SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom T    

ID / Description / Sequence
1 >lcl|NP_001104494.1|Plus1complement(63035761..63036759) NW_001581900 melanocortin receptor 4 MC4R __SEG__ Chr3 {Monodelphis domestica} MNSTHYYHGMHPTLHFWNHSYVLHSSANDTIGKGYLDGGCYEQLFVSPEVFVTLGIISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNST
DTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIITCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMAR
LHIKRIAVLPGTGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNFYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYTLGGPCDLAG
RY*
2 >lcl|NP_001191980.1|Plus1176543902..176545515 NW_001581841 probable G-protein coupled receptor 75 GPR75 __SEG__ Chr1 {Monodelphis domestica} MNLTDCLQIAPNTTLPLSPKDNSTYFQEDLQEIIHTATLVTCTFLLVIIFFMGSYGNVIVFMSFFDPAFRKFRTNFDFMILNLSFCDLFICGVTTPMFTFVLFFSSAASI
PDAFCFTFHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTMILTLLLWATSFTLAALATLKTSKSRLCLPMSSLITGEGKTILSLYVVDFAFCVVVVSVSYI
MIAQALRKNAQVRKCPPVITVDASRPQPFMGGGQPGGGNSIQGSGPALYRNQNYNKPQHVQTHGYTQCSNQLPTPAASRLQLVSAVNLSTAKDSRAVVTCVVIVLSVLLC
CLPLGISLVQGVLSGNGSFLFYQFELFGLTLIFFKSGLNPFIYSRNSAGLRRKVLWCFQYIALGFCCCKQKTRLRAIGKGSLEVNRNKSSHHETNSAYMLSPKPQKKFVD
QACGPSHSKESVLSPKVSAGHQHYGQSSSTPINTRIEPYYSIYNSSPSQEVSTPNSVQPVNAFGFTKSHIAKHYHTTNDLMQDCDSISAKQIPVPSV*
3 >lcl|XP_001362157.2|Plus1complement(4526..5461) NW_001581839 olfactory receptor 2D2-like LOC100009737 __SEG__ Chr1 {Monodelphis domestica} MSDINKTWVTEFFFLGLSDDLQIQLFLFILFLIVYLVTLLGNLLLISLVLIDSQLHTSMYFFLCNLSLADLGFSTCIVPQVLAHMLSRRKVISFIGCAVQLLFCVILGGT
ECALLAVMSYDRYLAICDPMHYPIIMTSRLCGHLVLGCWISGILVALVHTTFTLRLPYQGDNRIAHFFCESPALLALASADTHSSKMAIFLMGSLFLLAPVSLILASYGS
IIVTVIKMKTTSGRRKAFSTCGSHLLVVIIFYGSAIINYMRLKPSKEEAKVASVFYAVINPMLNPLIYSLRNKDVTKALRNIAKKRKCFIS*
4 >lcl|XP_001362322.2|Plus144855..45817 NW_001581876 olfactory receptor 2L2-like LOC100009814 __SEG__ Chr2 {Monodelphis domestica} MGRVNQTTDFILLGLFPEIKHLAVLISIIFLIYMIAITGNAVLIFLILGDSQLHTPMYLLLSQLSLIDLALISTVVPNMVTSFFTGRKNISQTGCGTQIFFILTLGISEF
LLLTFMSYDRYVAICNPLRYSVIMSPTVCMQMVIGSWLGGTLTSLVHTTYVMHFSICGSREILHFFCEVMALLKLTCENTSAYEKSVVISSFLVVFIPLSLILLSYTFIF
LTILRMNSPEGRSKALTTCSSHLSVVSLYFGPAILIYMRPGSSQTPKLNQALFLFDSILTPMLNPIIYGLRNKDVLAAIRKILRTIFSRGKIQRHLGCIT*
5 >lcl|XP_001362334.2|Plus1154045..154974 NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100009828 __SEG__ Chr6 {Monodelphis domestica} MNGANQTIVLEFILLGLSKHPNAEIVLFVLCLGIYLIILLGNSSLIVLSILDSNLHTPMYFFLSNLSFMDIFGTSSFVPLMLVNFLSVRKTISