLSFLDICYSSVIVPQLLETLGNNEVVFTYERCVTQFFFFTFYGSTE
CFLLAVMAYDRYVAICNPLLYAMAMTPQTRLGLVALAYSGAMVNGVVRSGCTFSISFCKSNQVDFFFCDLPPLLNLACSETKLREQVIFLFAFLVIITSVSVILVSYLFI
IWAIRKIRTAGAKAKTFSTCASHMIVVALFFGTLIFMYLKGNIGKSLWEDKIVSVFYTVVIPMLNPMIYSLRNKEVKEALKKAFKRITTSQESSI*
1012 >lcl|NP_001001278.1|Plus1complement(25504957..25505901) NW_047563 olfactory receptor Olr382 Olr382 __SEG__ Chr1 {Rattus norvegicus} MDNKSLTTVTEFILTGFTDHPEWEIPLFLVFLCFYLITILGNLGMVILIQMDAQLQTPMYFFLSHLSVMDACYTSVITPQILAMLATEKTVISYGHCAAQFFFFTFCAST
ECFLLAVMSYDRYVAISSPLLYTVAMSPKKCWSLVLGAYVCGLSGSIQRTTCTFSLSFCEDNEINFFFCDLPPLLKLACSDTTNAEIVIVLFGNFVILVNALVILISYLL
IIKTVTMMKSSGGRGKTFSTCVSHLTAVALFFGTLTFMYIRSGSETSLEEDKVVSVFYTVIIPMLNPLIYSLRNKDVKAAFRKLSNRLHVSQHV*
1013 >lcl|NP_001001279.1|Plus13355866..3356804 NW_047562 olfactory receptor Olr67 Olr67 __SEG__ Chr1 {Rattus norvegicus} MSVFNNSEVKYFLLIGIPGLEYAHAWISIPICLMYLIAIVGNCTIIFVIKTEPSLHEPMYYFLTMLAVSDMGLSFSSLPTMLKIFCFNAMQISPNACFAQEFFIHVFTAM
ESSVLLIMSLDRFLAIHNPLRYSSILTGSRVAKIGLILAIRSTALVLPFPFTLRKLKYCQKNLLSHLYCLHQDVMKLACSDNKINFIYGFFAALCTMLDFALILMSYMLI
LKTVLSIASLVERLKALNTCVSHICAVLIFYVPIITLAAIHRFAKHKSPLLVILIADMFLLVPPLMNPIVYCIKTRQIREKVLGKLVNLCVR*
1014 >lcl|NP_001001280.1|Plus1complement(3381724..3382662) NW_047562 olfactory receptor Olr69 Olr69 __SEG__ Chr1 {Rattus norvegicus} MTPGPLGNESMSSTFLLSGIPGLEHMHIWISLPLCLMYLVSILGNCTILFIIKTEPSLHEPMYLFLSMLALTDLGLSLCTLPTVLGIFWVGARDIGHDACFTQLFFIHCL
SFLESSVLLSMAFDRFVAICRPLHYASILTHTVIGRIGLASLGRSVALIFPLPFMLKRFPYCGSLVLSHSYCLHQEVMKLACADIKANSIYGMFVIVSTVGVDSLLILFS
YALILRTVLSIASRAERLKALNTCVSHISAVLLFYTPMIGLSVIHRFGKQAPHLVQVVMGFVYLLFPPVMNPIVYSVKTKQIRDRVTNAFCN*
1015 >lcl|NP_001001281.1|Plus13443325..3444284 NW_047562 olfactory receptor Olr75 Olr75 __SEG__ Chr1 {Rattus norvegicus} MLQLQDNREFLSNFTSKLTTFLLTGIPGLESAHGWISIPFCCLYATALSGNSMILFIIVTQHSLHEPMYYFLSMLSATYLGLTVSTMSTTLRILWFQANEISLDLCIVQM
FFLHGFTCIESGVLVAMAFDRYVAICNPLRYTMILTNSRIIQVVFLVMMRTLLLIIPLLLLLTPVSFCKRKALPHSYCYYPDVIKLACSDTRANDICGLVDLILTTGVDI
PCIVLSYVLIIHSFLNIASSEGRHKAFSTCVSHIGAVAVFYIPMFSLSLVHRYGRSAPKIVHSMMANVYLLLPPVLNPIIYSVKTKQIRKAMLSLFFAK*
1016 >lcl|NP_001001282.1|Plus1complement(3547467..3548411) NW_047562 olfactory receptor Olr82 Olr82 __SEG__ Chr1 {Rattus norvegicus} MLTYNETNIHPSTFILIGIPGLEAAHIWISIPFCMGYILALVGNSSLLFIIKTDSSLHEPMYLFLCMLAVADLVVCTTAVPKLLSLFWFHDGEIRFEACLTQIFLIHSCS
TMESGFLVGMAFDRYVAICNPLRHSAILTRTVTGAMGLAIVLRGAAFLSPHPFLLRWLPYCKTNIISHTYCEFMALIKIACAETSIRRAYSLIVAFLTGGVDFILIICSY
VLILNTVFHLPSKDARLKTLGTCGSHVCVILVFYTPAFFSFLTHRFGHKVDAHVHILVANMYLLVPPMLDPIIYGVRTKKIRDRFLKLFHFQRL*
1017 >lcl|NP_001001283.1|Plus14405763..4406728 NW_047562 olfactory receptor Olr137 Olr137 __SEG__ Chr1 {Rattus norvegicus} MLHTSSMSEVTNTTHDPFYFILTGIPGFEAIHLWISIPFFCLYTISIMGNTTILTVIRTEPSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIREISFEACFAQLF
FLHGFSFMESSVLLAMSFDRYVAICRPLHYASILTSEVIGRIGLAIICRCVLAVLPSLFLLKRLPFCHSHLLSHSYCLHQDMIHLVCADIRVNSWYGFTLILLITVLDPL
LIVLSYALILKSVLNTATWVERLRALNNCLSHMLAVLVLYVPMVGVSVTHRFAKHVSPLVHVLMANIYLLAPPVMNPIIYSAKTKQIRQGITRLLFQRKIH*
1018 >lcl|NP_001001284.1|Plus1complement(3414472..3415479) NW_047562 olfactory receptor Olr72 Olr72 __SEG__ Chr1 {Rattus norvegicus} MSVFNTTAIEIPTFILIGIPGLEHVHIWLSIPICFMYLVAIMGNCTILFLIKTETSLHEPMYYFLSMLAFSDLGLSVSSLPTMLRIFLFNSTEISSDACIAQEFFIHGFS
AMESSVLFIMAIDRFIAVYKPLRYTSILTVRRVFKTGLIFATFCIAVILPFPFTLKRLKFCKKSLLSHSYCLHQDVMKVACSDNRINVIYGFFVAILSLLYLVCISVSYM
LILKIVLGITSQKGRLKFFNTCVSHICAVLIFYVPIITLAALHRFAKNVSPVVGVIIADIFLLVPPLMNPIVYSVKSQQIRNLIQTKLHKKHYWWETSASMKVWVTSLYL
NTCRN*
1019 >lcl|NP_001001285.1|Plus1complement(4306770..4307693) NW_047562 olfactory receptor Olr131 Olr131 __SEG__ Chr1 {Rattus norvegicus} MWSNISAAPFLLTGFPGLEAAHHWISIPFFAIYISVLLGNGTLLYLIKDDHNLHEPMYYFLAMLAGTDLTVTLTTMPTVMAVLWVNHREIRHGACFLQAYVIHSLSIVES
GVLLAMSYDRFVAICTPLHYNSILTNSRVMTIGLGVVLRGFLSLVPPILPLFWFPYCHSHVLSHAFCLHQDVMKLACADITFNQIYPVVLVALTFFLDALIIVFSYVLIL
KTVMGIASGEERAKALNTCVSHISCVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSIKTKHIQRSILRLLCV*
1020 >lcl|NP_001001286.1|Plus1complement(25440414..25441376) NW_047563 olfactory receptor Olr378 Olr378 __SEG__ Chr1 {Rattus norvegicus} MAKNNLTTITRFVLVGFIDLPKWEAPLFLVFVSFYIITILGNLGMIILIQVDIQLHTPMYFFLSHLSLLDACYTSVITPQILATLAQNKMIISYGQCATQFFFFTICAAT
ECFLLSVMAYDRYVAISNPLLYTVAMSPKRCWNLVAGAYIGGLLGAILRTTCTFSLLFCEDNQINFFFCDLPPLLKLACSDTTNIEIIIVFFGNFVILANALVILISYLH
IIKAVIKMKSSVGRGKTFSTCTSHLTAVGLFFGTLIFMYIRNSSGKSLQEDKVVSVFYTVVIPMLNPLIYTLRNKDVKAAFRKLIGRFQASQTLQNCLKG*
1021 >lcl|NP_001001287.1|Plus13462624..3463574 NW_047562 olfactory receptor Olr77 Olr77 __SEG__ Chr1 {Rattus norvegicus} MQDSREFLSNFTSKLTTFLLTGFPGLESAHGWISIPFCCLYATALSGNSMILFIIVTQHSLHEPMYYFLSMLSATDLGLTISTMSTTLRILWFQANEISLDLCIVQMFFL
HGFTCIESGVLVAMAFDRYVAICNPLRYTMILTNSRIIQMGFLVLMRPLLLIVPLLLLLTPIYFCKRKALSHPFCYYPDVIKLACSDSRINNICGLVFLILTIGVDIPCI
VLSYILIIRSVLTIASSEEQHKAFSTCVSHIGAVAVFYIPMFSLSLVHRYNRSAPKIVHSMMANVFLLLPPVLNPIIYSVKTKQIRKAVLSLLFAK*
1022 >lcl|NP_001001288.1|Plus14368447..4369385 NW_047562 olfactory receptor Olr135 Olr135 __SEG__ Chr1 {Rattus norvegicus} MFNSSQFTPEYFLLTGFPGLEAWYPWLILPFCFTYVIGIVGNTLILTVIRKNSSLHQPMFLFLAMLAFSELGVSASTLPTVLSIFLFGANKICFEACLLQMFSIHSFSIM
ESGVLLAMSVDRFVAIYNPLRYTTILTLPRIAGTGVTLGLKSLLLMFPLPFLLKSLPFCSHNVLSHSYCLHSDLIQLPCGDTRPNSILGLCIVTSTFGLDSLLIVVSYVL
ILYTVLNITSGEGRRKALNTCVSHMCAVLVYYVPMISVALVHRFMKHAVPAVRLLLANIYLLVPPMLNPIIYSAKNRQIRQGLIQLFLQRKY*
1023 >lcl|NP_001001289.1|Plus125352245..25353201 NW_047563 olfactory receptor Olr374 Olr374 __SEG__ Chr1 {Rattus norvegicus} MQGMMNGKPVLNQSGTPEFVFRVFTTVPEFQALLFLLFVLLYLMILCGNTAIIWVVCTHSSLHTPMYFFLGSLSVLEICYTTDVVPLMLSNIFGAQKPISLAGCGTQMFF
FVTLGSTDCFLLAIMAYDRYVAICHPLHYTLIMTQKLCIQMVMGSLSLALFLSLQLTTLIFTLPFCGHDREINHFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFL
LICISYVFIASTILRMHSAEGRQRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYTFVTPLLNPLIYTLRNKDVKGALRNSIFHKAV*
1024 >lcl|NP_001001352.1|Plus1complement(4610153..4611073) NW_047355 olfactory receptor Olr1537 Olr1537 __SEG__ Chr11 {Rattus norvegicus} MTGENQTVVAEFVLTGLTESPELQIPLFLIFFIIYLITMVGNLGLIALIWKDPHLHTPMYLLLGSLAFADACASSSVTPKMLVNILSKDHKILLVECFTQFYFFGSSATT
ECFLLSVMAYDRYVAICNPLLYPVMMSNSLCMHFIHVSYTVGFLHSAIHVGLLVRLHFCKSNIIDYFYCEILQLFKISCTDASVNVLLVLIFSAFIQGFTFMTIIVSYFS
VLFAILKTKSEKGRSKAFSTCSAHLLSVSLFYGTLFLMYVRPGSGSGEHKDRMYSLFYTIIIPFLNPFIYSLRNKEVTAALRRKMK*
1025 >lcl|NP_001001353.1|Plus1complement(4600543..4601472) NW_047355 olfactory receptor Olr1536 Olr1536 __SEG__ Chr11 {Rattus norvegicus} MGTENATLLTEFVLTGLSHQPSWKISPFLLFLSIYLITIVGNLGLIILIWNDPCLQIPMYLFLGCLALVDTWLSTTVTPKMFLTFIDKSKLISLSECMIQFFSFVMCATM
ECFLLAAMAYDRYAAICKPLLYPVIMTNRLCVRLLILTFITGILHASIQEGMLFRLTFCNLNVIHHFYCDVMPLLKISCTDPSLNYLIVFIFSGSIQVFTISTVLGSYTL
VMFTILRKRSSKGVKKAFSTCGAHLLSVCLYYGSLLFMYLLPASQKAQDEDMMDSVFYTVIIPVMNPIIYSLRNKQIKDSLEKFLKRNV*
1026 >lcl|NP_001001354.1|Plus1complement(3973798..3974733) NW_047773 olfactory receptor Olr917 Olr917 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTTFILLGLTDNQQLQVLIFIILFFTYSLSITGNLAIISLILVDPHLKTAMYYFLKNFAVLEISFTSASIPRYLYSIATGDKTITYNACVAQVFFTDLFGVTEFF
LLAAMSYDRYVAICRPLHYLTTMNTAVCRRLVFCCWVAGLFILIPPLSLGLNLQFCDSNIVDHFICDASPLLKISCSDTWFMEHTVLICAVRTLIITLVCVVLPYVNIIK
TILRFPSAQQKQKAFSTCSSHMIVVSITYGSCIFIYIKPSAKKEVAINKGVMVLTTSIAPMLNPFIYTLRNRQVKQTFGDSIKRIIAFFKK*
1027 >lcl|NP_001001355.1|Plus1complement(3582949..3583887) NW_047773 olfactory receptor Olr905 Olr905 __SEG__ Chr7 {Rattus norvegicus} MRNHSMVTEFLLLGISDTPEVQVVIFIFLLIAYMVSVTGNLTIITLTLLDSQLKTPMYFFLQNFSFLEIIFTSVSIPRFLESIITKVKTISYNNCLAQLYFFLSLGVSEF
FLLTAMSYDRYVAICKPLHYVIIMNQKVCTLLVLTSWLVGFLTILPLIMLILKLDFCASNTIDHFCCDYFPILQLSCSDTRLLEAFGLYCASITLLFTLALVILSYICII
STILRFPSASQRKKAFSTCSSHMIVISISYGSCIFMYVKPSANERASLTKGVAVLNTSIAPMLNPFIYTLRNQQVKQAFKDLIDKVMFNGKK*
1028 >lcl|NP_001001356.1|Plus1complement(4057496..4058428) NW_047773 olfactory receptor Olr920 Olr920 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTAFILLGLTNDPQLKALIFIFLFLTYVLSMTGNLTIIFLTFIDSHLKTAMYFFLQNFSFLEISFTTACIPRYLYNISTGDKTITYNNCIIQIFCTDLFGVTEFF
LLAIMSYDRYVAICKPLHYITIMSSRICTRLILCCWAAGLFVILPPLSLGLNLEFCDSVIDHFVCDAYPLLKISCTETWLIEQIVIVCAVLTFIMTLVCVVLSYVYIIKT
ILRFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKDSVAINKGVMVLTTSIAPMLNPFIYTLRNKQVRQALNDSVKRIALFFKK*
1029 >lcl|NP_001001357.1|Plus13653879..3654814 NW_047773 olfactory receptor Olr907 Olr907 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTTFLLLGLTDNQQLQVLIFIILFFTYSLSLTGNLAIISLILVDPHLKTAMYYFLKNFAVLEISFTSASIPRYLYSIATGDKTITYNACVAQVFFTDLFGVTEFF
LLAAMSYDRYVAICRPLHYLTTMNTAVCRRLVFCCWVAGLFILIPPLSLGLNLQFCDSNIIDHFICDASPLLKISCSDTWFMEHTVLICAVLTLIITLVCVVLSYVNIIK
TILRFPSAQQKQKAFSTCSSHMIVVSITYGSCIFIYIKPSAKKEVAINKGVMVLTTSIAPMLNPFIYTLRNRQVKQAFCDSIKRIIAFFKK*
1030 >lcl|NP_001001358.1|Plus1complement(2642386..2643321) NW_047773 olfactory receptor Olr883 Olr883 __SEG__ Chr7 {Rattus norvegicus} MRNHTVITFILLGLTDDQQLQVLIFIILFFTYSLSITGNLAIISLVLVDPHLKTAMYYFLKNFAVLEISFTSASIPRYLYSIATGDKTITYNACVAQVFFTDLFGVTEFF
LLAAMSYDRYVAICRPLHYLTTMNTAVCRRLVFCCWVAGLFILIPPLSLGLNLQFCDSNIIDHFICDASPLLKISCSDTWFMEHTVLICAVLTLIITLVCVVLSYINIIK
AVLRFPSAQQKKKAISTCSSHMIVVSITYGSCIFIYIKPSAKEEVAINKGVTVLTTSIAPMLNPFIYTLRNRQVKQAFCDSIKRIIAFSKK*
1031 >lcl|NP_001001359.1|Plus13734107..3735042 NW_047773 olfactory receptor Olr910 Olr910 __SEG__ Chr7 {Rattus norvegicus} MRNHTVITFILLGLTDDQQLQVLIFIILFFTYSLSITGNLAIISLVLVDPHLKTAMYYFLKNFAVLEISFTSASIPRYLYSIATGDKTITYNACVAQVFFTDLFGVTEFF
LLAAMSYDRYVAICRPLHYLTTMNTAVCRRLVFCCWVAGLFILIPPLSLGLNLQFCDSNIIDHFICDASPLLKISCSDTWFMEHTVLICAVLTLIITLVCVVLSYINIIK
AVLRFPSAQQKKKAISTCSSHMIVVSITYGSCIFIYIKPSAKEEVAINKGVTVLTTSIAPMLNPFIYTLRNRQVKQAFCDSIKRIIAFSKK*
1032 >lcl|NP_001001360.1|Plus13689297..3690250 NW_047773 olfactory receptor Olr908 Olr908 __SEG__ Chr7 {Rattus norvegicus} MKNNTITTFILLGLTDDPQLQIPIFIFLFFAYTLSIAGNLTIIALTILDSHLKTPMYFFLQNFSILEISFTSACIPRYLYNIATGDRSITYDICVIQVFFTDVFGVTEFF
LLAIMSYDRYVAICKPLHYVTIMNSKVCQTLVLCCWMAGLLIILPPLTLFLNLRFCDSNVIDYFFCDASPILKISCSDTWLIEQLVIVCAVLTFILTLVCVTLSYVHIVK
TILRFPSAEQRKKAFSTCSSHMIVVSITYGSCIFIYINPSAKDSVTINKGVTVLMTSIAPMLNPFIYTLRNKQVRQAFSDSFKKIVMISMKKKTDQI*
1033 >lcl|NP_001001361.1|Plus13530297..3531232 NW_047773 olfactory receptor Olr903 Olr903 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIRLQIPLFMFLILSYMLSLSGNLTIITLTLIDPHLKTPMYIFLKNFSFLEISLTTACIPRFLYSISSGDKSITYIACASQLLFIDLFAVTEFF
LLAIMSYDRYVAICKPLHYMTIMNSRVCKNFIFFCWVAALIIILPPIGLGLGLEFCDSNIIDHFCCDAAPLLKISCSDTLLIEQMVIVGAVLTFIITFVCVVLSYVYIIK
TILRFPSAKQRKKAFSTCSSHMIVVSITYGSCIFIYVKPSSKDDVAINKGISLIIISISPMLNPFIYTLRNKQVKQAFNYSIKKLAFRSNM*
1034 >lcl|NP_001001362.1|Plus1complement(7959440..7960420) NW_047773 olfactory receptor Olr1059 Olr1059 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQIPIFLFLFFNYILSVMGNFIIILLTLLDPHLKTPMYFFLRNFSFLEIAFTTVCIPRFLISILSGDRTISYNACAAQLFFFFLLGATEF
YLLAAMSYDRYAAICRPLHYPIIMNSKVCHLLVLSSWGTGFLVIFPPLLLGLKLDFCASKTIDHFLCDTSPVLQLSCTDTHFIELMAFVLAVMTLVITLILVILSYIVII
KTILKFPSAQQRRKAFSTCSSHMVVVSITYGSCIFMYMKTSAKERVTLNKGVAVLNTSVAPLLNPFIYTLRNKQVKEALKHVLQRFCSLQNNETMFRHAIETPVVK*
1035 >lcl|NP_001001363.1|Plus17740220..7741155 NW_047773 olfactory receptor Olr1052 Olr1052 __SEG__ Chr7 {Rattus norvegicus} MRIITSVTYFIFLGLTDDPELQVVIFFFLFLTYVLSITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKYISYNACAAQLFFYISLGSTEF
FLLASMSYDRYVAICKPLNYTTIISNKICHQLIISSWLAGFLVIFPPLAMGLELDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSLILALVTLMTTLMLIILSYTCIL
RTILKFPSTKQREKAFATCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNSFIYTFRNQQVKQAFKDLVRRKLLQKC*
1036 >lcl|NP_001001364.1|Plus1complement(7714860..7715795) NW_047773 olfactory receptor Olr1051 Olr1051 __SEG__ Chr7 {Rattus norvegicus} MRNRTLVTTFVLLGLTDDPQWQIVIFLFLFIAYVLSITGNLTIILLTLLDSHLKTPMYFFLQKFSFLEISLTSTCIPRFLVSIVTMNKTISVEACFTQLFAAFIFGIAQF
FLLAVMSYDRYVAICKPLHYTTIMNNRVCMLLFGSCCLIALFLVCPGVIVSLSLEFCDSIIEHFFCDYSPILKLSCNDTRSMQLLNYIFAIITLLTTLALVMVSYGRILS
TILKFPSAQQKKKAFSTCSSHMIVVFISYGSCIFMYIKPSAEERISLNKGVAILTLALAPVLNPFIYSLRNKQVKEALKDVIKKCTKDTSK*
1037 >lcl|NP_001001365.1|Plus17639416..7640351 NW_047773 olfactory receptor Olr1049 Olr1049 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIRLQIMLFIFLLLSYMLSLSGNLTIITLTLIDPRLKTPMYIFLKNFSLLEISLTTACIPRFLHSISSGDKSIAYTACVSQLFFIDLFAVSEFF
LLAIMSFDRYVAICKPLHYMTIMNSRVCKNFIFFCWVAALIIILPPFGLGLGLEFCDSDIVDHFCCDAAPLLKISCSDTWLIEQMVIVGAVLTFIITFVCVVFSYVYIIK
TILRFPSANQKKKAFSTCSSHMIVVSITYGSCIFIYVKPSSKNDVAINKGISLIITSISPMLNPFIYALRNKQVKQAFSYSIKKVAFLSKV*
1038 >lcl|NP_001001366.1|Plus1complement(7205611..7206549) NW_047773 olfactory receptor Olr1029 Olr1029 __SEG__ Chr7 {Rattus norvegicus} MKNHTRVTFFIIAGLIDDPQWKAVLFIFLLLTYLLSITGNLTIITLTLVDTHLKTPMYFFLRNFSFLEISYTTTCIPKLLVIMATGDKTISYGNCFTQVFFAFLFGASEF
YLLAAMSYDRYVAICKPLHYMTIMNNKVCVQLILSCWLAGFFVIFPPLVLGLNLDFCASNIVDHFYCDTTPLLQLSCTDTQFLETMGFVSALVTLLLTLVMVIISYTYIA
MTILKIPSTSQRKKAFSTCSSHMIVITLSYGSCIFIYLKPSVKQRVSISKGISVLNTSVAPLLNPFIYTLRNQQVKNAFINTAHRIASFSKK*
1039 >lcl|NP_001001367.1|Plus1complement(4457262..4458203) NW_047773 olfactory receptor Olr936 Olr936 __SEG__ Chr7 {Rattus norvegicus} MRNRTSVTYFILLGLTDDPELQVVIFFFLFLAYVLSITGNLTIITLTLLDSHMKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKYISYNACAAQLFFFIFLGSTEF
FLLASMSYDRYVAICKPMHYTTIISNKICHQLIISSWRAGFLVMFPPLAMGLELDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSFILALVTLMNTLMLIILSFTCIL
RTILKFPSAKQREKAFSTCSSHMIVASISYGICIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFSDLMRMKLASKVLI*
1040 >lcl|NP_001001368.1|Plus1complement(4656806..4657744) NW_047773 olfactory receptor Olr943 Olr943 __SEG__ Chr7 {Rattus norvegicus} MRNHSRITDFVLLGISDTPEVQILIFILLFIAYILSVTGNLTIIILTLLDSQLKTPMYFFLQNFSFLEIIFTSVSIPRFLESIITKVKTISYNNCLAQLYFFLSLGVSEF
FLLTAMSYDRYVAICKPLHYVIIMNQKVCTLLVLTSWLAGFLSIFPLIMLILKLDFCASNTIDHFSCDYSPILQLSCSDTKHLEAFGLYCASITLLFTLALVILSYICII
STILKFPSASQRKKAFSTCSSHMIVISISYGSCIFMYVKPSANERASLTKGVAVLNTSIAPMLNPFIYTLRNQQVKQAFKDLINRVMFNRKK*
1041 >lcl|NP_001001369.1|Plus1complement(4776529..4777467) NW_047773 olfactory receptor Olr947 Olr947 __SEG__ Chr7 {Rattus norvegicus} MPNKTAITEFILLGLTDDPELQILIFFFLLTTYLLSVSGNMTIITLTLSNILLKTPMYFFLRNFSFLEILFTTVCIPRFLISIATGNKAISYNACMAQVFFLIFLGATEF
FLLAAMSYDRYVAICKPLHYTTIISNKVCNQLVIASWSAGFLIVFPPVIMGIQLEFCDSNIIDHFACDSSPMLQIACTDTKILELMAFFLAVFTLIVTLALVILSYTLIL
RAILKIPSAEQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSARDGVVLSKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDFVKILLPSNKH*
1042 >lcl|NP_001001370.1|Plus14838935..4839912 NW_047773 olfactory receptor Olr950 Olr950 __SEG__ Chr7 {Rattus norvegicus} MKNQSVEIVFILLGLTDDPQLQILIFLFMFFNYILSLMGNLMIIFLTLLDLRLKIPMYFFLQNFSFLEMAFTSSCTPRFLMSILTGDKTISYGACLTQLFFFFLLLITEF
YFLAAMSHDRYVAICRPLHYPLIMNSKVCHLLVLSSWVTGFLSIFPPLMLGLTLDFCASKLIDHFLCDTSSVLQLSCTDTRFIEWMAFVIAVMTLVITLILVILSYTLII
KTILYFPSAQQQRKAFSTCSSHMVVVSITYGSCIFMCMKTSAKERVTLNKGVAVLNTSVTPLLNPFIYTLRNQQVKDAFKQVLRRLYYSQNSELKFRPKKHAVGP*
1043 >lcl|NP_001001371.1|Plus1complement(6493634..6494572) NW_047773 olfactory receptor Olr1002 Olr1002 __SEG__ Chr7 {Rattus norvegicus} MKNHTRVTFFIIAGLTDDPQWKAVLFIFLLLTYLLSITGNLTIITLTLVDAHLKTPMYFFLRNFSFLEISYTTTCIPKLLVIMATGNKTISYGNCLTQVFFAFLFGASEF
YLLAAMSYDRYVAICKPLHYMTIMNNKVCVQLILSCWLAGFFVIFPPLLLGLNLDFCASNIVDHFYCDTTPLLQLSCTDTQFLETMGFVSALVTLLLTLVMVIISYTYIA
RTILKIPSTGQRKKAFSTCSSHMIVISLSYGSCIFMYLKPSVKQRVSISKGISVLNTSVAPLLNPFIYTLRNQQVKNAFINTVHRIASFLRK*
1044 >lcl|NP_001001372.1|Plus1complement(6729663..6730586) NW_047562 olfactory receptor Olr219 Olr219 __SEG__ Chr1 {Rattus norvegicus} MGEENGTSVTEFIFLGLSQDPQTQVLLFFLFLLIYLLTVLGNLLIVVLIHSDPRLHTPMYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGAFVSLVDTTFTLRLPYRGNNVINHFFCEPPALLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWN
IVSTVIQMQSGEGRLKVFSTCGSHLIVVVLFYGSAIFAYMRPNSKIMNEKDKMISVFYSAVTPMLNPIIYSLRNKDVKGALRRITLR*
1045 >lcl|NP_001001373.1|Plus1complement(416557..417510) NW_047596 olfactory receptor Olr1686 Olr1686 __SEG__ Chr20 {Rattus norvegicus} MTINKSSGGDFILVGFSDQPRLEKILFVVVLISYLLTLVGNTAIILVSCLDSALQTPMYYFLTNLSFVDICFSTSIVPQLLWNLHGPAKTITATGCAIQLYVSLALGSTE
CVLLAVMAFDRYAAVCRPLHYATVMHPRLCQSLAGIAWLSGVGNTLIQGTITLRLPRCGNHRIYHFLCEVPAMIKLACVDIHANEVQLFMASLVLLLLPLTLILVSYGCI
TQALMRLRSALTWGKALGTCGSHLLVVVLFYGTITAVYIQPNSSYAHSRGKFITLLYTVVIPTLNPLIYTLRNKDVKGALKRLVRKDESTGKQILSK*
1046 >lcl|NP_001001374.1|Plus1769684..770637 NW_047596 olfactory receptor Olr1702 Olr1702 __SEG__ Chr20 {Rattus norvegicus} MTINKSSGGDFILVGFSDQPRLEKILFVVVLISYLLTLVGNTAIILVSCLDSALRTPMYYFLTNLSFVDICFSTSIVPQLLWNLHGPAKTITATGCAIQLYVSLALGSTE
CVLLAVMAFDRYAAVCRPLHYATVMHPRLCQSLAGIAWLSGVGNTLIQGTITLRLPRCGNHRIYHFLCEVPAMIKLACVDIHANEVQLFMASLVLLLLPLTLILVSYGCI
TQALMRLRSALTWGKALGTCGSHLLVVVLFYGTSTAVYIHPNSSYAQSQGKFITLLYTVVIPTLNPLIYTLRNKDVKGALKRLVRKDNSTGKQILPR*
1047 >lcl|NP_001001375.1|Plus111618002..11618967 NW_047657 olfactory receptor Olr526 Olr526 __SEG__ Chr3 {Rattus norvegicus} MNNWNYTKESDFILMGLTDSKELQLVLAVLFLLIYLVTVLGNTGMMLIIRLDARLHTPMYFFLTHLSFLDLCYSTVITPKTLQNLLTSNKIISFIGCFTQMYGFVLLAAA
ECFLLASMSYDRYVAICNPLHYPVIMSTRFCSALLTGSYMIGTLDSTINILCMNTLYFCRPKVIHHFFCDTSPILILSCNDTHNIEIIIFIFAGSTLMVSLITISASYVS
ILSTILKINSTSGKHKAFSTCASHLLGVTVFYSTMIFTYLKPSNSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKNAVHRVIKKQENSRLKFRVALSN*
1048 >lcl|NP_001001376.1|Plus111730009..11730974 NW_047657 olfactory receptor Olr530 Olr530 __SEG__ Chr3 {Rattus norvegicus} MSTWNYTKESDFILMGLTDSKELQLVLPVLFLLMYLVTVLGNTGMMLIIRLDARLHTPMYFFLTHLSFLDLCYSTVITPKTLQNLLTSNKIISFIGCFTQMYGFVLLAAA
ECFLLASMSYDRYVAICNPLHYPVIMSTRFCSALLTGSYMIGTLDATVNILCMNTLYFCRPKVIHHFFCDTSPILVLSCNDTHNIEIIIFIFAGSTLMVSLITISSSYMS
ILSTILKINSTSGKHKAFSTCASHLLGVTVLYSNIIFTYLKPSNSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKNAVHRVIKKQEGSRLQIRVTLSN*
1049 >lcl|NP_001001377.1|Plus112313406..12314386 NW_047657 olfactory receptor Olr555 Olr555 __SEG__ Chr3 {Rattus norvegicus} MQSKYLNLQRANKFKITETNLTVPIEFVLLGFSDIPKLHWLLFGIFLFIYMIILLGNGIIILITRVDPSLQTPMYFFISNFSFLEICYVSVTLPRMLMDLFTLKGNISFL
ACATQMCLFLILGATECFLLAVMAYDRYVAICNPLHYPVVMSTKLCTQLVIASWVIGIPIQVGQTYQILSLPFCDSNQINHFFCDIPPLLKLACGNIFVNEIVVFIFAIL
IVTVPFMLILASYSRIISTILKLPSNTGRTKAFSTCSSHLMVVFLFYGSASVTYLKPKSNKHEGTDKLLSLFYTILTPMFNPLIYSLRNKDVIGALRKLFTRFLAL*
1050 >lcl|NP_001001378.1|Plus114910480..14911397 NW_047657 olfactory receptor Olr684 Olr684 __SEG__ Chr3 {Rattus norvegicus} MGQGYNVTEFIFVGLTQDPAGQKALFALFSLTYLVTMLGNLLIAVTVIASPSLKSPMYFFLACLSVLDAFYCNTISPNLIVGFLKDKKTISFRACMLQLFVEHLFGGVEV
FLLVFMAYDRYVAICKPLHYLTIMNQRVCILLLLVAGVGGTVHSTIQVLTVYKLPFCGPNVIDHFMCDMNPLLGLACTDTFFLGITVMANGGVICVGIFTFLLVSYGIIL
NSLKTHSQEGRRKALSTCSSHIMVVICFFAPCIFIYARPVSNFPIDKYIAVFYTVVSPMLNPLIYTLRNSEMKNSIKKLWCKTSA*
1051 >lcl|NP_001001379.1|Plus1complement(13938226..13939182) NW_047773 olfactory receptor Olr1090 Olr1090 __SEG__ Chr7 {Rattus norvegicus} MAVTLGRNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLVTLLGNLLIMVTIWSEHSLHTPMYLFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
GFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSVMGTVVTTAVFNLTFCGPNEIHHFTCHVPPLLKLACGENVLEVAKGVETVCITALLGCFLLILL
SYAFIVATILKIPSSEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPKSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKNAMKKAFLSKLYPEKI*
1052 >lcl|NP_001001380.1|Plus1complement(14059660..14060616) NW_047773 olfactory receptor Olr1092 Olr1092 __SEG__ Chr7 {Rattus norvegicus} MAVTLGLNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLVTLLGNLLIMATIWSEHSLHTPMYLFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
GFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTVVTTAIFNLTFCGPNEIHHFFCHVPPLLKLACGENVLEVTRGVGMVCITALLGCFLLILL
SYAFIVATILKIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPKSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKVTMKKAFLNKLFLQNP*
1053 >lcl|NP_001001381.1|Plus14981710..4982648 NW_047773 olfactory receptor Olr956 Olr956 __SEG__ Chr7 {Rattus norvegicus} MKNHTRVTFFIIADLTDDPQWKAVLFIFLLLTYLLSITGNLTIITLTLVDTHLKTPMYFFLRNFSFLEISYTTTCIPKLLVIMATGDKTISYGSCLTQVFFAFLFGASEF
YLLAAMSYDRYVAICKLLHYMTIMNNKVCVQLILSCWLAGFFVIFPPLLLGLNLDFCASNIVDHFYCDTTPLLELSCTDTQFLETMGFVSALVTLLLTLVMVIISYTYIA
RTILKVPSTGQGEKAFSTCSSHMTVISLSYGSCIFMYLKPSVKQRVSISKGISVLNTSVAPLLNPFIYTLRNQQVKNAFINTVHRIASFLRK*
1054 >lcl|NP_001001382.1|Plus1complement(2843830..2844774) NW_047773 olfactory receptor Olr886 Olr886 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIQLQILLLLSYMLSLSGNLTIITLTLIDPRLKTPMYIFLKKFSFLEISLTTACIPRFLYSISSGDKSITYIACVSQLSFIDLFAVTEFFLLAI
MSFDRYVAIWKPLHYMTIMNSRVCKNFIFFCWVAALIIILPPISLGLCLEFCESDIVDHFCCDAAPLLKISCSDTWLLEQMLIVGAVLTFIITFVCVVLSYVYIIKTILR
FPSAKQKKKAFSTCSSHMIVVSITYGSCIFIYIKPSSKNDAAVNKGISLIIISISPMLNPFIYALRNKQVKQAFDYSVKKIAFLSKVQKTKNTT*
1055 >lcl|NP_001001384.1|Plus1complement(15980780..15981709) NW_047657 olfactory receptor Olr736 Olr736 __SEG__ Chr3 {Rattus norvegicus} MAHLLNVTEFIFLGLSPNKEGQRVCFVLFLLLYMAIVLGNLLMVVTVAASRNLGSPMYFFLSFLSFVEICYSSTTAPKLIFDLLAEKKSISVWGCMTQLFFMHFFGGTEI
FLLTMMAYDRYVAICKPLHYTSIMNQQVCAVLVGSAWIGGFVHSFSQILLILPLSFCGPNVIDHYFCDLLPVLKLACSDTFLIGLLIVVNGGTLSVISFVVLLASYLVIL
FHLRTQSAEGRRKALSTCGSHVTVVILFFGPCVFIYSRPSDTLPVDKMIAVFYTVITPLLNPLIYSLRNAEVKKAMKNLWFRIMKADEK*
1056 >lcl|NP_001001385.1|Plus1complement(4080503..4081438) NW_047773 olfactory receptor Olr921 Olr921 __SEG__ Chr7 {Rattus norvegicus} MRNRTVTTFILLGLTDDIRLQILLFMFLILSYMLSLSGNLTIITLTLIDPHLKTPIYIFLKNFSFLEISLTTACIPRFLYSISSGDKSITYIACASQLLFIDLFAVTEFF
LLAIMSYDRYVAICKPLHYMTIMNSRVCKNFIFFCWVAALIIILPPIGLGLRLEFCDSNIIDHFCCDAAPLLKISCSDTLLIEQMVIVGAVFTFIITFVCVVLSYVYIIK
TILRFPSAKQRKKAFSTCSSHMIVVSIAYGSCIFIYVKPSSKDDVAINKGISLIIISISPMLNQFIYALRNNQVKQAFNYSIKKLAFLSNM*
1057 >lcl|NP_001001386.1|Plus1complement(4386212..4387147) NW_047773 olfactory receptor Olr932 Olr932 __SEG__ Chr7 {Rattus norvegicus} MRNRTSVTYFILLGLTDDPELQVVIFFFLFLTYMLSITGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLVSILTKDKSISYNACVAQLFFFIFLGSTEF
FLLASMSYDRYVAICKPLHYTTIISNKICHQLIISSWLAGFLVIFPPLAMGLELDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSFILALITLMTTLMLIILSYTCIL
RTILKFPSAKQREKAFATCSSHMIVVSISYGSCIFMYVKTSAKAGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDLVRRKLASKC*
1058 >lcl|NP_001001387.1|Plus14496732..4497667 NW_047773 olfactory receptor Olr937 Olr937 __SEG__ Chr7 {Rattus norvegicus} MRNRTLVTTFVLLGLTDDPQWQIVIFLFLFIAYVLSITGNLTIILLTLMDSHLKTPMYFFLQKFSFLEISLTSTCIPRFLVSIVTMNKTISFEACFTQLFAAFIVGIAQF
FLLAVMSYDHYVAICKPLHYTTIMNNRVCTLLFGSCCLIALFLVCPGVIVSLSLEFCDSIVEHFFCDYSPILKLSCNDTRFMQLLNFIFAIITLITTLALIMVCYGRILS
TILKFPSAQQKKKAFSTCYSHMIVVFISYGSCTFMYIKPSSEERISLNKGIAILTLALAPVLNPFIYSLRNKQVKEALKDVIKKCTKDTSK*
1059 >lcl|NP_001001388.1|Plus1complement(14175378..14176334) NW_047773 olfactory receptor Olr1093 Olr1093 __SEG__ Chr7 {Rattus norvegicus} MAVTLGLNHTFVSEFILIGFSTFPPLQLMFFLLFLLMYLVTLLGNLLIMATIWSEHSLHTPMYLFLSTLSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFTF
GFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSVMGTVVTTAIFNLTFCGPNEIHHFFCHVPPLLKLACGENVLEVARGVGMVCITALLGCFLLILL
SYAFIVATILKIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPKSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKVTMKKAFLNKLFLQNS*
1060 >lcl|NP_001001397.1|Plus11349773..1350699 NW_047596 olfactory receptor Olr1735 Olr1735 __SEG__ Chr20 {Rattus norvegicus} MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYFVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICFSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEA
LLLPVMAFDRFVAICRPLHYSVIMNRQLCSHMTVTIWIMGFLHALLHSVMTSRLSFCGPNHVHHFFCDIKPLLDLACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYII
TYLFLKTHSCSMLHKALSTCASHFMVVILLYVPVLFNYIRPASSSALDQERIIAIMYSVVTPALNPLIYTLRNKEVRNALNKKVRRWL*
1061 >lcl|NP_001001421.1|Plus11364915..1365841 NW_047596 olfactory receptor 1736 Olr1736 __SEG__ Chr20 {Rattus norvegicus} MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYFVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICFSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEA
LLLPVMAFDRFVAICRPLHYSVIMNRQLCSHMTVTIWIIGFLHALLHSVMTSRLSFCGPNHVHHFFCDVKPLLDLACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYII
TYLLFKTRSCSMLHKALSTCASHFMVVCLFYAPVLFIYIRPSSGSSLDQERIIAIMYSVVTPALNPLIYTLRNKEVRSALNRKVRRWL*
1062 >lcl|NP_001001422.1|Plus11381377..1382303 NW_047596 olfactory receptor 1737 Olr1737 __SEG__ Chr20 {Rattus norvegicus} MSNQTSVTEFLLLGVTDIQELNPILFVIFFTIYSVNITGNGAILMIVILDPRLHSPMYFFLGNLACLDICYSTVTVPKMLENLLSTSKAISFLGCITQLHFFHFLGSTEA
LLLPVMAFDRFVAICRPLHYSVIMNRQLCSHMTVTIWIMGFLHALLHSVMTSRLSFCGPNHVHHFFCDIKPLLELACGNTELNLWLLNTVTGTIALTPFFLTFLSYFYII
TYLFLKTRSCSMLHKALSTCASHFMVVILFYAPVLFTYICPTSGSAPDQDRIIAIMYSVVTPALNPLIYTLRNKEVRSALYRKVRKWL*
1063 >lcl|NP_001001423.1|Plus11407046..1407975 NW_047596 olfactory receptor 1739 Olr1739 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPDFILLGLSRDPEKWQLLFSIFLALYLLGLSGNLLLLLAIGADVHLHTPMYFFLSQLSLVDLCSITTTAPKMLETLWTGDGSISFSGCLTQFYFFAVFADMDNL
LLAVMAIDRYAAICQPLLYPLLMTPCRCGVLVSGSWGVTNCLSLTHTLLLSQLYFQTNQEIPHFFCDLGPLLLLSCSDTHLNEILMIVLVVIFTIGALLCIVSSYGCIFY
AVARIPSAQGKRKALSTCSSHLSVVLLFYSTVFAAYLKPRSSSHSSGEVVAAVMYTLVTPTLNPFIYSLRNRDVKSSLRRILNMEKSHK*
1064 >lcl|NP_001001424.1|Plus11437944..1438873 NW_047596 olfactory receptor 1742 Olr1742 __SEG__ Chr20 {Rattus norvegicus} MNCSQAPGFILLGLSRDPEKWQLFFSVFLVLYLLGLSGNLLLLLAIGADVHLHTPMYFFLSQLSLVDLCFITTTAPKILQTLWTGDGSISFSGCLTQLYFFAVFADMDNL
LLAVMAIDRYAAICHPLLYPLLMTPCRCGVLVSGSWGVAHCVSLTHTLLLSQLYFHTNQMIPHFFCDFGPLLLLSCSDAHLNEGLMMALAGVFGISALLCIVSSYSCIFY
AVARVPSAQGKRKALATCSSHLSVVLLFYSTVFTTYLKPPSSSYSSGEVVAAVMYTLVTPTLNPFIYSLRNKDVKSSLRRILNMVKSPD*
1065 >lcl|NP_001001425.1|Plus1complement(1444984..1445925) NW_047596 olfactory receptor 1743 Olr1743 __SEG__ Chr20 {Rattus norvegicus} MEIVSTGNRTVSEFVLLGFHEIPGLHLLFFSVFIILYVSIITGNMLIAVVVVSSQRLHTPMYFFLVNLSFIEVVYTSTVVPKMLEGFVQEATISVAGCLLQFFVFGSLAT
DECFLLAVMAYDRYLAICHPLRYPLLMGPQWCLGLVLTVWLSGFMVDGLVVALMAQLRFCGPNLIDHFYCDFSPLMILACSDTGVAQVTTFVLSVVFLTVPFGLVLMSYA
QIVVTVLRVPSGTRRTKAFSTCSSHLAVVSTFYGTLMVLYIVPSAVHSQLLSKIIALLYTVVTPIFNPVIYTLKNQEVQQALRRLFYCKPTEM*
1066 >lcl|NP_001001426.1|Plus11461057..1461995 NW_047596 olfactory receptor 1744 Olr1744 __SEG__ Chr20 {Rattus norvegicus} MGTNSSLVTEFVLVGFSRLVHLQSILFSLFLVVYLLTVAGNLLIVALVSTDAALQSPMYFFLRILSALEICYTSVTVPLLLHHLLTGRRQIPRSGCALQMFFFLFFGATE
CCLLAAMAYDRYAAICEPLRYQVLLSRRVCVQLAGAAWSCGALVGLGHTSFIFSLPFCGPNAVPHFFCEIQPVLQLVCGDTSLNELQIILAAALIILCPFGLILSSYGRI
LVTIFRIPSAAGRRKAFSTCSSHLVVVSLFYGTAIFIYIRPKASYDPTTDPLLSLFYAVITPILNPVIYSLRNADVKAALKRSIQKMGPAEI*
1067 >lcl|NP_001001427.1|Plus11489421..1490359 NW_047596 olfactory receptor 1746 Olr1746 __SEG__ Chr20 {Rattus norvegicus} MVNQSSPTGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFFLSNLSFLDLCFTTTCVPQMLVNLWGPTKTISFLGCSVQLFIFMSLGTTEC
ILLTVMAFDRYVAVCRPLHYATIIHPRLCRQLAGVAWAIGLVQSTVQTPPTLHLPFCPHRQIDNFLCEVPSLIRLSCGDTTFNEIQMAVASVFIVVVPLSLILVSYGAIA
RAVLRIRSAKGRRKAFGTCSSHLIVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPTLNPLVYTLRNKEVKRAFWKLLGKDGDSEES*
1068 >lcl|NP_001001428.1|Plus11529999..1530937 NW_047596 olfactory receptor 1748 Olr1748 __SEG__ Chr20 {Rattus norvegicus} MVNQSSPTGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFFLSNLSFLDLCFTTTCVPQMLFNLWGPTKTISFLGCSVQLFIFMLLGTTEC
ILLTVMAFDRYVAVCQPLHYATIIHPRLCQQLAGVAWGIGLVQSIVQIPPTLKLPFCPHRQIDDFLCEVPSLIRLSCGDTTFNEIQLAVAGVIFLLVPLSLILVSYGAIV
RAVLKTNSRKGRRKAFGTCSSHLIVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPTFNPLVYTLRNKEVKRAFWKLLGKDVDSGES*
1069 >lcl|NP_001001429.1|Plus11535909..1536847 NW_047596 olfactory receptor 1749 Olr1749 __SEG__ Chr20 {Rattus norvegicus} MVNQSSPTGFLLLGFSEHPHLEKILFVVVLCSYLLTLLGNTLILLLSTLDPRLHSPMYFFLSNLSFLDLCFTTTCVPQMLLNLWGPTKTISFLGCSVQLFIFLSLGTTEC
ILLTVMAFDRYVAVCQPLHYTTIIHPRLCWKLAAVAWIMGLIQSIVQTPPTLRLPFCPHRQIDDFLCEVPSLIQLSCGDTTFNEIQLAVSSVILVVVPLSLILVSYGAIA
RAVLRINSTEAWKKAFGTCSSHLIVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPTLNPLIYTLRNKEVKRAFWRLWGKDGESKNT*
1070 >lcl|NP_001001506.1|Plus114298855..14299814 NW_047563 MAS-related GPR, member D Mrgprd __SEG__ Chr1 {Rattus norvegicus} MNYTPYSSPAPGLTISPTMDPVTWVYFSVTFLAMATCVCGIVGNSMVIWLLSFHRVQRSPFCTYVLNLAVADLLFLLCMASLLSLETGPLLTASTSARVYEGMKRIKYFA
YTAGLSLLTAISTQRCLSVLFPIWYKCHRPQHLSGVVCGVLWALALLMNFLASFFCVQFWHPDKYQCFKVDMVFNSLILGIFMPVMVLTSAIIFIRMRKNSLLQRRQPRR
LYVVILTSVLVFLTCSLPLGINWFLLYWVELPQAVRLLYVCSSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRALQDEPEGRETPSTCTNDGV*
1071 >lcl|NP_001001518.1|Plus135773238..35774191 NW_047625 succinate receptor 1 Sucnr1 __SEG__ Chr2 {Rattus norvegicus} *AQNLSCENWLALENILKKYYLSAFYGIEFIVGMLGNFTVVFGYLFCMKNWNSSNVYLFNLSISDLAFLCTLPMLIRSYATGNWTYGDVLCISNRYVLHANLYTSILFLT
FISIDRYLLMKFPFREHILQKKEFAILISLAVWVLVTLEVLPMLTFITSTPIEKGDSCVDYASSGNPKYSLIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKKRSQQQATV
LSLNKPLRLVVLAVVIFSVLFTPYHIMRNVRIASRLDSWPQGCSQKAIKCLYILTRPLAFLNSAVNPIFYFLVGDHFRDMLFSKLRQYFKSLTSFRL*
1072 >lcl|NP_001002270.1|Plus13483228..3484169 NW_047562 olfactory receptor Olr79 Olr79 __SEG__ Chr1 {Rattus norvegicus} MSVINDSSLYPRFLLTGFPGLEMRYSLISIPIFLVYATSIAGNITILFIIRTESSLHQPMYYFLSMLALTDLGLSTTTLPTMFSVFWFQAREIPFNACLVQMYFIHVFSI
IESAVLLAMAFDRFVAIREPLRYAAILTNTVIVGIGLAIAGRALALVFPASFLLKRLQYRVINILSYPFCLHQDLIKTTVSSRWVSSIYGLMVVIFSMGLDSLLLLLSYI
LILGTVLSIASKAERIKALNTCISHICAVLTFYTPMIGLSMIRRYGQNASPIVHVLMANVYLLVPPLMNPIVYSVKTKQIRDRILRKLKKHEV*
1073 >lcl|NP_001002280.1|Plus1complement(7216173..7217057) NW_047558 MAS-related GPR, member X2 Mrgprx2 __SEG__ Chr1 {Rattus norvegicus} MSFCEVVSCAIILLSLIIALVGLVGNGTVFWLLGFQMRRNAFSVYILNLAGADFLFMCFQIVYCSHIMLDMYYIPIKFPLFSIVVLNIGYLCGMSILSAISIERCLSVMW
PIWYRCQRPRHTSAVICTLLWVLALVWSLIEGKECGFLFDTNGPGWCETFDLIATAWLIVLIVVLLGSSLALVINIFCGLYRIPVTRLYVTIVFTVLVFLLCGLPYGIYW
FLLEWTEKFNYNLPCGFHPVTVLLSCVNSCANPIIYFLVGSIRHHRFQRKTLKLLLQKAMQDTPEEEECGEMGS*
1074 >lcl|NP_001002283.1|Plus1complement(7121746..7122732) NW_047558 MAS-related GPR, member B13 Mrgprb13 __SEG__ Chr1 {Rattus norvegicus} MDSSIPDPEADLIQLNGSYHTETSPCVIESRVMILLSIIIAFFGLAGNAMVLWLLAFRMRRNVFSVYILNLAGANFLFLCTHTAFSLEKIIVLFHSVHIHIPLLFYTLST
LAYLAGVSMVTAISAEYWLSGIWPYWYQGQRLKHTTTVICTGLWGLALLLSLLEGKSCGFLGSTYNQDVCWKLDFIIVAWLLVLFAVLSRSIQVLLVRIFCGSQRTPVTK
LHVTIVLTALVLVICGFPFGIIFYLLYWTTEVYYIMPCNSFHETILLLSYINSCANPIICLLVGSIRHCRFQCGTLRLLLHRAMQDIPEEEGEELEEVVGERVQSSIP*
1075 >lcl|NP_001002284.1|Plus17031717..7032778 NW_047558 MAS-related G protein-coupled receptor, member B5 Mrgprb5 __SEG__ Chr1 {Rattus norvegicus} MPDSPTESYGPDREYHVFISLFLCRNTSGKFLSVGPATPGWSINNTVVKENYYTEILSCIITFNTLNFLTATISVVGMAGNATVLRLLGFHMHRYAFSVYVFNLAGADFL
YLCTQTVYSLECVLQFDNSYFYFLLTILMFAYLAALCMIPAISTERCLSVTWPIWYHCQRPRHTSATVCALFWAFSLLLRLLLGQGCGFLFGKYDYYFCRYCSFITTAFL
IVLFVVPFVSSLAMLTKIICGSHRIPVTRFYVTIAVTVLVFTFFGLPVGIVSLLLPRIVVFRGVFYIYKIVTFLYSVNCCANPIIYFLIGSIRHHRLQRQSLKLLLQRAM
QDTPEEEGGVKGPSQKSNELEIV*
1076 >lcl|NP_001002285.1|Plus1complement(7291202..7292146) NW_047558 MAS-related G protein-coupled receptor, member X2-like Mrgprx2l __SEG__ Chr1 {Rattus norvegicus} MSSCGIMSCTMIFLSLIIAIVVLVGNAIVIWLLGFQMCRNAFSIYILNLAGADFLFIGFQIGYCFYIIFDIYTIPIKLPLFFIVMLNFAYLCGLSILSAVSIERCLCVMR
PFWYRCQLPRHTSAVICTMLWVLSLVLSLSEGKECGFLPGTNISDWCKTIDLIITSWLIVLFVVLLVSSLALVITIFCGLYRIPVTRLYVVIVFTVLFFLLFGLPYGIYL
FLLVWAETFYYVFPCGFLPVTIFLSCINSCANPIIYFLVGSVRHHRFQRKSLKLLLQQARQDTPETEEYVEMGSLGRSREVNSLQGTESCFDQA*
1077 >lcl|NP_001002287.1|Plus1complement(6923536..6924507) NW_047558 MAS-related GPR, member B4 Mrgprb4 __SEG__ Chr1 {Rattus norvegicus} MSPTTQAWSINNTVVKENYYTEILSCITTFNTLNFLIVIISVVGMAGNATVLWLLGFHMHRNAFSVYVLNLAGADFLYLCAQTVYSLECVLQFDNSYFYFLLTILMFNYL
AGFCMIAAISTERCLSVTWPIWYHCQRPRHTSATVCALFWAFSLLLSLLLGQGCGFLFSKFDYSFCRYCNFIATAFLIVIFMVLFVSSLALLAKIICGSHRIPVTRFYVT
IALTVLVFIFFGLPIGICVFLLPWIHMMLSSFFYEMVTLLSCVNSCANPIIYFFVGSIRHHRLQRQTLKLLLQRAMQDTPEEEGGERGPSQKSEDLEVVRCSS*
1078 >lcl|NP_001002288.1|Plus1complement(12698318..12699247) NW_047563 MAS-related GPR, member E Mrgpre __SEG__ Chr1 {Rattus norvegicus} MSLRVHTHSPSTQGDMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLDVACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLIMLRFFCYIVGLSLLV
AISTEQCLATLFPSGYLCRRPRYLTTCVCAFIWVLCLLLDLLLSGACTQFFGAPSYHLCGMLWLVVAVLLAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLVILL
FLFCGLPFGIFWLSKNLSWHTPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFQEPLRLVLQRALGDEAELGAVREASQGGLVDMTV*
1079 >lcl|NP_001002291.1|Plus1complement(21075710..21076651) NW_047334 olfactory receptor Olr1384 Olr1384 __SEG__ Chr10 {Rattus norvegicus} MWLNQSFTDDFILLGIFSYSPTDLLLFSVVMLVFTVALCGNVLLILLIYTDPRLHTPMYFFLSQLSLMDLMLVCTNVPKMAFNFLSGKKSISFVGCGIQIGLFVSLVGSE
GLLLGLMAYDRYVAISHPLHYPVLMNQKVCLQIIGSSWAFGTVDGLVQMVVVMTFPYCSLREVDHFFCEMLSLLKLACVDTSLFEKVGFVCCVLMLLFPFSIIVASYTRI
LGTVLRMHSAKSQKKALATCSSHLTAVSFFYGAAMFIYLRPRQYRTPSQDKMVSIFYTVLTPMLNPLIYSLRNRDVIGALQKGLDCCRIGNQH*
1080 >lcl|NP_001002853.1|Plus1complement(34957782..34958792) NW_047625 purinergic receptor P2Y, G-protein coupled, 13 P2ry13 __SEG__ Chr2 {Rattus norvegicus} MLGTVNTTGMQGFNKSERCPRDTRMTQLLFPVLYTVVFFTGVLLNTLALWVFIHIPSNSTFIIYLKNTLVADLIMTLMLPFKILSDSRLAPWQLRGFVCTFSSVVFYETM
YVGIMMLGLIAFDRFLKIVVPFRKTFVKKTAFAKIVSISIWLLMFLISLPNMILNKEATASTVKKCASLKSPLGLLWHQVVSHTCQFIFWTVFILMLLFYTVIAKKVYDS
YRKFKSRDSKHKRLEAKVFIVMAVFFVCFAPFHFVRVPYTHSQTTNKTDCRLENQLFLAKESTLFLATTNICMDPLIYIILCKKFTRKVPCMRWRTKTAASSDEHHSSQT
DNITLS*
1081 >lcl|NP_001003401.1|Plus12132114..2133883 NW_047617 ectodermal-neural cortex 1 Enc1 __SEG__ Chr2 {Rattus norvegicus} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAMNWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEQYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
1082 >lcl|NP_001003654.1|Plus17101116..7101628 NW_047535 partitioning defective 6 homolog alpha isoform 2 Pard6a __SEG__ Chr19 {Rattus norvegicus} MSVRVAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDNSDPV
IENRHPPCSNGLSQGPLCWDLQPGCLLPSAGSSLPSLDSREQANSGWGNGMRGDVSGFSL*
1083 >lcl|NP_001004444.1|Plus1328288..330429 NW_047761 zinc finger and BTB domain containing 1 Zbtb1 __SEG__ Chr6 {Rattus norvegicus} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDTYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKILTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDSDCSSSKCSSSASSKHNSKMIFGVRMYEDTVARNGSEANRWSAEPSSTVNTPHNREPEEESLPLANFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQSTARAYHRVVDARDGKDSAIKAELGDKGSPTAFSAHTDKYREDASQAPDDSASPTGSRKSTVESGTAGEEKSRAAETKRVVIKME
PEDVPADDMKDFTIVKVTEKDCNESTDNDELEDEPEEPFYRYYVEEDVGIKKSGRKTLKPRMSVGVDERGGLENMRPPNNSSPRQEDAENASCELCGLTITEEDLSSHYL
AKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTDEKMDMEENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVV
EHMSSCLDQDMFKGAVMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSGG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
1084 >lcl|NP_001005877.1|Plus1complement(2108451..2109443) NW_047557 free fatty acid receptor 2 Ffar2 __SEG__ Chr1 {Rattus norvegicus} MTPDWHSSLILTAYILIFLTGLPANLLALRAFVSRVRQPQPAPVHILLLNLTLADLLLLLLLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISIERYLG
VAFPVQYKLSRRPLYGVIAALVAWIMSFGHCTIVIIVQYLNSTEQVGTENQITCYENFTQAQLDVVLPVRLELCLVLFFVPMTVTIFCYWRFVWIMLTQPHVGAQRRRRA
VGLAVVTLLNFLVCFGPYNMSHLVGFHLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVVRRAFGKGLLLLRNPGSSMLGRGAEETVEGTKTDRGGSQTEGAQSSDFVTE
*
1085 >lcl|NP_001005904.1|Plus1534972..536738 NW_047712 calicin Ccin __SEG__ Chr5 {Rattus norvegicus} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLVSSNDMKTTDELYITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRVNCLRYLFLAELFELKEVSDLAYSGIRDNFHFWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKEEREKYFKKFF
NYINLNAVSNKTLMFASNKLTGLENNSAHATLIESVLMDRKQERPCSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATAAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTCTGEVVQCITFPIEFNHRPLLSFHQDNILRVHSHRQSVEINLQKIKANKSTTSVPLLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
YLLDQKIGEWKTLACPPEALDCPACCLAKLPCKILQRI*
1086 >lcl|NP_001006595.1|Plus1complement(4857114..4858013) NW_047562 olfactory receptor Olr156 Olr156 __SEG__ Chr1 {Rattus norvegicus} MTFTLMGVPGLESQHIWLSLPFTSMLLAILIGNGAILFLVITEPTLHTPMYLLLALLMVADLISTLALLPKVLCLFWFDDRVIAVYACFTQMFFIHGASVVQSALLVAMA
FDRFVAVCEPLRYNTILSHSLVGRLGLVALAKGVILILPMPLLLQRLTFCHRIIPHTYCDHMAVVKMACSNTRPNRIYGLFVVLLVVGLDLLLIGLSYVFILQTVVRLNS
RDATFKALNTCSAHFFVILITYVPGLFSSITHRIGRNIPPHAHIILANLYLLIPSVFNPIIYGIKMKEIRDRVVKCLCR*
1087 >lcl|NP_001006596.1|Plus113029522..13030427 NW_047657 olfactory receptor Olr595 Olr595 __SEG__ Chr3 {Rattus norvegicus} MQFVLIGFSDLPNLQGSLFTVFSVVYLIILMGNFLIIVIISMEQALQKPMYFFLANFSSLEICYVSVTVPRILFNIETQDRHISLMSCATQMCFFLIFGTTESLLLAVMS
YDRYIAICHPLLYPMVMNPSKCTQLAAGSWLGGIPIQVGQTCQIFSMKFCNSYKINHFFCDIPPILKLACGDTTMHELSVYVVVMVVAAFPFILVLTSYSKIIATILRLP
TAKGRAKAFSTCSSHLLVVVLFYGSATVTYLRPKSMHSPGTDKLLSLFYTIVTPMFNPLIYSLRNKEVISALRKLFFKAYY*
1088 >lcl|NP_001006597.1|Plus16050691..6051578 NW_047773 olfactory receptor Olr990 Olr990 __SEG__ Chr7 {Rattus norvegicus} MRNHTVTTFILLGLTDDQQLQVLIFIILFFTYSLIITGNLSIISLVLADPHLKTALYYFLKNFAVLEISFTPASIPRYLYSIATGDKTITYNACVAQVFFTDLFGLTEFF
LLAAMSYDRYVAICRPLHYLTTMNTAVCRRLVFCCWVAGLFILIPPLSLGLNLQFCDSNIIDHFICDASPLLKISCSDTWFMEHTVLICAVLTLIITLVCVVLSYVNIIK
TILRFPSAQQKQKAFSTCSYIKPSAKKEVAINKGVMVLTTSIAPMLNPFIYTLRNRQVKQAFCDSIKRIIAFFKK*
1089 >lcl|NP_001006598.1|Plus1complement(4939209..4940150) NW_047333 olfactory receptor Olr1362 Olr1362 __SEG__ Chr10 {Rattus norvegicus} MSSTNQSSVTEFLLLGLSRQPQQQQFLFLLFLTMYLATVLGNVLIILAISTDSRLHTPMYFFLCSLSFVDVCFSSTTAPNVLANHILGSQKISFSGCLTQLYFLCIFGDM
DNFLLAVMAYDRFVAICHPLRYTTKMTHQVCALLVMGSWVVANMNCLLHILLMARLSFCADNIIPHFFCDVTPLLKLSCSDTHLNELMILTEGAVVMVTPFVCILISYIH
ITWAVLRVSSPRGGWKAFSTCGSHLTVVCLFYGTVITVYFNPSTSYSAGRDTAAAVMYTVVTPMLNPFIYSLRNRDMKVALRKVLAMRFPSKQ*
1090 >lcl|NP_001006599.1|Plus11387403..1388293 NW_047596 olfactory receptor 1738 Olr1738 __SEG__ Chr20 {Rattus norvegicus} MGVTDIQELNPILFLTFLVMYFVNVFGNGSILMIVILDPRLHSPMYFFLGNLACVDICFSTVTVPKMLENFFSTSKAISFLGCITQLYLFHFLGSTEALLLTVMAFDRFV
AICRPLHYPSIMNSHVCIQLTVVIWAIPFIPALLHSILTSQLSFCGSNHVHHFFCDVKPLLELACGNTELNRWLLNTFTGTVAIALFFLTFLSYFYIITYLFLKTRSCSM
LHKALSTCASHVMVVIIFYAPVLFIYINPDSRSSLEKDRIIAVMYTVVTPALNPLIYTLRNKEVRGALNRKIRIQL*
1091 >lcl|NP_001007147.1|Plus1complement(651881..652921) NW_047781 transducer of ERBB2, 2 Tob2 __SEG__ Chr7 {Rattus norvegicus} MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLRGSGFRCVHIGEVVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVK
VLYLGDGEVGGAQELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGASSGVSVSGSGAGGQQPPSQQPRL
ARSPTNNLLKHKSLSLSMHSLNFITANPGPQSQLSPNAKEFVYNGGGSPSSLFFDGVDGPGTSAAAPFGSSGASTCNSSSFDVAQVFGGGANSLFLEKTPFVEGLSYNLN
TMQYPNQPFQPVVLAN*
1092 >lcl|NP_001008526.1|Plus1complement(31832359..31833702) NW_047762 BCL2-associated athanogene 5 Bag5 __SEG__ Chr6 {Rattus norvegicus} MDMGNQHPSISRLQEIQREVKSIEQQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQDTERLLKELEQNANHPHRIEIKNIFQEAQALVKEKTV
PFYSGSNCVTSEFEEAIQDIILRLTHVKTGGKISLRKARYHTLTKICAVQEIIEDCVRKQPSLPLSEDVHPSVAKINSVMCEVNKARGTLIALLMGVDSSETCRHLSCVL
SGLMADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADNTHAFDLGQNHSIIKIENVLKRMREMKNELLQAQSPPELYLRSKTELQGLIGQLDEVSLEKNPCIRE
ARRRAVIEVQTLITYLDLKEALEKRKLFPCEETPPHKAVWNVLGNLSEIQGEVLSFGGNRTDKNYIRLEELLTKQLLTLDAVDPLGEEKCKAARKQAVKLAQNILSYLDM
KSDEWEY*
1093 >lcl|NP_001009172.1|Plus1complement(1726676..1728586) NW_047597 zinc finger and BTB domain containing 22 Zbtb22 __SEG__ Chr20 {Rattus norvegicus} MEPSPMSPSGATLPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRSSAATTTVTAVAAPSVSVPCASVPSGSGGTVAPATVGSVRSHTSSRASENQSPSSSNYFSPRESTDFSS
SSQDAFVASAVGSGNRRDGGPVFPVPVVGSAGTTSGKLLLEADELCDDGGDGRGAAAPGAGLRRPNCLPASAVPQKHWVYVKRARNCPAPASLVHQDPDLEDEEEEEDLV
LTCEDDEDEDLGNGSGVPAGGEPEATLSISDVRTLTEPAEKGEEQVNFCESSNDFGPYEGGGAGAGLDDPGGPTPSSYGLTHPPRPLLPLDVPGNQILVFPSSSSQAPGQ
PPGNTAEHGAVTLGGASAVGLGIPSGSGGTPGGAGNSDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECSVCAKKFMWR
DSFMRHRGHCERRHRMGAGGAASVPGPGPGAPTGPALQPKRESSAVGGGSGDEANSATPPSNRRVWSPPSVHKVEMDFSGGGGAAH*
1094 >lcl|NP_001009965.1|Plus1complement(14498552..14499613) NW_047561 tsukushin precursor Tsku __SEG__ Chr1 {Rattus norvegicus} MLCTLFLLLLALGTVQTTRPCFPGCQCEEETFGLFDSFSLIRVDCSSLGPHIVPVPIPLDTAHLDLSSNRLETVNESVLGGPGYTTLAGLDLSHNLLTSITPTAFSRLRY
LESLDLSHNGLAALPAEVFTSSPLSDINLSHNRLREVSISAFTTHSQGRALHVDLSHNLIHRLLPYPARASLSAPTIQSLNLSWNRLRAVPNLRDLPLRYLSLDGNPLAT
INPGAFMGLAGLTHLSLASLQGILQLPPHGFRELPGLQVLDLSGNPKLKWAGAEVFSGLGLLQELDLSGSSLVPLPETLLHHLPALQSVSVGQDVQCRRLVREGAYHRQP
GSSPKVVLHCGDTQESARGPDIL*
1095 >lcl|NP_001012045.1|Plus133363633..33365036 NW_047454 kelch repeat and BTB (POZ) domain containing 7 Kbtbd7 __SEG__ Chr15 {Rattus norvegicus} MQSREDAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQA
SVTIHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREETLADLTLA
QLLAVLRLDSLDVESEKTVCHVAVQWLEAAPKERGPSAAEVFKCIRWAHFPAEDQDYLEELLTKPIVKKYCLDVIEGALLQLRLDDDLCKALIRVPSSSSNSSNNSNSNN
NNDTSNTVIPAEENPPHRLGMCVKRMMVFFEHCKHPFLCCYSYSGEIYKVFLPVSCLADTRALSTLAVSIFPDHDICSTVQPRKGVWVYKPAPNNLHQLTDHLLCPKGMD
VTDLNGYIYILGGQDPVTGAILKDVECY
1096 >lcl|NP_001012046.1|Plus1complement(61871728..61872672) NW_047454 sprouty 2 Spry2 __SEG__ Chr15 {Rattus norvegicus} MEARAQSGSGSQPLLQSPHDSGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQPTQVHSSRAALSRSV
STVSSGSRSSTRTSTSSSSSEQRLLGSSFSPGPAVDGIIRVQPKSELKSGELKPLSRDDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCC
VKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT*
1097 >lcl|NP_001012054.1|Plus130936704..30937153 NW_047492 calmodulin-like 3 Calml3 __SEG__ Chr17 {Rattus norvegicus} MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQDMVNEIDKDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVM
TRLGEKLSDEEVDEMIQAADTDGDGQVNYEEFVHMLVSK*
1098 >lcl|NP_001012070.1|Plus121964482..21965693 NW_047563 G protein-coupled receptor 44 Gpr44 __SEG__ Chr1 {Rattus norvegicus} MANITLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRMRQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVF
FLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHRVCLMLWALAVLNTVPYFVFRDTIPRRDGRIMCYYNMLLLNPGSDRDTTCDYRQKALAVSKFLLAFMVPLAI
IASSHVAVSLQLHHRGRQRTGRFVRLVAAIVVAFILCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNPLLYVLTCPDMLHKLRRSLLTVLESVLVEDS
DLSTGPGKRCRRRHRRRASSTTTPASTLLLADRFPQLRPARLIGWMRRGSAELPRRVREQSQEKQGSLSCTLD*
1099 >lcl|NP_001013190.1|Plus120747424..20748116 NW_047773 four and a half LIM domains 4 Fhl4 __SEG__ Chr7 {Rattus norvegicus} MSEFKCHHCRESLQGKKYVQKDNFNYCVTCFDAHCANICVECNKPIGADSKEVCYKERFWHNTCFKCSKCLQPLATETFVVWDNKILCNNCVSQQAFPKCKGCLKDIKQG
EQSVEYKGTIWHKDCFVCSNCKEVIGTKTFFPKDEGFYCVACYDILFTKYCVKCNKPITSGGVSYQDQPWHSECFVCVNCSKELSEQRFTVMDDKIFCVDCYKNFIAKKC
AGCKNPITGFG
1100 >lcl|NP_001013974.1|Plus118855323..>18856117 NW_047773 hypothetical protein LOC300308 LOC300308 __SEG__ Chr7 {Rattus norvegicus} MDITSIKKTLGSQYRVAFFLGQGSYGSVKLAWHRRTQALVAIKTVEISKKTIRSILSEMTTLELLHHPNIISLFQILVTANQIHFILQYAPGGNLVELISEEGPLPEEKA
KKMFGQIVSAIRHCHSLDIVHGDIKPQNILIDGEGNVKLIDFGLAVKCRPGTLLSRHCGTRGFNAPELVLRQPYDGKSSDVWSLGVLLYFITTGYFPFRGNTIDEIEQKI
TTGTYTIPHHLSGQLENLIHQIFTVSPEMRPSIEEIENHPWIKKC
1101 >lcl|NP_001014121.1|Plus119676863..19677927 NW_047813 progestin and adipoQ receptor family member VIII Paqr8 __SEG__ Chr9 {Rattus norvegicus} MTTAILERLSTLSVSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTL
PLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLA
FILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRHEIFFQRHGPLSVYTACLSFFFL
AACSAATASLLRHKVKDRLIKKDS*
1102 >lcl|NP_001014295.1|Plus1647948..649087 NW_048044 armadillo repeat containing, X-linked 3 Armcx3 __SEG__ ChrX {Rattus norvegicus} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGPGDVEDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTVTSRLNSSV
QLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLGAHVPSSLGSLFNKKEYKEVILKLLSIFENINDNFKWEENEPAQNHFSE
GSLFFFLKEFQVCADKVLGIESHHDFQVRVKVGKFVTKLTERMFPKSQE*
1103 >lcl|NP_001014779.1|Plus11753277..1755616 NW_047511 protocadherin beta 8 Pcdhb8 __SEG__ Chr18 {Rattus norvegicus} METALAKTPEKRQVIFLAILLLLWESGSEAIRYSMPEETESGYLIANLAKDLGLQIGELSTRGARIHHNGNKELLQLDAKRGNLLLKEKPDREALCGATEPCVLHFQIIL
ENPVQFFQTDLQLTDINDHSPEFPDTEMLLKIQESVQPGTVFPLKAAQDSDIGSNAVQNYTVNPNLHFHVLTHSHTDGRKYPELVLDRALDREEQPELTLILTALDGGAP
PKSGTTTVRIEVVDINDNAPQFVQSLYAVEVPEDSPLNALVVTVSARDLDTGIHGNVAYSLFQGSGGLQPFVIDEISGEIRLKGALDFEATPYYNMEIVATDSGGLSGKC
TVSIQVVDVNDNAPKLTISSLTRSIPENAPEAVVAVFSVSDPDSGDNGRVLCSIQNELPFLLKPTFKNFYTLVTESPLDRESRAEYNITISVSDLGTPRLTTQHTITVQV
SDINDNAPTFTQTSYTLFVHENNSPALHIGTISATDADSGSNGFINYSLLPPHDQQLALVSLISINSDNGQLFALRALDYEAVQAFEFHVGATDGGSPALSSQALVRVVV
LDDNDNAPFVLYPLQNASAPCTELLPRAAEPGYLVTKVVAVDADSGQNAWLSFQLLKATEPGLFNVWAHNGEVRTARLLSERDVPKHRLLLVVKDNGEPPRSASIMLQVL
VVDGFSQPYLPLPEVALNPTKEEDMLTLYLVIALASVSSLFLLSVLLFVGVRLCRKARAASLGDCSIPEGHFPGHLVDVSSAGTLSQNYHYEVCLTEDSGTSDFKFMNPI
IPTSLLQDS*
1104 >lcl|NP_001014780.1|Plus11734196..1736514 NW_047511 protocadherin beta 6 Pcdhb6 __SEG__ Chr18 {Rattus norvegicus} METALAKTPEKRQVVFLALLLLLWEAGSEAISYSMSEETESGYLVANLAKDLGFRAGELATRGARIHHRGNKDLLQLDAETGNLLLKEKPDREALCGATEPCVLHFQVIL
ENPVQFFQTDLQLTDINDHSPEFPDTEMLLKIQEIAQPGTVFPLKAAQDSDIGSNAVQNYTVSPNLHFHVVTHSRTDGRKYPELVLDRALDREEQPELTLILTALDGGAP
PKSGTTTVRIEVVDINDNAPQFVKSLYAVEVPEDSPLNALVVTVSARDLDAGIHGNVAYSLFQDSGGSPPFVIDEISGEIRLKGALDFEATPYYNMEIVATDSGGLSGKC
TVAIQVVDVNDNAPKLTISSLTRSIPENAPEAVVAVFSVSDPDSGDNGRMVCSTQNELPFLLKPTYENYYTLVTEGPLDRESRAEYNITITVSDLGTPRLTTQHTITVQV
MDINDNAPVFTQTSYTMFVHENNSPALHIGTISATDSDSGSNAHITYSLLPPRDPQLSLASLVSINIDNGQLFALRALDYEVLQGFEFRVSATDQGSPQLSSQTLVSVVV
LDDNDNAPFVLYPLQNASASCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQMLKATEPGLFSVWAHNGEVRTTRLLSERDVPKHRLLLLVKDNGEPPLSASVTLQVL
LVDGFSQPYLPLPEVRRDPSQEEDLLTLYLVVALASVSSLFLLSVLLFVGVRLCRRARETSLGACSVPEGHFPGHLVDVSGMGTLSQSYQYEVCLTGDSGTTDFKFLNHH
SQ*
1105 >lcl|NP_001014783.1|Plus11694070..1696424 NW_047511 protocadherin beta 3 Pcdhb3 __SEG__ Chr18 {Rattus norvegicus} MVAREERLLKQRQVLLLFVFLGGSLAGSASRRYSVAEETERGFAIANLAKDLGLSGEELAERRAQAISKGNVQYFQLSHQTGDLLLVERLDREELCGSTEPCVLHFQILL
HNPLQFITNELEVIDVNDHAPEFFENAMQLKVLESSPPGTVIPLGNAVDLDVGRNGLQNYTVSPKSHFHVHTRHRRDGRKYPELVLHRALDREEQPELSLTLTALDGGSP
PRSGTTQVHILVLDINDNAPEFTQSLYEVQILEKSPVGSVITTVSASDLDTGNFGAISYVFFHASEEILKTFQLNSSTGNIQLLKSLDYETINTYEVDIEAKDGGGLSGK
CVVIVQVVDVNDNPPELTLSSVNSLIPENSAETVVAVFSVSDLDSGDNGRVTCSIQDDLPFILKPSVENFYTIASEGALDRESRAEYNITITVSDLGTPRLTTQNTITVQ
VSDINDNAPDFTQKSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPDDPQLALDSLISINADNGQLFALRALDYEALQAFEFRVDATDRGSPALSSQALVRVM
VLDENDNAPFVLYPLQNASAPCTELLPRAAEPGYLVTKMVAVDSDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPKHKLLLLVKDNGESPRSASVTLQV
LLVDGFSQPYLPLPEVARDSLQNDVDLLTLYLVIALASVSSLFLLSVLLFVGVRLCRRVRAASMGGCSVSEGHFPGHLVDVSQAGTLSQSYQYEVCLTGDSRTSEFKFLN
PVIPNLFLEESERS*
1106 >lcl|NP_001014784.1|Plus111859635..11860624 NW_047710 neuropeptides B/W receptor 1 Npbwr1 __SEG__ Chr5 {Rattus norvegicus} MHNLSLFEPGRGNVSCGGPFLGCPNESNPAPLPLPQPLAVAVPVVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELFTLVLPINIADFLLRRWPFGEVM
CKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVVLPFAVFARLDEEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVST
ICALYITLLCRLRAIQLDSHAKALDRAKKRVTLLVVAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLVSCRTA*
1107 >lcl|NP_001019499.1|Plus1923230..924111 NW_047691 GTPase, IMAP family member 7 Gimap7 __SEG__ Chr4 {Rattus norvegicus} MAELDDDSLRIVLVGKTGSGKSATANTILGQKIFTSRIAPHAVTQTCQKASRRWKERDLLVVDTPGLFDTKVNLETTSIEISRCVLQSCPGPHAIILVLQLNRFTIEEQE
TVTRIKAIFGKAVMKYLIILFTRKDELEDQNLNDFIEDSDTNLKSIIKECDSRYLAINNKAEGAEGEMQVQELMGFVESLVRSNGGLYFSDPIYKYAEQRLKKQVGILRE
IYTDVLEKEIRIVEEECGLGKLSTQEGEEKIQAIREKYNLKIGNLREAAEKNIFTWIVEEVKKVLLKIWHFFS*
1108 >lcl|NP_001020096.1|Plus1complement(8614003..8615124) NW_048034 G protein-coupled receptor 34 Gpr34 __SEG__ ChrX {Rattus norvegicus} MTTTVDSWLCSSPGMHFITNDSDQVSQNFSGVSNVTSCPMDEKLLSTVLTTFYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAVADLLLIFCLPFRIMYHINQN
RWTLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRRAITTKQSVYVCCVVWTVALAGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFALVVMFW
LIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNASSCYWKEIIHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIM
CQLLFRRFQSDTSRSESTSEFKPGYSLHDLSVTVKMQYSTKGN*
1109 >lcl|NP_001020214.1|Plus1complement(4861904..4863547) NW_047658 inositol 1,4,5-triphosphate receptor interacting protein-like 1 precursor Itpripl1 __SEG__ Chr3 {Rattus norvegicus} MAVISLLFLAVMYVVHHPLMVSDRMDLDTLARSRQLEKRMSEEMRQLEIEFEERSRAAEEKQKAENFWRGDTSNDQLVLGKKDMRWPFQASGQDGGPLGWMLGNLWNAGL
FCLFLIFELLRQNMQHEPAFESSSEEEEEEIRVVPVSSYTWLSGFPSQEALESFYKHYIQNAIRDLPCTCEFVESFVDDLIEACRVLSRREAHPQLEDCLGIGAAFEKWG
TLHETQKFDVLVPIVPPQGTMFILEMRDPTLGRRCGCVKVDSECVCKNEKLLGDVLCLVHHRDHSAMLSKCTSSIKAALCTSSHLDVYKTVQWFRNMVSNAWALVAHKYD
FKLTLPPSTTTCKLRLDYRSGRSLSISLVLGVQREDTLVYLVSQAPEREQFTSVDWPESFAACEHLFLKLVGRFAPDNTCHLKCLQIILSLQDHQTLPPGASRPILTSYH
FKTALMHLLLRLPLTDWQHRMLSQRLQDLLWFLGRSLQQRSLHHFLIGNTHLPLTIPIPKAFRNAEPVNLFQHLVLNPVAHSQAVEEFHNLLAQVKTLPCSPLAGGL*
1110 >lcl|NP_001020306.1|Plus1complement(1326287..1326655) NW_047339 hypothetical protein LOC497995 LOC497995 __SEG__ Chr10 {Rattus norvegicus} MACCSTSFCGFPTCSTGGTCGSSCFQPSCCETSCFQPSCCETGYGIGGGIGYGLEGGSGAVNYRVRWCRPDCRVEGTSLPPCCVVSCIPPTCCQLHHAQASCCRPSYCGQ
SCCRPACCCYCC*
1111 >lcl|NP_001020851.1|Plus12004624..2005721 NW_047556 G protein-coupled receptor 4 Gpr4 __SEG__ Chr1 {Rattus norvegicus} MDNSTGTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQRNELGVYLMNLSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFL
CCISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWVAWMNLYRVFVGFLFPWALMLLCYRGILRAVQSSVSTERQE
KVKIKRLALSLIAIVLVCFAPYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKALHNLLRFLASNKPQEMANASLTLETPLT
SKRSTTGKTSGAVWAVPPTAQGDQVPLKVLLPPAQ*
1112 >lcl|NP_001028844.1|Plus1complement(33355059..33355913) NW_047658 bcl-2-like protein 1 isoform 1 Bcl2l1 __SEG__ Chr3 {Rattus norvegicus} MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEPERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTS
QLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWVRTTPLVCPPLVCLSSVEIPNCPFWSPGMVVE
DIDYSGDIPGFTLIPGVNFGNIDDPVFKEPVFFILATLVAPQFHSFVPISRQRKTACVFTWLKT*
1113 >lcl|NP_001029182.1|Plus1complement(475039..477474) NW_047693 TLR4 interactor with leucine rich repeats precursor RGD1310827 __SEG__ Chr4 {Rattus norvegicus} MEGVGAVRFWLVVCGCLAFPPRAESVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQDVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLE
ELYLGNNLLQALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNVLGALPDAVFAPLGNLLYLHLEANRIRFLGKNAFTQLGKLRFLNLSANELQPSLR
HAATFVPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEALRELRLEGNRLNQLPLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLREL
SLRDNALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQLLQNGSCVDPSPSPTAGSRQWPISTAPGEGMTP
PAGLAQELPLQPQPQPQQRGRLLPGVAWAGAAKELVGNRSALRLNRRGPGLQHQSPSAAAASGSAPQSLDLHEKPERGRPTRANLPQTEPTPTSEPASGTPSARDSWQRA
AKQRLASEQQGRAVQYDSGVGLPPLVSDPCDFNKFILCNLTVEAVSANSASVRWAVREHRSPRPQGGARFRLLFDRFGQQPKFQRFVYLPERSDSATLHELRGDTPYLVC
VEGVLGGRVCPVAPRDHCAGLVTLPEAGGRGGVDYQLLTLVLLAINALLVLLALAAWGSRWLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTT
VCALSEADLIEFPCDRFMDSSGGGTGGSLRREDHLLQRFAD*
1114 >lcl|NP_001029253.1|Plus1556749..557786 NW_047725 progestin and adipoQ receptor family member VII Paqr7 __SEG__ Chr5 {Rattus norvegicus} MAMAVAQKFSHLLSSLWHVGQKPLQAEPVFTVDRAEVPRLFWKPYIYAGYRPLHQNWCFYFRTLFQQHNEAVNVWTHLLAALALLLRLIVLAGSVDFWEDPHALPLFIIV
LASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHDKVQAIFLPTAAFLAWLSCAGSCYNKYSQKPGLLGRSFQEVPSALAYALDISPV
VHRIIVSPLPAEEDPALLYHKCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARGAIYKPLHARWPHNFFGLFLLTVGSSILTAL
LLSQLVRRKLHQKTK*
1115 >lcl|NP_001032413.1|Plus1complement(26179410..26181368) NW_047689 leucine rich repeat containing 4 Lrrc4 __SEG__ Chr4 {Rattus norvegicus} MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNAI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEDRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSRVLLIDTGVYTCMVTNVAGNSNASAYLNV
SSAELNTPNFSFFTTVTVETTEISPEDITRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPVPSTDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLR
KRHQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
1116 >lcl|NP_001032436.1|Plus18368123..8369043 NW_047817 G protein-coupled receptor 35 Gpr35 __SEG__ Chr9 {Rattus norvegicus} MNNTNCSILPWPAAVNHVFTIYLVLLLVLGLLLNGLALWVFCYRMHQWTETRVYMTNLAVADVCLLCSLPFVLYSLKYSTSDTPICQLSQGIYLVNRYMSISLVTAIAVD
RYVAVRHPLRARELRSPRQAGAVCVALWVIVVTSLVLRWRLGIQEGGFCFSSQNRYNFSTTAFSLLGFYLPLAIVVFCSLQVVTALARRPATDVGQVEATQKATRMVWAN
LAVFIICFLPLHLILTVQVSLNLHTCAARNIFSRALTITAKLSDINCCLDAICYYYMAKEFQDASLPATASSTPHKSQDTQSLSLT*
1117 >lcl|NP_001032440.1|Plus118114070..18116220 NW_047695 leucine rich repeat neuronal 1 precursor Lrrn1 __SEG__ Chr4 {Rattus norvegicus} MARLSPGKAACWMVLGLLIPSLTESSILNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPGNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNI
KEVGLANLTQLTTLHLEENQISEMTDYCLQDLSNLQELYINHNQISSISANAFSGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFRPLSNLRSL
VLAGMYLTDIPGNALVGLDSLESLSFYDNKLIKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHR
LAFRSVPALESLMLNNNALNAVYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYRGQQVKEVLIQDSSEQCLPMISHDTFPNHLNMDIG
TTLFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEIANIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGAQVLKIYVKQTESHSILVSWKVNSNVM
TSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKTAAFALDISDHETSTALAAVMGSMFAVISLASIAIYIAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSDKDKDGSADTKPTQVDTSRSYYMW*
1118 >lcl|NP_001034095.1|Plus111908261..11910030 NW_047560 ectoderm-neural cortex protein 2 Klhl25 __SEG__ Chr1 {Rattus norvegicus} MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLSPSNCLGMMVLSDAHQCRRLYEFSCRMSLVHFETVRQSEDFNSLSRDTLLDLISRDELETEDERVVFEAILQWVKH
DLEQRKVHLPLLLRNVRLALLPSDCLKKAVSGEALLMADECTKLIIDEAFRCKTKILLNDGVVTSPFARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGIFPASPSVSLKQVEKYDPGDNKWTMVAPMRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCFDPSDNRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEYTAASAYRFDCETNQWTRIGDMTAKRMSCHAVASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITSVPYSLIPTAFVSTWKHLPA*
1119 >lcl|NP_001034543.1|Plus12832329..2833627 NW_047784 hypothetical protein LOC315283 Fam113b __SEG__ Chr7 {Rattus norvegicus} MVRLLASEVQQLLHNKFVVVLGDSVHRAVYKDLVLLLQKDCLLTNKQLRTKGELSFEKDQLMMGGELDTLHNRTDYREVREFCSDHHLVRFYFLTRVYSEYMESVLKELQ
SGNHAPDVIIMNSCLWDVSRYGRNSLSSYRQNLENLFGRMDEVLPKSCLLVWNTAMPLGDKIKAAFLPQKCKGQYPRISVATLKKKVTQANFYSHAEATKHYFDVLDLNF
HFRQARKHLQGDGVHWNEHAHRKLSYLLLAHMADAWGVELPHRDPWEPGFEAWESSGQVEERQPQDNIGPQFAQSPPYPFPRPPPLLPSPGLPIRPPPLLGCPLPPPQPM
PPLPLYPQVSYFSSDPVFQSDEFYIHSDSPSSNHTGYAFEGDFSFYPQPPMPNFRPPCHQRQAPVVHRGFPRHFPRGPYMPWRERPRRPQKHAPACLESRPQ*
1120 >lcl|NP_001037716.1|Plus119311077..19313131 NW_047492 frizzled-8 precursor Fzd8 __SEG__ Chr17 {Rattus norvegicus} MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV
CERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPQPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDTAAAPPSRGGKARPPGGG
AAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAG
HEKVACSGGAPGAGGAGGAGGAATAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHL
AAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFY
EQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGGGPGPGGGGGHGGGGGSLYSDVS
TGLTWRSGTASSVSYPKQMPLSQV*
1121 >lcl|NP_001037746.1|Plus1complement(1760719..1761636) NW_047566 hypothetical protein LOC682010 MGC93861 __SEG__ Chr1 {Rattus norvegicus} MLWAQRKKRKATTETTEDKPAESHRPNDSWIKSHFSRLSEEKLPAYRRVSSCGYSPEGKHGEANTTLHVDTVTTKHGEGGVALHRDSFASKQKISGTSVSKEMQRESGKS
PSMENDTWAAVAACTKEIDAKGHHVANSVLQRSPEYHRTGHAESRNISPEDLKALEEVELKLKGNFLTHRETVVAGANQAHTVYNQSHHGNQSHQNHNTYPCHQNNQSRS
VHYQGHHPSHLSHQGYPSYSSHQNHPGHPSQQGHSSHSNQQGHLGLSSQQGHPSQSSHQSHQGQPGHPNHQSHSLVNRRNQIYDS*
1122 >lcl|NP_001039308.1|Plus125738039..25739073 NW_047454 lysophosphatidic acid receptor 6 Lpar6 __SEG__ Chr15 {Rattus norvegicus} MVSANGSHCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCI
SVDRFLAIVYPFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRS
KMNKTKVLKMIFVHLVIFCFCFVPYNINLILYSLVRTQTFVNCSVGAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKSWSVRRSDSRFSEVQGTENFIQHNL
QTLKNKIFDNESAI*
1123 >lcl|NP_001065244.1|Plus1complement(17423703..17424116) NW_047626 bolA homolog 1 Bola1 __SEG__ Chr2 {Rattus norvegicus} MLSARLARCMVSMATRACVSRGSAGSAAGGPVEAAIRAKLEQALSPEVLELRNESGGHAVPAGSETHFRVAVVSSRFEGMSPLQRHRLVHEALSEELAGPVHALAIQAKT
PAQWRENPQLDISPPCLGGSKKTRGTS*
1124 >lcl|NP_001065245.1|Plus1complement(1252281..1253300) NW_047510 G protein-coupled receptor 17 Gpr17 __SEG__ Chr18 {Rattus norvegicus} MDGLETALPSLTDNASLAYSEQCGQETPLENMLFACFYLLDFILAFVGNALALWLFIWDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFL
FYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWIVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALASLAVAFTFPFITTVTCYLLIIRSLR
QGPRIEKHLKNKAVRMIAMVLAIFLICFVPYHIHRSVYVLHYRGGGTSCSAQRALALGNRITSCLTSLNGALDPVMYFFVAEKFRHALCNLLCSKRLTGPPPSFEGKTNE
SSLSARSEL*
1125 >lcl|NP_001073358.2|Plus1complement(29145933..29147288) NW_047562 selenophosphate synthetase 2 Sephs2 __SEG__ Chr1 {Rattus norvegicus} MAEAAAGASGEAMAALVAAEGSLGPAGWSAGRSFSNYRPFEPQTLGFSPSWRLTSFSGMKG*GCKVPQETLLKLLEGLTRPALQPPLTSGLVGGQEETVQEGGLTTRPGP
GSAFPSLSIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEKEREKVTPLMIKGFRDAAEEGGTAVTGGQTVVN
PWIIIGGVATVVCQQNEFIMPDSAVVGDVLVLTKPLGTQVAANAHQWLDNPEKWNKIKMVVSREEVELAYQEAMFNMATLNRTAASLMHTFNAHAATDITGFGILGHSQN
LAKQQKNEVSFVIHNLPIIAKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGASASAAAAP
DNSNAASEPSS*
1126 >lcl|NP_001073849.1|Plus1complement(42972446..42973507) NW_047760 transmembrane protein 30B Tmem30b __SEG__ Chr6 {Rattus norvegicus} MTWSASARGAQQPDNTAFTQQRLPAWQPLLSAGITLPLFFCAGLAFIGLGLGLFYSSNGIQELEYDYTGNPGTGNCSVCAAKGQDRAPPPSCQCSWSFTLPELFPGPVYL
YYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFSSDGLPIAPCGAIANSLFNDSFSLWHQRQPADPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAF
KGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIL
MGFVMLVVYIRYQDQDDDDNDDE*
1127 >lcl|NP_001093961.1|Plus164320..65210 NW_047515 melanocortin 2 receptor Mc2r __SEG__ Chr18 {Rattus norvegicus} MKHIINSYEHTNNTARNNSDCPDVVVPEEIFFTISIIGVLENLIVLLAVIKNKNLQSPVYFFICSLAISDMLGSLYKILENILIMFRNMGYLKPRGSLESTADDIIDCMF
VLSLLGSIFSLSVIAADRYITIFHALQYHSIVTMRRTVITLTVIWMFCTGSGITMVIFSHHIPTVLTFTSLFPLMLVFILCLYIHMFLLARSHARKISTLPRANMKGAMT
LTILLGVFIFCWAPFVLHVLLMTFCPNNPYCVCYMSLFQVNGMLIMCNAVIDPFIYAFRSPELREAFKKMLFCNRY*
1128 >lcl|NP_001094413.1|Plus15402475..5403371 NW_047393 G protein-coupled receptor 39 isoform 2 Gpr39 __SEG__ Chr13 {Rattus norvegicus} MASSSGSSNICSRVIDHSHVPEFEVATWIKITLTLVYLIVFVVGILGNSVTIRVTQVLQKKGYLQKEVTDHMISLACSDILVFLIGMPMEFYSIIWNPLTTPSYALSCKL
HTFLFETCSYATLLHVLTLSFERYIAICHPFRYKDVSGPCQVKLLIGFVWVTSALVALPLLFAMGIEYPLANVPTHKGLNCNLSRTRHHDHPGDSNMSICTNLSSRWEVF
QSSIFGAFAVYLVVLVSVAFMCWNMMKVLMKSKRGTLAGTGPQLQLRKSESEESRTARRQTIIFLSESGSRGILGPLA*
1129 >lcl|NP_001094466.1|Plus1complement(15540076..15540882) NW_047626 TRAF domain and POZ/BTB containing protein T1 RGD1559714 __SEG__ Chr2 {Rattus norvegicus} MSRDLEVKSCGYIHISVQNFCYEWAIRNFSFCMDGIRENITSPGFSLEASEEVQWCLTIYPNGVDEESTDYLSVYLGLLSCPKSPVWAKVQFWIINAQGEKYVITKISDV
LRFLPNRYWGCKNFILRDFLLYHSHWLLPEDKLTLCCKVSIIGPYFSRPGQNMPPAIRDPMQILAEDLGELWENSLFTDCSLVVAGQEIRSHKAILAARSPVFRAMFEHE
MLDSLRNRIEIHDIHLQVFKEMMHFIYTGTVPHLHNHSMATGLLAAAD*
1130 >lcl|NP_001096057.1|Plus11335883..1336938 NW_047804 chemokine receptor CXCR6 Cxcr6 __SEG__ Chr8 {Rattus norvegicus} MDDGHQEKDLDDDVYGGDPWLFNNSSGNSQEHKRFLKFKEVFLPCMYLVVFVLGLLGNSLVLIIYIFYQRLRSLTDVFLLNLPLADLVFVCTLPFWAYAGTYEWVFGTAM
CKTLRSMYAMNFYVSMLTLTCITVDRFVVVVQATKAFNRQAKWKIWGQVTCLLIWVVSLLVSLPQIIYSRVGHIDRLICQFHNEAISTVVLVLQMTLGFFLPLLTMILCY
SGIIKTLLHARNFQKHKSLKIIFLVVATFLLTQTPFNIAMLIQWISWEYSTITSFQYVVLVTEAIAYLRACLNPVLYAFVGLKFRKNLWKLMKDISCLSRLGVSSQWKSS
EDNSKTCSASHNAETTSMFQL*
1131 >lcl|NP_001099360.1|Plus15375338..5376420 NW_047355 G protein-coupled receptor 15 Gpr15 __SEG__ Chr11 {Rattus norvegicus} MEPATTLFYLDYYDATSPDPRIMETPSHTSYTSVFLPVFYTAVFLTGVLGNFILMVTLHFKHRNRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSLLCKGSS
YTISVNMHCNVFLLTCMSMDRYLAIMRPTLARRLRRRSCAYAVCAVIWIISCLLGLPTLLSRGLTHIEGKPYCAEKKPTSLKLMWGLVALIATFFVPLLSIVSSYCCITR
RLCAHYQQSGKHNKKLRKSIKIIVIVVAAFTISWVPFNTVKLLAIVSGLQPESQFPSESLQQAMKVTGSLAFANSCVNPLLYYIFDSYIRRAIVRSLCPCLKIHNIGSST
ETLDSHLTKALANFIHSEDFVKRRKRSVSL*
1132 >lcl|NP_001099383.1|Plus1complement(3119684..3122173) NW_047369 extracellular leucine-rich repeat and fibronectin type III domain containing 1 Elfn1 __SEG__ Chr12 {Rattus norvegicus} MAGHGWGAPWVLVAAATLLHACGLAQGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGMLRGLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQLGSGTFAGLTKLSVCEIYSNPFYCSCELLGFLRWLAAFTNATQTHDRVQC
ESPPVYAGYFLLGQGRHGHQRSILSKLQSVCTEGSYTAEVLGPPRPVPGRSQPGHSPPPPPPEPSDMPCADDECFSGDGTTPLVVLTTLVPQTEARPSMKVKQLTQNSAT
IMVQLPSPFNRMYTLEQYNNSKSFTVSKLTQPQEEIRLTNLYTLTNYTYCVVSTSSGTHHNHTCLTICLPKPPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCL
RKRRRQEEKHKKAVAAAAGSLKKTIIELKYGPEIEAPGLAPLTQGPLLGPEAVTRIPYLPAATSDVEQYKLVESGETPKATKGNYIEVRTGEPPERRGCELSRPAPETQS
SVAEISTIAKEVDRVNQIINNCIDALKSESTSFQGAKSGAVSAAEPQLVLLSEPLASKHSFLSPVYKDAFGHGGLQRHHSVEAATGPPRASTSSSGSARSPRTFRAETAG
AHKAPATETKYIEKSSPVPETILTVTPAATVLRAEADKSRQYGEHRHSYPGSHPAEPPAPPPPPPTHEGLGGRKASILEPLTRPRPRDLVYSQLSPQYHNLSYSSSPEYT
CRASPSIWERLRLSRRRHKDDAEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
1133 >lcl|NP_001099527.1|Plus1complement(66969509..66972031) NW_047454 SLIT and NTRK-like family, member 6 Slitrk6 __SEG__ Chr15 {Rattus norvegicus} MKLRICLLYPSLLACLSLQSQSPMPPVRGSCDTLCTCEEKDGIMIINCEEKGINTLSQISVPPSRPFHLSLLNNGLTTLHTNDFSGLTNALSIHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEQSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
ACNCELLQLKNWLENMPPQSIIGDVICYSPPLFKGSILSRLKKESICPTPPVYEEHEDPAGSLLAITSSTSDSRLSSKNTSILKQPTKAPGSVPYLTKPSTQLPVPYCPV
PCNCKVLSPSGLLIHCQERNIESVSDLQPPPHNPRKLILAGNIIHTLMKADLMDYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLYKGMFLGLSSLEYLY
LEYNAVKEILPGTFNPMPKLKVLYLNNNLLHVLPAHIFLGIPLTRVNLKTNQFTHLPVSNILDDLDLLIQIDLEDNPWDCSCDLVGLQQWIHKLGKGTVTDDILCASPGH
LDKKELKALNSELLCPGLVNNPSMPTQTSYIIVTSPTMAADAAGTLLSSLTDAVPLSVLILGLLIVFITIVFCAAGIVVFVLHRRRRYKKKKVEEQLRDTSPVHLQYSMY
GHKTTHHTTERPSSSLYEQHMVSPMVHVYRSPSFGPKHLEEVEERSDKEGNDAKHLQRSLLERENHSPLTGSNMKYKVVDQSTDFLPFQDASLLYRNILDKERELQQLGI
TEYLRKNIAQLQPDVEVNYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
1134 >lcl|NP_001099548.1|Plus1complement(2348518..2349339) NW_047470 testis-specific serine kinase 6 Tssk6 __SEG__ Chr16 {Rattus norvegicus} MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGS
QARELFSQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGL
PRRQKRGVLYPDGLELSERCKSLIAELLQFSPSARPSAGQVARNGWLRAGDSG*
1135 >lcl|NP_001099620.1|Plus1complement(204567..205469) NW_047512 sprouty homolog 4 Spry4 __SEG__ Chr18 {Rattus norvegicus} MEPPIPQSGVPLNPSSVMVQPLLDSRVPHSRLQHPLTILPIDQMKTSHVENDYIDNPSLAPATGPKRPRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQ
RLLDHMAPPPVTEQASPRAVRLQPKVVHCKPLDLKGPAAPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYSTCMCLVQGIFYHCTNEDDEGSC
ADHPCSCSGSNCCARWSFMGALSLVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDTKASRSDKPF*
1136 >lcl|NP_001099686.1|Plus1complement(1905639..1906706) NW_047555 formyl peptide receptor 1 Fpr1 __SEG__ Chr1 {Rattus norvegicus} MNTNMSAVNFMNMSGSTRSVSAGYIVLDIFSYLIFALTFVLGVLGNGLVIWVAGFRMKRTVTTISYLNLAIADFCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDIN
LFGSVFLIALIALDRCVCVLHPVWAQNHRTVTLAKKVIIVPWICAFLLTLPVIIRVTTVPNRLGPGKTACALDFSPWTKDRAEKDKVAITMYTVRGIIRFILGFSTPMSI
VAICYGLIATKIHRQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVGLIRTIQIREHLRNIPQSTLTAMKITSSLAFFNSCLNPILYVFMGQDFRQRLIHSLPASLERALSE
DSAQTSDTGTNLGANSIPENPANAM*
1137 >lcl|NP_001099703.1|Plus1complement(2993577..2994275) NW_047556 hypothetical protein LOC292706 RGD1311676 __SEG__ Chr1 {Rattus norvegicus} MGVSHSSREEWERESRTDLWWAHIQEAFMKKCDFSWDQIKQLHQRFRLLSGDQPTLRPENFDNVLDLEFNPIRSRIVRAFFDNRNLGKGTSGLAEEITFQDFLTIISYFR
PLEPRPNKEEAEQYRKEKMQFLFNMYDQDGDGIITLQEYRRVVEDLLSANPQAETATVRSVANSIARVALMEASRASDQPLNEDEPYEGITFEDFFKTWQSLELEVKMQV
SFLNLQAMAFCQ*
1138 >lcl|NP_001099936.1|Plus1complement(14159247..14160374) NW_047627 protein arginine methyltransferase 6 Prmt6 __SEG__ Chr2 {Rattus norvegicus} MSLSKKRKLESGVGGAGGEGAEEENGGEQEAAPPRPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASAIWQQAQEVVRLNGLEDRVHILPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPDSAELFVAPISDQMLEWRLGFWSQVKQHYGVDMS
CMESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAIWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVP
VEQDTDISGEITLLPSRDNPRRLRVLLRYKVGDHEEKTKDFAMED*
1139 >lcl|NP_001100110.1|Plus114371693..14372970 NW_047711 G protein-coupled receptor 63 Gpr63 __SEG__ Chr5 {Rattus norvegicus} MVVSGVLTAPAVLTTPHTGTSNMTFVVYENSPMNITAPLPFQHPSPGPLLRYSLETMTSTGFSSLAVNSTVVTPAPAVFKSLNLALQIILSAIMIFILFVSFLGNLVVCL
MVYQKAAMRSAINILLASMAFADMLLAVLNMPFALVTILTTRWIFGKFFCRLSAMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKVLIAVSWATAFSVAFPLA
VGNPDLQIPSRAPQCVFGYTTNSGYQAYVILISLISFFIPFLVILYSFMGILNTLRHNALRIHSYPEGICLSQVSKLGLMSLQRPFQMSIDMSFKTRAFTTILILFAVFI
VCWAPFTTYSLVATFSKHFYYQHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKFLPRLPGHTRRRIRPSAVYVCGEHRTVL*
1140 >lcl|NP_001100127.1|Plus1complement(1637859..1639871) NW_047712 zinc finger and BTB domain containing 5 Zbtb5 __SEG__ Chr5 {Rattus norvegicus} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQSGEEPSAPMSSSMRNNLDQRTPFPMRRLHKRKQTVEERARQRLRSSMDESAISDVTPE
SGPSGVHSREEFFSPDSLKIVDNPKPDGMADNQEDSAMMFDRPFGAQEDAQMPSQSDGSAGNMASRATQVETSFEQEAVAEKGSFQCENPEVGLGEKEHMRVVVKSEPLS
SPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKTSFSISNFLNKSRGSNFSTSQSTDDNLPNTTSDCRLEGEAP
YLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPVQEVMGLPCVQTSGYQGEQFGMDFPRSGLGLHSSFSRAMMGSPRGGASNFPYYRRIAPKMPVVTSVRSSQISEN
QASSQLMMNGASSFENGHSSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSKTTCLRW
QSSNLPSTLL*
1141 >lcl|NP_001100193.1|Plus1complement(2593711..2595630) NW_047759 phosphoinositide-3-kinase, catalytic, gamma polypeptide Pik3cg __SEG__ Chr6 {Rattus norvegicus} MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLHVAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIY
DRYQVVQTLDCLRYWKMMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRLVTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIVNNCI
FIVIHRGTTSQTIKVSADDTPDTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNGEEIHLVLDTPPDPALDEVRNEEWPLVDDCT
GVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKLFTEEVLWNVWLEFGIKIKDLPKGALLNLQIYCCKTPS
LSSKASVETPGSESKGKAQLLYYVNLLLIDHRFLLRHGGYVLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQ
LRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENV
1142 >lcl|NP_001100220.1|Plus114997202..14999184 NW_047762 fibronectin leucine rich transmembrane protein 2 Flrt2 __SEG__ Chr6 {Rattus norvegicus} MGLQTAKWPSHGTFVLKFWLIMSLGLYSHVSKLLACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IADGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFANLRKLERLDISNNQLRMLTQGVFDHLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPVFTPAPSTVSPTTQSPTVSVPSPSRGSVPPAPAPSKLPTIPDWDGRERATPPISERIQLSIHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRTVEDTICSEATTHASYLNNGSNTASSHEQTTSHTMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
*
1143 >lcl|NP_001100221.1|Plus117773003..17774016 NW_047762 G-protein coupled receptor 65 Gpr65 __SEG__ Chr6 {Rattus norvegicus} MTMNSTCVEEQHDLDHYLFPVVYIFVFIVSVPANIGSLCVSFLQAKKENELGVYLFSLSLSDLLYALTLPLWINYTWNKDNWTLSPTLCKGSVFFTYLNFYSSTAFLTCI
ALDRYLAVVYPLRFSFLRTRRFAFITSLSIWILESVFNSILLWEDETSVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTFLGYAIPLVTIMICNHKVYRAVKHNQATEN
NERRRIIKLLASITLTFILCFTPFHVMVLIRCILERNVNFNNKTGKQTFTVYRITVALTSLNCVADPILYCFVTETGRSDMWNILKVCARKRNRSRGQKRDILSVSTRDT
IELEIIE*
1144 >lcl|NP_001100342.1|Plus1complement(1494464..1495534) NW_047804 chemokine (C-C motif) receptor 1-like 1 Ccr1l1 __SEG__ Chr8 {Rattus norvegicus} MESPAVTESSYNTVAMNDFFSGFVCFSINVRAFGITVLTPLYSLVFVIGVIGNVLVVLVLIQRKRLRNMTSIYLFNLAVSDLVFLFTLPFWVDYIVKGDWVFGNAMCKFL
AGFYYLGLYSDMFFITLLTIDRYLAVVHAVFALRARTVTFGIISSIITWVLATLVSIPCLYFFKTQLEFTYQTCRAVLPKKSLIQFLRFQALTMNILGLILPLLAMIICY
TRIINVLHRRPNKKKAKVMRLIFVITLLFFLLLTPYYLAAFVSAFEDVLFTPGCVRSQQVDLALMITEALAYTHCCVNPVIYVFVGERFRKYLRQLFWRRTAVSLPKWLP
FHSVDRVQRSSSTSPSTGEIEVSADL*
1145 >lcl|NP_001100376.1|Plus18349551..8350672 NW_047814 G protein-coupled receptor 45 Gpr45 __SEG__ Chr9 {Rattus norvegicus} MACNSTPIGTYQHLLLNASNTLDPGATPLSAPLRISLAIMMLLMIVVGFLGNTVVCIIVYQRPAMRSAINLLLATLAFSDIMLSLCCMPFTAITLVTVRWHFGDHFCRLS
ATLYWFFVLEGVAILLIISVDRFLIIVQRQDKLNPRRAKVIIAASWVLSFCISAPSFTGWTFMEVPARAPQCVLGYTEFPAERAYVVTLVVAVFFAPFGVMLCSYLCILN
TVRKNAVRVHNQSDSLDLRHLSGAGLRRLRRQQQQASLDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSAFSRRFYYSASFYTTSTCVLWLSYLKSVFNPIVYCWRIK
KFREACIELLPQTFQILPKVPERIQRKIQPSTVYVCNENQSTV*
1146 >lcl|NP_001100408.1|Plus17057149..7058156 NW_048043 G protein-coupled receptor 174 Gpr174 __SEG__ ChrX {Rattus norvegicus} MTDNFTCNKTDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVVFMINLAIADLLQILSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLV
CISVRRFWFLMYPFRFNDCKQKYDLYISIVGWLIICLACLLFPLLRTNDDTPGNRTKCFVDLPIRNVNLAQSVAMITIGEVVGFITPLMIVLYCTWKTALSLQNKYPISQ
HLGEKKKALRMILTCAAVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFTTNEFRRRLSRQELPDSIQLQTKSYKIVNNHGASPT
AAELC*
1147 >lcl|NP_001100409.1|Plus16942760..6943818 NW_048043 hypothetical protein LOC302377 RGD1560455 __SEG__ ChrX {Rattus norvegicus} MGSNSTSTAESNCNATNLTFQNSLYATTYIFIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYINHHWPFQRALCLLCFYLKYLNMYASIF
FLTCISLQRCLFLLKPFRARNWKRRYDVGISAAVWIIVGTACLPLPILRSAGLANNSESCFADLGLHDISMASSIGMVTAAELGGFVLPVVIITYCTWKTRKSLQEFQDP
PQNIKERKKALRMVLMCAVVFIVCFTPYHLNFPFFMMVKQRVFSNCSFIKSTLYFHIISLCLANLNCCLDPVVYYFMTSEFRDQFSEHGNLVIQSCLRCKDSTLEIRQRK
ENLQTISLECLDVPTQCDEMAV*
1148 >lcl|NP_001100410.1|Plus16704774..6705886 NW_048043 lysophosphatidic acid receptor 4 Lpar4 __SEG__ ChrX {Rattus norvegicus} MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSASLFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTL
CKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILN
VSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINTHIRM
ESLFKTETPLTPKPSLPAIQEEVSDQTTNNGGELMLESTF*
1149 >lcl|NP_001100726.1|Plus1817542..818852 NW_047452 suppressor of cytokine signaling 4 Socs4 __SEG__ Chr15 {Rattus norvegicus} MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSRKSESCSESEAVGTLESVEIPLRSQERELSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIRNCGARHS
PGLPSKRTIHISELMLDKCPFPPPSDLAFRWHFIKRHTVALSSSSDEWVSTDLCERRPRDAQLKRRSTEDDIPCFSHTSVQPCVITTNSASCAGGHVTGSLMNLVTDNSM
EDGDMDSEDEIITLCTSSRKRNKPRWETDDGILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHA
RIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYLKEYHYKSKVRLLRIDVPEPQ*
1150 >lcl|NP_001100753.1|Plus1complement(65069042..65071132) NW_047454 SLIT and NTRK-like family, member 1 Slitrk1 __SEG__ Chr15 {Rattus norvegicus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKINGQDEHATPGAVPNGGTKIPGNWQLKIKPTPPIATGSA
RNKPPVHGLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRRSHFVDYKNLILLDLGNNNIANIENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYAKISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
1151 >lcl|NP_001100754.1|Plus168269537..68272413 NW_047454 SLIT and NTRK-like family, member 5 Slitrk5 __SEG__ Chr15 {Rattus norvegicus} MHVCCPPVTLEQDLHRKMHSWMLHTLAFAVTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLENLEYLQVDYNYISVIEPNAFGKLHMLQVLILNDNLLSGLPNNLFRFVPLTHLDLRGNRLKLLPYVGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKP
PKGTRQPNKPRVRPTSRQPSKDLGYSNYGPSIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYITVVRRTDFLEATGLDLLHL
GNNRISMIQDRAFGDLGNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNQLQAMPSGVFSGLTLLRLNLRSNSFTSLPVSGVLD
QLTSLIQIDLHDNPWDCTCEVVGMKLWIEQLKVGVLVDEVICKAPKKFAETYMRSIKSELLCPDYSDVVVSTPTPSSIQLPSRTNAAATPAVKLNSTGTPAGLGAGTGAS
SVPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGGGGGGGGHPHAHVHHRGSALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSR
EGNSVEDYKDLHELKVTYSSNHHLQQQQPPPPQQPQQQPPPQLQLQPGEEERRESHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGSSLPEYPKF
PCSPAAYTFSPNYDLRRPHQYLHPGAGESRLREPVLYSPPGAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF*
1152 >lcl|NP_001100796.1|Plus1complement(2326100..2328001) NW_047476 kelch repeat and BTB (POZ) domain containing 11 Kbtbd11 __SEG__ Chr16 {Rattus norvegicus} MENSVAPFVLYPGTEPRTPGEDSLPLPAEEEGAASPAQTPCSLSASLCFSSGDDSPPQSRASAAEGSEASPPSLRSDLRVVETQWDVSSAASPESPQECARPEEPASPEE
PPSRREHARPVELESLDELGEPVPVPPGVGSEHGEPDLVIEVAGRRLRAHKAVLAARSDYFRARASRDVLRVQGVSFTALRLLLADAYSGCMAGVRPDNVAEVVAGARRL
QLPGAAQRATEAMAPQLSLDNCYEVLSAGKRQRLSELRDAAYRFMCDHYLEVLREPAVFGRLSGAERDLLLRRRLGTGRACLLAAALGTTGERSGSRPQSPSGDAESRGD
AAVYCYQAEAGEWRELTRLPEGAPARGCGLCVLFNYLFVAGGVAPAGPDGRARPSDQVFCYNPVTDCWSTVRPLRQARSQVQLLALDGHLYALGGECLLSVERYDPRADR
WTAVAPLPRGAFAVAHEAATCNGEIYVSGGSLFYRLLKYDPRRDEWQECPCSSSRERSADMVALDGFLYRFDLCGSRGDAQAATGSGGGVSVFRYHCLAKQWSQCAAHLR
PPGAPAGLQPFRCVALDGTIYCVSRAGTWRFVPSQDTEAGSDMGPGGSFEPEPLGSPLDVRGVLFPFVLNLPEKPDRGEQGAA*
1153 >lcl|NP_001101147.1|Plus1complement(34925689..34926753) NW_047625 G protein-coupled receptor 87 Gpr87 __SEG__ Chr2 {Rattus norvegicus} MNVSPFSGNELYSQASHTANSTIEGHGKNSTHHNEFDTIILPVLYLVIFVASILLNGLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILC
RYTSVLFYANMYTSIVFLGLISVDRYLKVVKPFGDSRMYSITFTKVLSICVWVIMAVLSLPNIILTNGQPTKENIHDCMKLKSPLGAKWDMAVTYVDSCLFVAVLVILIG
CYIAISRYIHKSSRQFISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDDSAHKILHYCKEMTLFLSACNVCLDPIIYFFMCKSFSRRLFKKSNIRTR
SESIRSLQSVRRSEVRIYYDYTDV*
1154 >lcl|NP_001101153.1|Plus1complement(50061055..50063994) NW_047625 SLIT and NTRK-like family, member 3 Slitrk3 __SEG__ Chr2 {Rattus norvegicus} MKPTITEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGN
NALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHI
GRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSSN
KQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRTPENLTHRDVRTIELEVLCPEMLHIAQPGPSPPQSGDYHPNGGPTSASPYDFSPPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDSGGSGGGSGSGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAASAAQ
DTGATDRGGPGTQPPGMGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSNSQLNTIVTVNHHHPHPHHSAVGGVSGVGGGTGGDLAGFRHHEKNGGVVLFPPGGGC
GGGSLLLERERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTPKSDYLDLRAKLQTKPDYLEVLEKTAYRF*
1155 >lcl|NP_001101185.2|Plus1complement(11955622..11956971) NW_047627 G protein-coupled receptor 61 Gpr61 __SEG__ Chr2 {Rattus norvegicus} MESSPIPQSSGNSSTLGRALQTPGPSTASGVPELGLRDVASESVALFFMLLLDLTAVAGNAAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHALF
GEVACRLYLFLSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVGVWVKALAMASVPVLGRVYWEEGAPSVNPGCSLQWSHSAYCQLFVVVFAVLYFLLP
LILIFVVYCSMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAHQTTPHRTFGGGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSAQPISTGQVENVVTWIG
YFCFTSNPFFYGCLNRQIRGELSKQFVCFFKAAPEEELRLPSREGSIEENFLQFLQGTSENWVSRPLPSPKREPPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLR
PAPSPRLES*
1156 >lcl|NP_001101223.1|Plus123812228..23814150 NW_047657 leucine rich repeat containing 4C Lrrc4c __SEG__ Chr3 {Rattus norvegicus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
1157 >lcl|NP_001101396.1|Plus1complement(26790058..26791878) NW_047711 hypothetical protein LOC313156 RGD1310773 __SEG__ Chr5 {Rattus norvegicus} MLHTAIPCWQPFLGLAMVLLFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSINPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLGYISHRALQWTI*LGAAHPGEVQLDSGTNRSPFPSPQPHHPASEASQYQQYACVC
L*KIIPPETTRDRLLAIAGYDASQ*PLWSQPHIPLDH*HQPVHCPFPRL*TPCIPDPP*PLLQSHQHY*SRHVL*PDPPTGASCSRGPAPHH*TSLLPRAPLPPRAQCIS
EPAGNIGRECLLFP*GFGGPEH*Q*PTSVRLPTSLAPAATGHPAVWRPAAHVCRARHHT*EVI*GFP*HCSFFLFYLQKTQNP*KEVTAPPSGRRTDGPAGVQRGWRPPA
RDFLGDTSKAFYHHQVQRKGHCVG*WHLRNPFRPGSRQWDVCLHS*QCCWE*HLHGISHCEGIHFRPLPLRKQDPYVHD*LQ*HRFQRH*CQYFFPGP*NNTGIYSHGLF
HIPGSGFILFSPSFCVEPRKGQTQKQH*P*VCAPKKQWCCCRRGGGWTQEVQHENDI
1158 >lcl|NP_001101414.1|Plus1complement(5751881..5753734) NW_047715 kelch-like 9 Klhl9 __SEG__ Chr5 {Rattus norvegicus} MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGEEIFPVHRAMMASASDYFKAMFTGGMKEKDLMCIKLHGVNKVGLKKIIDFI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCSELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWKSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
1159 >lcl|NP_001101519.1|Plus1complement(20476004..20477131) NW_047762 G protein-coupled receptor 68 Gpr68 __SEG__ Chr6 {Rattus norvegicus} MRSKAPSGPKMGNITTENSSLPCPIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTIADLFYICSLPFWLQYVLQHDNWSHGDLSCQVCGIL
LYENIYISVGFLCCISIDRYLAVAHPFRFHQFRTLKAAVGVSVLIWAKELLTSIYFLKHKEVIEDEDRHRVCFEHYPIQAWQRGINYYRFLVGFLFPICLLLASYQGILR
AVRRSHGTQKSRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSLWESSCDFAKSIFNIYHFSLLLTSFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTSRAREAY
PLGAPEASGKSGAQGEEPELLTKLHSAFQTPNSLGLGGPPTVGLA*
1160 >lcl|NP_001101545.1|Plus19692022..9693263 NW_047773 sphingosine-1-phosphate receptor 4 S1pr4 __SEG__ Chr7 {Rattus norvegicus} MSNNRKPRPGCDSTLPGAALSLSPGKAMNISTWSTLVTPESCHRLAASGHSLLIVLHYNHSGRLASRGGPEDNGGLGMLRGPSVAAGCLVVLENAMVLAAIAIHMRSRRW
VYYCLLNITLSDLLTGLAYVVNVLLSGTRTFQLSPVHWFLREGLLFMALAASTFSLLFTAGERFATMVRVAESGATKTSRVYGCIGLCWLLAATLGLLPLLGWNCVCAFQ
RCSSLLPLYSKGYVLFCVVVFALILVTILSLYGAIFRVVRANGQKSPRPPARRKSRRLLNTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMDWILALAVLNSA
INPLIYSFRSREVQHAVLTFLCCGCLRLGLRGPGDCLTRITEAHSGASTTDSSLRPRDSFRTSRSLSFKMREPLSSVSSIRSA*
1161 >lcl|NP_001102210.1|Plus121366405..21367385 NW_047773 cytoskeleton-associated protein 4 Ckap4 __SEG__ Chr7 {Rattus norvegicus} MKVASLEESKGDRSQDVKVLKEAVKEVQASMKSRERDIEALKSSLQTMESDVYTEVRELVSLKQEQQAFKQAADSERLALQALTEKLLQSEESSSRLPEDIRRLEEELQQ
LKVGAHGSEEAVVFRDSKAFDELQKQMEGLGARLQYVEDGVYSMQVASASHTESLESLLSKSQEYEQRLAMLQEHVESLGPISDLASTVRSLEETQLALSSDLKGLKQGL
GELPGTVESLQEQVHLLLSQDPAQAAGLPPQDFLDRLSSLDNLKSSVSQVESDLKMLRTAVDSLVAYSVKIETNENSLESAKGLLDDLRNDLDRLFVKVEKIHEKI*
1162 >lcl|NP_001102382.1|Plus1complement(2141328..2142287) NW_047557 free fatty acid receptor 3 Ffar3 __SEG__ Chr1 {Rattus norvegicus} MDTSFFPGNHWLFFSVDLLVFLVGLPLNVMALVVFVNKLRRRPVAVDLLLLNLTISDLLLLLFLPFRIVEAACGMKWILPFIFCPLSGFLFFTTIYLTSLFLMTVSIERF
LSVAYPLWYKTRPRLAQAGLVSGICWFLASAHCSVIYVTEYWGNATYSQGTNGTCYLEFREDQLAILLPVRLEMAVVLFMVPLCITSYCYSRLVWILSQGASRRRRKRVM
GLLVATLLIFFVCFGPYNMSHVVGYVRGESPTWRSYVLLLSTLNSCIDPLVFYFSSSKFQADFHQLLSRLIRACVPWTQEVSLELKVKNGEEPSKECPS*
1163 >lcl|NP_001102532.1|Plus1complement(3737307..3738308) NW_047369 G protein-coupled receptor 146 Gpr146 __SEG__ Chr12 {Rattus norvegicus} MWSCGPLNSTAWAEEPLCRNLRLGLWVLSLFYLGAGVPVGLGYNALLVLANLASKNSMTMPDVYFVNMAVAGLVLTALAPAYLLGPAHSRWALWSLSSEAHVTLLILFNV
ASLVTMYSTALLSLDYYIERALPRTYMASVYNTRHVCGFVWGGAVLTSFSSLLFYICSHVSSRIAECARMQNTEAADAILVLIGYVVPGLAVLYALALISRIGKEDTPLD
QDTSRLDPSVHRLLVATVCTQFGLWTPYYLSLGHTVLVSRGRTVEGHYLGILQVAKDLAKFLAFSSSSVTPLLYRYINKAFPSKLRRLVKKIHCGRRHCSPDPAGIQQVM
AQA*
1164 >lcl|NP_001102533.1|Plus1complement(5324883..5325728) NW_047369 sprouty homolog 3 Spry3 __SEG__ Chr12 {Rattus norvegicus} MATDDPQPILPIAQLRSVHASNDYVDRPPAPRKPTLSSPSLTLQTHKSDWSLATTPTALPRSVSQCHQLQPLPQHLSQSSIASSVSQTTTASDQRLLATMTPSPSGPSSI
LRTHPKVDGALKGGAEQSAGQSSDHRLFICEECGRCKCVPCTAVRPLPSCWVCNQRCLCSAESLLDYGTCLCCVQGVFYHCSTDDEDNCADEPCSCGPGSRFLRWAAMGV
ISVFLPCLCCYLPTRGCLRLCQRGYDSLRRPGCRCKMHTNTVCRKMSSGGSPCPKAQEKSV*
1165 >lcl|NP_001102566.1|Plus14998761..5000383 NW_047431 G protein-coupled receptor GPR75 Gpr75 __SEG__ Chr14 {Rattus norvegicus} MNSSAPLQNVPNATLLYTPPLQGGNNTSLQEGLRDFIHTATLVTCTVLLAIIFCLGSYGNFIVFLSFFDPAFRKFRTNFDFMILNLSFCDLFICGATAPMFTFVLFFSSA
RSIPDSFCFTFHLTSSGFIIMSLKMVAVIALHRLRMVMGKQPNCTASFSCILLLTLLLWATSFTLATLATLRTSKSHLCLPMSSLMDGEGKAILSLYVVDFTFCVAVVSV
SYIMIAQTLRKNAQVKKCPPVITVDASRPQPFMGASVKGNGDPIQCTMPALYRNQNYNKLQHNQTHGYTKNANQMPIPSASRLQLVSAVNLSTAKDSKAVVTCMVIVLSV
LVCCLPLGISLLQVVLSDSGSFILYQFELFGFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLRYTGLGFLCCKQKTRLRAMGKGNLEINRNKSSHHETNSAYMLSPKPQKK
FVDQACGPSHSKESVASPKVSAGHHPCGQSSSTPINTRIEPYYSIYNSSPSQQESSPANLQPVNSFGFASSYIAMHYYTTNDLMQDYDSTSAKQIPIPSV*
1166 >lcl|NP_001102593.1|Plus11688289..1690688 NW_047511 protocadherin beta 2 Pcdhb2 __SEG__ Chr18 {Rattus norvegicus} KEAGEEMEQILKKRQVLLFFVLLGIAQAGSTIRRYSVEEEAENGFFVANLLKDLGLEVEELAERGPRVISKGKKLNLEFNRQTGDLLLREKLDREELCGPAEPCVVPFQV
LLGNPLEIFQAELQIRDINDHSPVFLDKKIILKISEITAPGTTFLIERAQDLDVGSNSLQTYSISPNFHFHLNLQDSPDGTVLPQLVLDKVLDREERSEIRLILTALDGG
NPPRSGTVHILIEVLDINDNAPAFSKLRYEVQVPENSPVGSQVATVSAKDLDIGDNGQITYAFSQASEDIRKTFRMNATSGEILLVKTLDFESIQAYTVYVQATDGGGLS
GSSVVFVQVKDLNDNPPELTMSTFTNHIPENAPETVIAVFSVADPDSGDNGKMVCSIQEDLPFVLKPSVENLYTLMTNTALDRETRTQYNITITVSDMGTPRLTTQHTIA
VYVSDINDNAPAFTQTSYTIFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPQDPQLALNSLISINADNGQLFALRALDYEALQAFEFHVSAVDGGLPALSSQAPVR
LVVLDDNDNAPFVLYPLQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLGERDVLKHRLLLLVKDNGDPPRSASVTL
HVLLVDGFSQPYLPLPEVARDAAQDENALTLYLVIALASVSSLFLLSLLLFVGVRLCRRDRATSLGGCSMPEGHFPGHLVDVGGAGTLSQSYQYEVCLSGDTRTPDFKFL
KPIIPNFLLQNSERENDTNPSYRNSFEFS*
1167 >lcl|NP_001102630.1|Plus1complement(18295351..18297375) NW_047563 fibronectin leucine rich transmembrane protein 1 Flrt1 __SEG__ Chr1 {Rattus norvegicus} MVVAHPAATATTTPAATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPSDIPDDATTLYLQNNQINNAGIPQDLKTKVKVQV
IYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKG
LNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPW
FCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFEAGSQGSAANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLV
IQVKPLTADSIRITWKAMLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETGNTYVADETPVCAKAETADSYGPTTTLNQEQNAGPMAG
LPLAGIIGGAVALVFLFLVLGAICWYVHRAGELLTRERVYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRSKEEYVVHTIFPSNGSSLCKGAHTIGYGTTRG
YREGGIPDVDYSYT*
1168 >lcl|NP_001102632.1|Plus119996974..19998527 NW_047563 zinc finger and BTB domain containing 3 Zbtb3 __SEG__ Chr1 {Rattus norvegicus} MEFPEHSQQLLQSLREQRSQGFLCDCTVMVGSIQFLAHRAVLASCSPFFQLFYKERELDKRDLVCIHNEIVTAPAFGLLLDFMYAGQLALRGDTPLEDVLAAASYLHMND
IVKVCKQRLQARALAEADSTKKEEETNPASLEFLSGSSRGPQPLLASVEPSVRWSKEEWKGPATPLPIAHPADGPPVSGGADTTQPSMEVDSSHLRAPPPPVADVSVSLA
SPSSSTETTPVNYFSSGLPTVSVEPLTPLDVVPESLRVVEPRDTGGPLQGFYPPAPAPPPAPAPVLSQATAPVEAELVQVKVEAIVISDEETDLSEEQPQGSEGLFPSGG
AMYGGQPSQAEAFEEPGATGLEEVGPSDHFLPPEPHLPYHLLPGPGQYHRGLVTSPLPAPPALHEPLYPPSEYEAAQGSFGSFTEDVPTCKTCGKTFSCSYTLRRHATVH
TRERPYECRYCLRSYTQSGDLYRHIRKAHNEDLAKRSKPDPEASTILGVQPLSGSQTTERHSGGGGPPKDFVLGPKN*
1169 >lcl|NP_001102643.1|Plus1complement(3097672..3098955) NW_047615 G protein-coupled receptor 150 Gpr150 __SEG__ Chr2 {Rattus norvegicus} MEDPFSPSTLSPVSNLSLPIRQSWGLNLTSKQGTSVPGPQPPPRWPPSHRIHLVFLGIILAASVAGNTTVLCRLCGSSSRPWLGPKRRKMDFLLVQLAAADLYASGGTAL
SQLAWELLGDPRPALGNLACRLSQLLQTSGRGASAHLVALIALERQLAVRGPQGPQLPARALTTLSWLLALLLALPPTFVVRWEAPPSSTASAWPGEHRCHDIFAPLPRW
HLQVYALYEAIVGFAAPVAILGVSCGHLLCVWWRRGSQASVAGMPWSASMARASLPSALPRAKVQSLKMSLALALLFVGCDLPYFAARLAAAWSSGHRGDWEGESLVAAM
RVVEVANSAVNPLVYLFFQTGDCRLWRRLRRRIGVLCCVQEEEAEISGGAGDHQALHRHRWPHPHYHHARREERDQGGLRPPPPRPRPLPCSCESAF*
1170 >lcl|NP_001102701.1|Plus1765877..766656 NW_047691 leucine rich repeat containing 61 Lrrc61 __SEG__ Chr4 {Rattus norvegicus} MEPPGEKPGEAEALIITPQLLKSHSGEFALDSILLLKLRGLGVVDLGCLGECLNLEWLDLSGNALTHLGPLASLHQLAVLNVSNNRLTGLEPLAACENLQSLNAAGNLLT
NPGQLQCLAGLQGLEHLRLRDPLARLSNPLCVNPSYWAAVRELLPGLKVIDGERVSGRGSELYQLCRDLDSSLRSSTSLGPRAIEVQPWVEPGYWESWPIRSSSILEEAC
RQFQDTLQECLDLDRQASDSLAQAQQALRPAKTTSSFVF*
1171 >lcl|NP_001102744.1|Plus18894609..8896219 NW_047754 suppressor of cytokine signaling 5 Socs5 __SEG__ Chr6 {Rattus norvegicus} MDKVGKMWNNFKYRCQNLFSHEGGSRSENVDMNANRCLSVKEKSVSLGEAAPRQQSSPLRENIALQLGLSPSKTFSRRNQNCAAEIPQVVEISIEKDSDSSATPGTRLAR
RDSYSRHAPWGGKKKHSCSTKTQSSLDTEKKFGRTRSGLQRRERRYGVSSMHDMDSVSSRAVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPF
PAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDGSAIPQTNCDSEEDSTT
LCLQSRRQKQRQVSGDSHSHISRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFD
AHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK*
1172 >lcl|NP_001102784.1|Plus1complement(7166441..7168453) NW_048032 zinc finger and BTB domain containing 33 Zbtb33 __SEG__ ChrX {Rattus norvegicus} MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRADLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTVQDGTAETLPSSSNDKSPEIEKSKDEAQDNGAPVMPIITESFSLSAEDYEMKKIIVTDSDDDDDDDVIFCSEILPAKEDLPSNNTATQVQP
NPASVAISEVTPCTSSNSPPVTNITPPQLPTPVNQSTLSQAQGSEELLVSSASTHLTPNIILLNQAPLTAPPSVSSSLPNHMSSSVNVLVQNQQAPNSAVTGNKAEEEEE
ILDDDDDIISSSPDSAVSNTSLVPQADASKSTTFDGSLTQKMQAPILPQEPPSNSLKISDVITRNTNDPGLRSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYD
IVIPVKDDPDGGEAKLENELPKTSGSEPSNKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYQCRYCDKVFPLAEYRTKHEIHHTGERRYQCL
ACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCKSLQIRQYAYLSNKPSAMPVMKDDAVGYKVDAGKEPPVGTTSAPPQNKSTFWEDIFIQQENDSIFKQNVTDGST
EFEFIIPESY*
1173 >lcl|NP_001102786.1|Plus1complement(5848511..5850100) NW_048040 retinoic acid induced 2 Rai2 __SEG__ ChrX {Rattus norvegicus} MDDLQSQNLSMDMTDSPPTLANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNA
TYVMTTQGPVQLPVVLEQHVFQHLNSPLVLPQEAPCSSNAIHNNLFQGAEDSEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPTQGSLGPPPCQPPPGYAPVPPQPFSSP
LSPLVPPATLLVPYPVIVPLPVPVPIPIPVPVPQSSESKFSPSFPKPPSSFGLHSFKGTQTTLEKDELKPLDILQPKEYFQLSRHTVIKMGGENEALDLSMKSVPWLKAG
EASPPVFQEDAALDLSLAAHRKAEVPPETLYNTSGSADIQGHTLLEKRPSGMEMPFAPAKSREASAMMDSHSSSSNGTEMVSQPIHPGSELKPENNIEIVSESQAAKVIV
SVEDAVPAIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQEDESLGNTEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
1174 >lcl|NP_001102801.1|Plus17860661..7860939 NW_047626 dolichyl-phosphate mannosyltransferase polypeptide 3 Dpm3 __SEG__ Chr2 {Rattus norvegicus} MTKLTQWLWGLALLGSAWAALTMGALGLELPLPCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQILEARADLARKGLRF*
1175 >lcl|NP_001102825.1|Plus1complement(28850804..28851838) NW_047696 immunoglobulin (CD79A) binding protein 1b Igbp1b __SEG__ Chr4 {Rattus norvegicus} MAAFMDEQQKPKLRELLETGIELLEEVEATTQPTGSKQIQEKVRKALKLLEKASEMLSQLDLFSRNEDWEEIASADLKYLMLPALKGALTLKLVGTSNRLHLLQDARELF
MNFLTQSHNYHVAEFQLPWAQSSSQESNPAAATSDTLEHNLVAMASQRQAKIQRYKQKKAVEQRLSSLKSAVESGEADDERVREYYLLQLRRWINISLDEIDSIDQEIEI
LRERDSFGEASVSQGSPQERPPLKPFVLTRSVAQAQVFGAGYPSLATLTVNDWYEQRQKGEVSSSVREAEKQAPPLETLSVSEPEKPDLEQKEEEDENALHRMQEWDDWK
DTHPRGYGNRQNMG*
1176 >lcl|NP_001102844.1|Plus14947570..4949141 NW_047694 leucine rich repeat transmembrane neuronal 1 LRRTM1 __SEG__ Chr4 {Rattus norvegicus} MDFLLLGLCLHWLLRRPSGVVLCLLGACFQMLPAAPSGCPGQCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQ
KLRRVKELTLSSNQITELANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHND
LIKVNFAHFPRLISLNSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPYLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLS
NFQGRYDANLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAAVTNRSDLAPPESSATTLVDGGEGLHDSTLEPITVAIPGGEHAENAVQIHKVVTGTMALIFSF
LIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV*
1177 >lcl|NP_001102852.1|Plus1complement(3750114..3752135) NW_047333 vasorin Vasn __SEG__ Chr10 {Rattus norvegicus} MHSRSCLPPLLLLLLVLLGSGVQSCPSGCQCNQPQTVFCTARQGTTVPRDVPPDTVGLYIFENGITTLDVGCFAGFPGLQLLDLSQNQITSLPGGIFQPLVNLSNLDLTA
NKLHEISNETFRGLRRLERLYLGKNRIRHIQPGAFDALDHLLELKLPDNELRVLPPLHLPRLLLLDLSHNSIPALEAGILDTANVEALRLAGLGLRQLDEGLFGRLRNLH
DLDVSDNQLGHMPSVIQGLRGLTRLRLAGNTRIAQIRPEDLAGLTALQELDVSNLSLQALPSDLSSLFPRLRLLAAARNPFNCLCPLSWFGPWVRESHVVLASPEETRCH
FPPKNAGRLLLELDYADFGCPVTTTTATVPTIRPTVREPTPSTSSQAPTWPSPTEPTTQAPIVLSTAPPTMRPAPQPQDCPASICLNGGSCRVGAKHHLECLCPEGFIGL
YCESPVEQRTKPSSIPDTPRPPRLLPLRIEPVSPTSLRVELQRYLQGNTVQLRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSICVTALGAGRTPEGEEA
CGEANTPQAVRSNHAPVTQAREGNLPLLIAPALAAVLLAVLAASGAVYCVRRARASSTAQDKGQVGPGTGPLELEGVKVPLEPGSKASEGGGEALSGGPECEVPLMGYPG
PSLQGVLPAQPYI*
1178 >lcl|NP_001102860.1|Plus11793296..1795692 NW_047511 protocadherin beta 9 Pcdhb9 __SEG__ Chr18 {Rattus norvegicus} MHFPIMEKLRKIHLNRQVMLFIFMMALVLVCSEATTRYSILEETESGSFVAHLAKDLGLGAGELAARSARVVSDDYKQRLLLDPETGDLILREKLDREELCGSLDPCVLP
FQVSLEKPVQYFQGELLIQDINDHAPEFPDRELLLKIPENSQPGTRFSLKLAQDLDVGNNGLQEYRVSTNPHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLTLIAL
DGGSPPRSGTALVRILIIDINDNAPEFVNSPYEVQVLESCPPDSPILTVLARDADAGNFGSVSYGLFQASDEIQQTFSINETTGDMRLKKKLDFEKIKSYHVEIEATDGG
GLSGRGSVMIEVLDVNDNAPELTISSLTSSVPENAPETIISIFRVGDRDSGENGKAVCSISENLPFILKSTFKNFYTLVTESPLDRESRAEYNITISVSDLGTPRLTTQH
TITVQVSDINDNAPAFTQTSYTMFVRENNSPALHIGTISATDADSGSNAHITYSLLPPQNPQLALVSLISINADNGQLFALRALDYEALQAFEFYVGATDQGSPALSSQA
LVHVMVLDDNDNAPFVLYPLQNASAPCTELLPRAAEPGYLITKVVAVDCDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTTRLLSERDVPKHRLLLLVKDNGDPARSAT
VTLHVLLVDGFSQPYLPLPEVARNAVQEDDDALTLYLVIALASVSSLFLLSVLLFVGVRLCRRGREVSLGGCSIPDGHFPGHLVDVSGAGTLSQSYQYEVCLRGDSGTGE
FKFLKPMVPNAGIEIMESPHCRESFVFN*
1179 >lcl|NP_001102861.1|Plus1complement(4944448..4945527) NW_047626 mab-21-like 2 Mab21l2 __SEG__ Chr2 {Rattus norvegicus} MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTG
KQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALESAAKQTWRLAREILTNPKSLDKL*
1180 >lcl|NP_001102865.1|Plus11899765..1902164 NW_047511 protocadherin beta 20 Pcdhb20 __SEG__ Chr18 {Rattus norvegicus} MGNRKTIILQKRQVLVFFVLLGLSRASAESLRYSVAEETEIGSFVANLARDLGLGVAELSSREARIVSDDNKKHLLLNLLTGDVLLSERLDREELCGSTEPCVLPFQVVL
EDPLQFYRAELHVRDINDHAPTFLDKEITIKIPESAAIGATFLIENAQDLDIGSNSLQDYSISPSSHFYVKIHESGDGKIYPELVLDKALDHEEESELRLTLTALDGGSP
PRSGTTLVLIKVLDINDNAPEFAQNFYEVQVPEDTPIGSSIITISAKDLDMGNYGKISYSFLHATEDVRKTFEINPTSGEVNLRSLLDFEVIQSYSVTIQATDGGGLSAK
CTLSVKVLDINDNAPEVIISSVTKTIPENASETLITLFSVRDQDSGDNGRILCSIPDDLPFILKPTFKNFFTLLSEKALDRESRAEYNITITVSDLGTPRLTTQHTITVQ
VSDINDNAPAFTQTSYTMFVHENNSPALHIGTISATDSDSGSNAHITYSLMPPRDPQLALDSLISINADNGQLFALRALDYEVLQAFEFRVGATDRGSPALSSQALVRVV
VLDDNDNAPFVLYPLQNASAPYTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTSRLLSERDAPKHKLLLMVKDNGDPPRSASVMLHV
LVVDGFSQPYLPLPEVAHNPAHDEDTLTLYLVIALASVSSLFLLSVLLFVGVRLCKKARAASLGGCSVPEGHFPGHLVDVTGTGTLSQNYQYEVCLTGSTGTNEFKFLKP
VMPSLQLQDPDSNMLVKENFRNSLGFNIQ*
1181 >lcl|NP_001102967.1|Plus131363765..31364844 NW_047625 mab-21-like 1 Mab21l1 __SEG__ Chr2 {Rattus norvegicus} MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAG
KQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALENAAKQTWRLAREILTNPKSLEKL*
1182 >lcl|NP_001102979.1|Plus1complement(1427969..1429159) NW_047785 G protein-coupled receptor 84 Gpr84 __SEG__ Chr7 {Rattus norvegicus} MWNSSDDNFSCYHESVLGYRYFAVIWGMVVAATGTVGNVLTLLALAIRPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGAIFCRIFGLLLFTSNSVSILT
LCLIALGRYLLIAHPKLFPQVFSAKGIVLALVGSWVVGVTSFAPLWNVYVLVPVVCTCSFDRVRGRPYTTILMGIFFVVGLSSVGVFYCLIHRQVKRAARALDKYGLQEA
SMRSHQVSGTHEAVPGHFQELDSGLASRGPSEGISSEPVSAATTQTLEGDSSEAGDQGMRKAAQQISERSLPEVHRKTGGAAGARRATDAPSEFGKVTRMCFAVFLCFVL
SYIPFLLLNILDARGRAPRVVHMVAANLTWLNSCINPVLYAAMNRQFRQAYGSILKRGPQSFRRFH*
1183 >lcl|NP_001102980.1|Plus1complement(34847324..34848304) NW_047625 G protein-coupled receptor 171 Gpr171 __SEG__ Chr2 {Rattus norvegicus} MTNSSMFCPIYRDLEPFTYFFYLVYLIGIIGSCFATWAFIQKSTNHRCVSIYLINLLTADFLLTLALPVKIVVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSI
DRCLQLVHSCKIYRIQEPGFAKMISAVVWLMVLLIMVPNMVIPIKNIKEKSNVGCMEFKREFGKNWHLLTNFICVAIFLNFSAIILISNFLVIRQLYRNRDNANYPSVKS
ALLNILLVTASYIICFVPYHAVRIPYTLSQTEVISDCSTRIALFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVTETFASPQKMKAREEKPRRENDVQSTGSAC*
1184 >lcl|NP_001102994.1|Plus1complement(8710457..8712322) NW_047399 choroideremia-like (Rab escort protein 2) Chml __SEG__ Chr13 {Rattus norvegicus} MADKLPTEFDVVIIGTGLPESILAAACSRSGQRVLHVDSRSYYGGNWASFSFTGLLSWLKDYQQNHDSEGDVTGTWQDLIDETEEAIALCKKDETIQHTEVFCYASQDVE
DSMQETDPLQKSPSPEASATPADSLDTASLPKERHSEDCTSYEAPSRRTEGSDGAVSLSSADAQDSLEKEKFCGDETGMHTVSDGEEGEHKLAAEDNVGQPKRNTITYSQ
MVKESRTFNIDLVSKLLYSQGSLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKFLTFCLDYEQHSDEYQDFKQCSFSDYLKTKKL
TPNLQHFILHSIAMSSDSSCTTLDGLQATKNFLRCLGRFGNTPFIFPLYGQGEIPQCFCRMCAVFGGVYCLRHKVQCLVVDRDSGRCKGIIDGFGQRISANYFIVEDSYL
SKEMCSNIQYKQISRAVLITDQSILKTDSDQQISILVVPPLEPGTASVRVMELCSSTMTCMKDSYLVHLTCFSSKTAREDLEPVVKQLFIPFAEAEADKEELRKPRLLWA
LYFNMRDSSGVSRSSYCSLPSNVYICSGPDCGLGNEHAVKQAETLFQEIFPSEEFCPPPPNPEDIIFEAEG*
1185 >lcl|NP_001103024.1|Plus13305868..3306917 NW_047653 G protein-coupled receptor 21 Gpr21 __SEG__ Chr3 {Rattus norvegicus} MNSTWDGNQSSHPFCLLALGYLETVRFCLLEVLIVVFLTVLIISGNIIVIFVFHCAPLLNHHSTSYFIQTMAYADLLVGVSCLVPSLSLLYYPLPMEEAMTCQVFGFIVS
VLKSISMASLACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFRWCAESWHTNSYFTLFIVMTLYAPAALIVCFTYFNIFRICQQ
HTKEISERQARFSSQNGETGEAQTCPDKRYAMVLFRITSVFYVLWLPYIIYFLLESSTGCSSRLASFLTTWLAISNSFCNCIIYSLSNSVFQQGLKGLSESVCTSCASHT
TAKDPYTVRSKGPLNGSHI*
1186 >lcl|NP_001103049.1|Plus120049010..20049738 NW_047563 LRRN4 C-terminal like Lrrn4cl __SEG__ Chr1 {Rattus norvegicus} MLGSLSLLWLVAMTTSLVSQAQILTMEDYQVGEEDDVTRTTPSLAVRCDYDRCRHLQVPCKELQKVGSVACLCPGLSREDQQPEPPRLVEVQIVAEEGYAVAHWCAPFSP
VSHYWLLLWESNGAPQKSASLNATVRRAEVKGLKPGVAYVLCVVAANDAGKSNVPGADVEGPENWTGPSLGPCRKFIMPPKPVTLVHAAVGVGTVLALLSCAALVWHFCL
RDRWGCPRRRQGTSTAQNSDAL*
1187 >lcl|NP_001103079.1|Plus110387301..10389070 NW_047773 leucine rich repeat and Ig domain containing 3 Lingo3 __SEG__ Chr7 {Rattus norvegicus} MTCWLHMLGLHLLLLPTAPLATGCPARCECSASTRTVACGRRRLTAVPEGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIAHVEPGAFANLPRLRVLRLRG
NQLKLIPPGVFTHLDSLTLLDLSENKLVILLDFSFQDLRSLQRLEVGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRHLAIAALEDQNFQKL
PGLLHLEIDNWPLLEEVAPGSLRGLNLTSLSITHTNITAVPAAALRQQAHLTCLNLSHNPISMVPRGSFRDLVRLRELHLAGALLAVIEPQAFVGLRQIRLLNLSDNLLS
TLEENTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGRLPACATPAEVRGDALHNLPDSVLFEYFVCRKPKIRERRLQHVTATEGDDVRFLCRAEGEPAPTVAW
VTPQHHSVTAASRGRARVLPGGTLAITDTRPQDSGTYTCVASNAGGNDTYFATLTIHPAANRTQSDGHNETQVGVRFPLDLTTILVSTAMGCITFLGVVLFCFLLLFVWS
RGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI*
1188 >lcl|NP_001103124.1|Plus144343356..44345509 NW_047334 glycoprotein Ib (platelet), alpha polypeptide Gp1ba __SEG__ Chr10 {Rattus norvegicus} MALLILLFLLPSPLHSQPTCDVSKVTSLLEVNCEDKKLKKLPTDLPADTGILHLSKNQLGTFSTSYLVHFTHLTHLYLSRCELTSLQAHEKLLKLETLDLSHNHLQSLPS
LGRALPALTTLDVSFNKLGSLSPGALEGLGQLEELYLQNNDLKSLPPGLLMPTTKLLKLSLANNKLRELPPGLLDGLEDLDTLYLQGNWLSTIPKGFFGSLLLPFVFLHA
NTWYCDCEILYFRNWLQENPNRVYLWKEGVDVKAMTANVASVRCANLGNAPVYSYPGKGCPTNEGDIDYDDYADTPTTRTEVKFSTNTKAHTTYWGLFYSESSTSPDSQM
TSLPPIHEPTKKQPTFAHTEIPGFTTLPDTMESNTAFYSLNNTVPTTTPEPTSTQATPEPSSTPMLTTPVPTPEPSSIPMLTVPVSTPEPSSTPMLTTPVSTPEPSSIPM
PTIPVPTPEPSSIPMPTIPVPTPEPSSTPMPTIPVPTPEPSSTPMFTTPVPTPEPSSTPMLTTPTLTTPESSSTPSILVSTIPPVLTTTLAPPESIPKTVLEQFYTLEPT
LPRTLESTIIIPEQNSLNSQAVPQASSDTPKSNPFLNSDFCCLLPLGFYVLGLLWLLFASVVLIVLLTWIWHVTPHNLDMDQSAALATSTHTTSLEMQRARQVTMPWAWL
LSLQGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGHGQDLLGRVGIRYSGHSL*
1189 >lcl|NP_001103525.1|Plus1complement(19768309..19769037) NW_047657 hypothetical protein LOC499839 RGD1564664 __SEG__ Chr3 {Rattus norvegicus} MAFAVIRACSRVGRGGLYKRLGGLPRGTRRQRQRRQGASLSTTEQRSLAPRPPTGPPARYPSPAVPARASEARRHPAADLDPPPGEPQAVASRGTPEPRPPPESPGAQPP
PGPAAADGAMAAAKPGELMGISSSYQAVMPHFVCLADEFPQPVRPAKLPKGKGRLRRPRQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQ
REPLGSCKLRNSLDSSDSDSAL*
1190 >lcl|NP_001107222.1|Plus11943802..1945022 NW_048033 testis derived transcript-like Tesl __SEG__ ChrX {Rattus norvegicus} MDLGHKPGLGAPCLKCKEKCAGFELHFWRKICRNCKCGQEDHDILLSNDEDQKVGRLFEHTEYTNIITKLKSEGMPMFKHNVMAMTNPCTAEKKFFNTGSYEWAPPVQRQ
ELARNYMAKEKLSLSGSWATQYLKKQLSKQLPAHDQDPSKCHELSPNEVREMEQFIKKYKNEALGVGAMKHLSEVNDQGDKVQNPARVRNTTSALSSKEKSTEPKKTQYS
CYCCKQPIKEGDTAIYAERAGYNKLWHPSCFICSTCGELLVHMIYFWKNGKLYCGRHYCDSEKPRCAGCDELIFSKEYTQAENQNWHLKHFSCFDCDKILAGKIYVMVND
KPVCKPCYMKNHAVKCQECQSVIDPELQRVTYNNFSWHASSECFLCSCCRKCLFGQKFMPVNGLVFCSMECKKMMS*
1191 >lcl|NP_001108073.1|Plus11700706..1703045 NW_047511 protocadherin beta 4 Pcdhb4 __SEG__ Chr18 {Rattus norvegicus} METTIAKTSQQRQVVFLTMLLLLRVSGSEAIKYSMPEETESGYLVANLAKDLGLRVGELATRGARIHHRGNKELLQLDAETGNLFLKEKLDREVLCGLTEPCVLQFQIIL
KNPVQFFQTELQLTDINDHAPEFPDTEMLLTIPESVQPGTVFPLKAAQDSDIGSNAVQNYTVSPNLHFHVVTHSRTDGRKYPELVLDRALDREEQPELTLILTALDGGAP
RRSGMTAVHIEVVDINDNAPQFVQSLYEVQVPENIPLDALVVTVSATDLDAGIYGNVAYSLFQGSRDSQPFIIDEITGEIRLSKELDFEVTPYYNVEIAAVDGGGLSGKC
TVAVQVLDVNDNAPELTISTFSSPVPENSPETVVLVFGVFDQDSGDNGRMVCSIQNELPFLLKSTFENYYTLVTERPLDRESRAEYNITITVSDLGTPRLTTQHTITVKV
SDINDNAPSFTQTSYTMFVHENNSPALHIGTISATDSDSGSNAHITYSLLPPDDPQLDLDSLISINADNGQLFALRALDYEALQSFEFLVGATDEGSPALSSQALVHVVV
LDDNDNVPFVLYPLQNASPPCTELLPRAAEPGYLVTKVVAVDQDSGQNAWLSFQLLKATEPGLFSVWAHNGEVRTARLLSERDVPKHKLLLLVKDNGEPQRSASVTLHVL
LVDGFSQPYLPLPEVALDPTYDEDNLTLYLVVALASVSSLFLLSVLLFVGVRLCRRARASSLGGYSVPEGHLPSHLVNVSGMGTLSQSYQYEVCLMGESGTTDFKFLKPS
IPNSLIADN*
1192 >lcl|NP_001108074.1|Plus11710890..1713283 NW_047511 protocadherin beta 5 Pcdhb5 __SEG__ Chr18 {Rattus norvegicus} MEKLERNHANRQVIPFLFMLLWGQVLMVPTRYSVLEEAERGSFVAHLAKDLGLGAGELAARSARVVSDFDNQQFMVDPDTGDLLLREKLDREELCGSVDPCVMHFQVFLE
KPVQFFQGELLIQDINDNSPEFPDKELLLKIPENSQPGTRFPLNLAQDLDVGSNGLQEYRVSTNPHFHVLTRNNSEGKKYPELVQDRALDREEQAELSLTLMALDGRSPP
RSGTALVRILIMDINDNAPEFVNSPYEVQVPESCPPDSPILTVLAPDADAGNFGSVSYGLFQASDEIQKTFSINEVTGEIRLKKELDFEKTESYRVEIEATDGGGLSGKG
SVVIEVLDVNDNAPELTISSLTSSVPENAPETVVAIIRIRDRDSGDNGKMICSISDHVPFTLKPSYKNFYTLVTERALDRESRAEYNITISVSDQGTPRLTTQHTITVQV
SDINDNAPAFTQTSYTMFVHENNSPALHIGTISATDSDSGSNAHITYSLLPPYDPQLALDSLISINPDNGQLFALRALDYEALQAFEFRVAATDGGSPALSSQALVRVMV
LDDNDNAPFVLYPLQNASAPYTELLPRAAEPGYLITKVVAVDRDSGQNSWLSFQLLKSTEPGLFSVWAHNGEVRTTRLLSERDVPKHRLLLVVKDNGEPPRSASITLQVV
LVDGFSQPYLPLPEVARDSAKDGADLLTLYLVIALASVSSLFLLSVLLFVGVRLCRRARAASLGDCTVPEGHFPGHLVDVSRAGTLSQSYQYEVCLTGDSGAGEFKFLKS
MVPNLMVQDPGREIAENLHCRDSFVFS*
1193 >lcl|NP_001108075.1|Plus11805821..1808202 NW_047511 protocadherin beta 10 Pcdhb10 __SEG__ Chr18 {Rattus norvegicus} METASEKRQVVFLTILLLLWKSDAETIRYSMPEETESGYLVANLAKDLGLRVGELATRGARIHHKGNKDLLQLDAETGNLILKEKPDREVLCRATEPCVLHFQIILENPV
QFFQTELQLTDINDHAPEFPDRKMLLKISESAQPGTMFPLKAAQDPDIGSNAVQNYTVSPNLHFHVITHSRTDGRKYPELVLDRALDREEQPELTLTLIALDGGAPSRSG
TTTVHIEVVDINDNPPKFDQSLYEVQIPENSPLNALVATVSARDLDAGIHGTVIYSLFQGGELSQPFEIDEVAGEIRLKGTLDFEATPYYNIEIVATDPGGFSGKCSVAI
QVVDVNDNAPKLTISSLNSSIPENAPEAVVAVFSVSDPDSGENGRIVCSIQNELPFLLKPTFENYYTLVTERPLDRESRADYNITITVSDLGIPRLTTQHTIIVQVSDIN
DNAPAFNQTSYTLLVRENNSPALHIGTISATDSDTGANAHISYLLLPLYDMQLALTSLVSINQENGQLFVLRALDYETLQTFEFSVGATDHGSPALSSQALVRVVVLDDN
DNAPFVLYPLQNASVPCTELLPRAAEPGYLVTKVVAVDCDSGQNAWLSFQLLKATEPGLFNVWAHNGEVRTTRLLSERDVPKHKLLLVVKDNGEHQRSATVTLHVLLVDG
FSQPYLPLPEVARDPVQDDEDVLTLYLVIALASVSSLFLFSVLLFIGMRLCKRAREASLGVCSVPEGHFPGHLVDVSGTGTLSQSYQYEVCLTGDSGTGEFKFLKPMISN
LMVQDPGREVKESPPCRDSFVFS*
1194 >lcl|NP_001108076.1|Plus11906141..1908414 NW_047511 protocadherin beta 21 Pcdhb21 __SEG__ Chr18 {Rattus norvegicus} MESVVGAAQHVRQVLVFFVFLEGSLVLSETWSYSVAEETETGSSIGNIIKDMDVGDLAARGARVIFDDYQPYLRLELETGNLLLNKKLDREALCSTSEPCILHFQVLLEN
PLQFFQAELLIEDINDHTPTFLEKLIFLNISEGATPGTAFQMDNAQDLDIGMNGILNYSISPNPYFYLKLKDSGKGRRYPELVLARSLDREKEASISLILIAIDGGSLPR
TGAVQVQVVVLDVNDNAPEFEKTLYEVQVPENSSVDSLVIKVSAKDLDSGINGEVSYSFSHISRDVQKTFEIHPISGEIHLKTVLDFEVIPSYTINVQAIDGGGLSGKSA
IIVQVTDVNDNPPEIVITSLMSPIQENSLSEMVVAIFSLRDQDSGENGRMICSIQDKLPFLLKPTFKNFYTLVTEHPLDRESRAEYNITITVSDLGTPRLTTQHTITVQV
ADINDNAPAFTQTSYTIFVQENNRPALHIGTITATDSDSGSNAHITYSLLPFHDPQLSLASLISVNADNGQLFALRALDYETLQTLEFHVGATDGGSPALSSQALVRVMV
LDDNDNAPFILYPLQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSIWAHNGEVRTTRMLSEHDVPKHKLLLLVKDNGEPPRSASVTLHLL
VVDGFSQPYLPLPEVALDPTNVDEEALTLSLVIALASVSSLFLLSVLLFVGVRLCRKATTASLGGYSVSEGHFPGHLVDFSGAETLSQSYQYKVCLT*
1195 >lcl|NP_001119763.1|Plus1complement(19100521..19102470) NW_047658 fibronectin leucine rich transmembrane protein 3 precursor Flrt3 __SEG__ Chr3 {Rattus norvegicus} MISPAWSLFLIGTKIGLFFQVAPLSVMAKSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKV
FFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVR
GLMCQAPEKVRGMAIKDLSAELFDCKDSGIVSTVQITTAIPNTAYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPSRKTILITVKSVTPDTIHISWRLALPMTALRLSW
LKLGHSPAFGSITETIVTGERSEYLVTALEPESPYRVCMVPMETSNLYLFDETPVCIETQTAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVSIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNLSESSSNRSYRDSGIPDLDHSHS*
1196 >lcl|NP_001119774.1|Plus133005324..33006586 NW_047762 zinc finger and BTB domain-containing protein 42 LOC691556 __SEG__ Chr6 {Rattus norvegicus} MEFPEHGVRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDQPASSRDTVRLNGDIVTVPAFSRLLDFMYEGRLDLHSLPVEDVLAAASYLHMYDI
VKVCKGRLRKKDPDLETRTLGTELPGQTPHPLPSWPPAFCQATPKAKPPSLGVKAVHPLPKFGPPSWQVSEESSGALDLSLKPGPRPEQAHPPCLLQTSQCSSIQQGAQP
LVKAEQDSFSEQDSSSPQSADRSPPPVCASAARGLAVNLEPLHIQGTGSQQLGLHAEPVVDSEDLGPGRHLCICPLCCKLFPSTHALQPHLSAHFRERDSVRTRLSPEGA
VPTCPLCSKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHVRKFHYGLVKPLLV*
1197 >lcl|NP_001120775.1|Plus1complement(19316217..19317824) NW_047562 inositol 1,4,5-triphosphate receptor interacting protein-like 2 Itpripl2 __SEG__ Chr1 {Rattus norvegicus} MSVRYTLNLRVFWPLVTGLCTALVCLYHALRSSEGARAEPPDGADSGFPLLKVAILLLLCYILLRCRHTIRQRLLPGSSRPCGHANFSARSLQEPGLSILLESYYEHEVR
LSPHVLGHSKAHVSRIVGELVQAGRARGSPGPITGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVPLRLPPQVALEPRSLGTEPALTPAFRSCFVCTLKAPPSPSGT
STGQWHRDCKPFAEGFCVDVQGRRHLSATLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVHLGEGVFLVAPPPPPSP
SGALSELPGGLRAEALWGVNTARQEQKLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDPMAATHWGRILSSYMLKTAVLEVLLNEGGPTPSWDEAYLSECLEKLVKF
LRDCLLRRRDLFHCVLGPAGAAAEVGPLPKVLREAPPVDLLAPFDQHARELAAARLLSTWRRLPQLLQVYGGPRYLARCPAPRSQRIQGFPEDEP*
1198 >lcl|NP_001124009.1|Plus131943..34078 NW_047778 zinc finger and BTB domain containing 39 Zbtb39 __SEG__ Chr7 {Rattus norvegicus} MGMRIKLQSSNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYEVAERLG
MEDLLRACHSTFPDLESTTIAKSLTSTSDSPCVTLSCPSVDPTHPLGELRGSGEHFGPDRNYALPTDAGGSYKEEERAIAGDTNHSLPLPQVPLPPKSEDHDAPVPFTSV
PSMVTPPPVLGTVSTGIQTSTTSSCQPYKVQSNGDFGKSNFFTSDNALDITPQTNPCLSNNDQARDPGFGQMDELQLEDLGDEDLQFEDPAEDLGTTEEVIELSDDSEDD
LAFGDNRENKAMPCQVCKKVLEPNIQLIRQHARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTLHRRDGIFENNVIVHPNEPLSGKLG
LFPGAASPELKCAACGKALAKDFHVVRGHILEHVSLKGQACSVCDQRHLNLCSLMWHTLSHLGISVFSCSVCASSFVDWHLLEKHMAVHQSLEDVLFRCHLCSQSFRSEA
AYRYHVSQHKCSSGLDPRPAVGLPHLALQKRKLPAEDFLSEELALQGQPGNSKYSCKVCGKRFAHTSEFNYHRRIHTGEKPYQCKVCHKFFRGRSTIKCHLKTHSGALMY
RCTVCGHYSSTLNLMSKHVGVHKGSLPPDFTIEQTFMYIIHSKEAEKNPDS*
1199 >lcl|NP_001128305.1|Plus15977830..5978942 NW_047561 coiled-coil domain containing 89 Ccdc89 __SEG__ Chr1 {Rattus norvegicus} MPQKEKTLRMDTPPPDEILGRQNENLENEDDELGFKEMDGLREALANLRGLSEEEKGEKAMLRSRIQEQSQLICILKRRSDEALERCQILELLNSELEEKRMQEMEKMKV
QNEQVQKLESRFMTLAANHELMIRFKDEHKSENIKLKEENEKLRQENNSLFSQALKDQENKVLQLTAHNKALVEELEVLKQRCAHEAGQARAREEELLALQNQQACEHAK
ETEQLRSQLQSIKQQHRQATEQMGKDQEANINMNQELQARLHTVMREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSNLRVRELQRKV
DGIQKAYDDLRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
1200 >lcl|NP_001128463.1|Plus1complement(648023..649402) NW_047597 zinc finger and BTB domain containing 12 Ng35 __SEG__ Chr20 {Rattus norvegicus} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGISEASLMSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLAGGLGIGASVGSHLGELAQSSVAPNTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEAGVAEINVLIR*
1201 >lcl|NP_001137222.1|Plus13342278..3342622 NW_047651 Notch-regulated ankyrin repeat protein Nrarp __SEG__ Chr3 {Rattus norvegicus} MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYA
ASGR*
1202 >lcl|NP_001138251.1|Plus11648299..1651082 NW_047453 toll-like receptor 11 Tlr11 __SEG__ Chr15 {Rattus norvegicus} MPKMERHLFHSVLLILILLTLVSLNLTGLAWTIPDCIIADSLLFPNLSSYIPFCTLAPRLHLLASCSNVKNINQTLEKVPRNTEVLCLQGMVPTLPANAFDGFYSLQLLR
LQLGTTNITSRTFQGLDQLQYLFFEHHAPCCLSLFLPPDSLESLRSLSSLSFQGYCLTYSHSIYLPTTLRHLTMRNSCLTKLQELQRLFPDLLLGASSTPNTKPRTPFLE
VLDLSYNLQLKQAGIRDLYGLTLHSLILDGTPLRALDLTSSGLLHLHFLSLVGTGIEKLPASVTGFSELCALDLGKNQIQNILGNGDILGLKALKFLSLHDNHLQSLPVR
FLRTLPQLQKLNLSMNKLGPILELPEGLFSTNLTVLDLSHNQLCEIPRGNFSFLSQLQELWLSGNNISSLSNESLQGLRWLRTLDLSWNQIKVLKPGWLSHLPALTTLNL
LGTYLEHISGTQLQGPKMLRHLQLGSFPTLEIYRLWFPMLLSLEIQAETYIQFMVPSGEPFLFLENLTLETSNLLLEPKTTTIHFPSLRRLTLRGYSIFLSTSQLQSFFP
PQLPLLEYFFVWCRNDDAVDLHLFEMPRLRVLELGNLNFFYESSTVKLEMLLNEVPQLQVLALSHLNLKNLSVSSFKGLQSLKLLLLNSERALEMNSNLQELIPQIPQYV
YFSDVTFACQCETSWLESWATRAPNTFVYGLEKPICMANASDYSKTLLFSFLATNCPHGTEFWGFLTSFSLLLLLIILPLISCHKWSWLHHLWTLFHTCWWKLGGHRLRG
QFNYDVFISYCEEDQDWVLEELVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRAILCVLTGQALASPWCNLELRLATYHLIARPGTTCLLLLFLEPLDRQ
KLHSYHRLSRWLQKEDYFDLSQGKMEWNTFCEQLKQRLRKARKERED*
1203 >lcl|NP_001138806.1|Plus15281914..5282969 NW_047375 G protein-coupled receptor 81 Gpr81 __SEG__ Chr12 {Rattus norvegicus} MLFLSPSAMDNGSCCLIEGEPITQVMPPLLILAFLLGALGNGLALCGFCFHMKTWKSSTIYLFNLAVADFLLMICLPLRTDYYLRRRHWILGDIPCRLVLFMLAMNRAGS
IVFLTVVAVDRYFKVVHPHHMVNAISNRTAAAIVCVLWTLVILGTVYLLMESHLCVRGMVSSCESFIMESANGWHDIMFQLEFFLPLTIILFCSFRVVWSLRQRQQLTRQ
ARMRRATRFIMVVASVFITCYLPSVLARLYFLWTVPSSACDPSVHIALHVTLSLTYLNSMLDPLVYYFSSPSFPKFYAKLKIRSLKPRRPGRSQARRSEEMPISNLCRKS
STDVVNSSQRPSDGQWGLQVC*
1204 >lcl|NP_001139300.1|Plus13867153..3869768 NW_047400 toll-like receptor 5 Tlr5 __SEG__ Chr13 {Rattus norvegicus} MWCFYSLFSHRIMAYQLDLLIGVVFMASPVLEMSPCFSDGRIALFRGCNLTQIPWVLNTTERLLLSFNYISTVVTTSFPLLEQLLLLELGTQYARLTIGQEAFRNLPNLR
ILDLGQSQIEVLNPDAFQGLPHLFELRLFDCGLSNAVLRDAYFRNLNSLARLDLSANEIHSLHLHSSFQELSSLSDINFSFNRIFTLCEDELQPLQGRTLSFFGLKSTSL
FSRVFVDWEACRNPLRGIRLETLDLSENGWTAAILGNFSHTIQGSHISSLILTYHIMGSGFGFQNIKDPDQSTFASLARSSVLQLDLSHGYIFSLNPRLFETLKDLKKLN
LAFNKINKISDYAFHGLDSLQILNLSYNLLGELYNSNFYGLPSIAYLDLQRNHIGIIQDRTFRLLKKLQTLDLRDNALKTIGFIPSVQMVLLGSNKLTHLPHVRFTANFI
ELSENGLENLSDLYFLLRIPGLQFLILNQNRLSSCSNVDYAPSQNLSLEQLFLAENMLQLAWETGLCWDIFKGLSRLQILYLNNNYLNFLPPGIFNGLVALRMLSLSANR
LTMLSPGSLPANLEILDISRNQLFSPDPGLFSSLRALDITHNEFICDCELSTFIVWLNQTNVTLFGSPADVYCMYPNSLLGSSLYNISTKDCDEEEAVRSLNFSLFILCT
VTLTLFLVITLIVTKFRGICFLCFKTIQKLMFKGKFRNPEPSAYRYDAYFCFSSKDFEWAQNALLKHLDAQYSSQNRLRLCFEERDFIPGENHISNIQAAVWGSRKTVCL
VSRHFLKDGWCLEAFRYAQSRCLSDLKRVLIVVVVGSLPQYQLMRHETIRGFLQKQQYLRWPEDLQDVDWFLDKLSGCILKEEKGKKRSSPIQLRTIRTVS*
1205 >lcl|NP_001157615.1|Plus11992840..1993922 NW_047725 cannabinoid receptor 2 isoform 1 Cnr2 __SEG__ Chr5 {Rattus norvegicus} MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILSSQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKI
GSVTMTFTASVGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHV
ASLAEHQDRQVPGIARMRLDVRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYALRSGEIRSAAQHCLTGWKKYLQGLGSEGKE
EAPKSSVTETEAEVKTTTGPGSRTPGCSNC*
1206 >lcl|NP_001162611.1|Plus1complement(2858278..2859309) NW_047555 formyl peptide receptor, related sequence 3 Fpr-rs3 __SEG__ Chr1 {Rattus norvegicus} MEANSSIPLNGSEVVFYDSTTSTVLWILSVVVLSITFVLGVLGNGLVIWVAGFRMAHTVTTICYLNLALGDFSFMATLPIHIISMVMKGKWLFGWFLCKFVHSIVHINLF
ASVFLITLIAMDRCTCVLHPVWAQNHRTVGLARKVVVGAWILSLLLTLPHFLFLTTVRDPRGEVHCTCNFESVVANPEEQLKVSIIVSTAIGIISFIIGFSLPMSFIAIC
YGLMAVKICRKDFLNSSRPLRVLSAVAISFFMCWFPFQLIILLGNIWNKETPNSIHILLNPASTLASFNSCLNPILYVFLGQEFREKLIHSLSASLERALQEDSVLNDGK
SSNFSSCPADSEL*
1207 >lcl|NP_001163899.1|Plus1complement(3651513..3653378) NW_047400 hypothetical protein LOC289334 LOC289334 __SEG__ Chr13 {Rattus norvegicus} MAGFHLFSPKPYGELGEPLAAGEQEFADQLGWHELSRNSWAQTAGAEIETEVPWVHPKCSPAGRSRRRGYIASPRESHSLTHVARRPSDRARKHRSGNLRLEEACGMGEA
PTKSSRTWQQKRQQQPPDQPSPRHPAAPGVSSPQYPGEAFSPPSAGALLVEKTHNGDRWAVPVCRHVGPGSPALDLTDKSSVHSLELWRQSTCVCTQNRKNRDRTKYYPP
SASCKEKSSQHARVLKSKLDEAVISFRDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERRLLLLQSQEQWQGQREQHKPRRGHSHEQPRQGHEQQ
GQRRDRQAKSTVQPENQSGWTMQPDKPENQGLDKMDRVQVQAEHLKHCQAQSLREQERVLQSVRDLNRLQLQKRLETAGHKREQHAMESPKKVQGSNLSTVVNVQARKVL
MDCQAKAEELLRKLSLEQSFQSSQNMQEGLVKERHRGQQGKAQTEAEQFQRVKWREEEAEELLQESKRVLAELAEEKMGQARSHAHKTSKDRAQHLQELNILRERNRHIL
KLKAEKEEKCHIEGIKEAIKKKEQKLEQMTLGKDPIFQEYQKVPLASKINRCYDKGAAETQLPLHQQGGVY*
1208 >lcl|NP_036624.2|Plus1complement(4209070..4210326) NW_047514 adrenergic, beta-2-, receptor, surface Adrb2 __SEG__ Chr18 {Rattus norvegicus} MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWT
SIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQAIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYS
RVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRANLIPKEVYILLNWLGYVNSAFNPLIYCRSP
DFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL*
1209 >lcl|NP_036659.1|Plus124557023..24558792 NW_047492 cholinergic receptor, muscarinic 3 Chrm3 __SEG__ Chr17 {Rattus norvegicus} MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLA
CADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGEC
FIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVKRSSRRKYGRCHFWFTTKSWKPSAEQMDQDH
SSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQKDFTKLPIQLESAVDTGKTS
DTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTF
RTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL*
1210 >lcl|NP_036717.1|Plus1120051..121319 NW_047619 5-hydroxytryptamine receptor 1A Htr1a __SEG__ Chr2 {Rattus norvegicus} MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCD
LFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR
AARFRIRKTVRKVEKKGAGTSLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGNSKEHLPLPSESGSNSYAPACLERKNERNAE
AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCENSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCRR*
1211 >lcl|NP_036833.1|Plus12691247..2692647 NW_047569 adrenergic, beta-1-, receptor Adrb1 __SEG__ Chr1 {Rattus norvegicus} MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAGMGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLL
VVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVT
NRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLSGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFF
LANVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDDDDDAGATPPARLLEPWAGCN
GGTTTVDSDSSLDEPGRQGFSSESKV*
1212 >lcl|NP_036851.1|Plus125744914..25746089 NW_047760 somatostatin receptor 1 Sstr1 __SEG__ Chr6 {Rattus norvegicus} MFPNGTAPSPTSSPSSSPGGCGEGVCSRGPGSGAADGMEEPGRNSSQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLS
VPFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWL
VGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNF
KRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCASRISTL*
1213 >lcl|NP_036916.1|Plus124756567..24757988 NW_047711 cannabinoid receptor 1 Cnr1 __SEG__ Chr5 {Rattus norvegicus} MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFM
ILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIH
RPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQV
TRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNT
ASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL*
1214 >lcl|NP_036927.1|Plus125737972..25739675 NW_047356 platelet glycoprotein V precursor Gp5 __SEG__ Chr11 {Rattus norvegicus} MLRSVLLSAVLSLVGAQPFPCPKTCKCVVRDAVQCSGGSVAHIAELGLPTNLTHILLFRMDRGVLQSHSFSGMTVLQRLMLSDSHISAIDPGTFNDLVKLKTLRLTRNKI
SHLPRAILDKMVLLEQLFLDHNALRDLDQNLFQKLLNLRDLCLNQNQLSFLPANLFSSLGKLKVLDLSRNNLTHLPQGLLGAQIKLEKLLLYSNRLMSLDSGLLANLGAL
TELRLERNHLRSIAPGAFDSLGNLSTLTLSGNLLESLPPALFLHVSCVTRLTLFENPLEELPEVLFGEMAGLRELWLNGTHLRTLPAAAFRNLSGLQTLGLTRNPLLSAL
PRGMFHGLTELRVLALHTNALEELPEDALRGLGRLRQVSLRHNRLRALPRTLFRNLSSLVTVQLEHNQLKTLPGDVFAALPQLTRVLLGHNPWLCDCGLWPFLQWLRHHL
ELLGRDEPPQCNGPESRASLTFWELLQGDQWCPDPRGLPPDPPTENALKAPDPTQRPNSSQSWAWVQLVARGESPDNRFYWNLYILLLIAQATIAGFIVFAMIKIGQLFR
TLIREELLFEAMGKSSN*
1215 >lcl|NP_036932.1|Plus136818138..36819259 NW_047625 purinergic receptor P2Y, G-protein coupled, 1 P2ry1 __SEG__ Chr2 {Rattus norvegicus} MTEVPWSAVPNGTDAAFLAGLGSLWGNSTIASTAAVSSSFRCALIKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFY
YFNKTDWIFGDVMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGIRKNKTVTCYDSTSDEYLRSYFIYSMC
TTVAMFCIPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDT
FRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL*
1216 >lcl|NP_036984.1|Plus12481986..2483110 NW_047725 5-hydroxytryptamine receptor 1D Htr1d __SEG__ Chr5 {Rattus norvegicus} MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTILLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDI
WVSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHEEMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVA
ARSRILNPPSLYGKRFTTAQLITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWI
HPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQRVVHFRKAS*
1217 >lcl|NP_037001.1|Plus17109592..7110929 NW_047470 neuropeptide Y receptor Y5 Npy5r __SEG__ Chr16 {Rattus norvegicus} MEFKLEEHFNKTFVTENNTAAARNAAFPAWEDYRGSVDDLQYFLIGLYTFVSLLGFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFG
KAMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQY
ILPLVCLTVSHTSVCRSISCGLSHKENRLEENEMINLTLQPSKKSRNQAKTPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQGKHLAVPENPASVRSQLSPSSKVIP
GVPICFEVKPEESSDAHEMRVKRSITRIKKRSRSVFYRLTILILVFAVSWMPLHVFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRALIH
CLHMS*
1218 >lcl|NP_037014.2|Plus1complement(1564858..1565946) NW_047334 somatostatin receptor type 5 Sstr5 __SEG__ Chr10 {Rattus norvegicus} MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIYVVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVSYWPFGSFLCR
LVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYL
LIVVKVKAAGMRVGSSRRRRSERKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKVLCLRRGYGMEDAD
AIEPRPDKSGRPQATLPTRSCEANGLMQTSRI*
1219 >lcl|NP_037082.2|Plus1complement(395369..396580) NW_047617 proteinase-activated receptor 1 precursor F2r __SEG__ Chr2 {Rattus norvegicus} ESERMYATPYATPNPRSFFLRNPSEDTFEQFPLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTSPWLTLFIPSVYTFVFIVSLPLNILAIAVFVFRMK
VKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSGMCRFATAAFYCNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMGVVPLLLKEQ
TTQVPGLNITTCHDVLNETLLHGFYSYYFSAFSAIFFLVPLIISTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLLLSDSPGTETAYFA
YLLCVCVSSVSCCIDPLIYYYASSECQKHLYSILCCRESSDSNSCNSTGQLMPSKMDTCSSHLNNSIYKKLLA*
1220 >lcl|NP_037093.1|Plus1complement(5267022..5268083) NW_047816 G protein-coupled receptor 1 Gpr1 __SEG__ Chr9 {Rattus norvegicus} MEVSREMLFEELDNYSYALEYYSQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIWFMGFKWKKTVTTLWFLNLAIADFVFVLFLPLYISYVALSFHWPFGRWLC
KLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEVNNRIICYNNFQEYEL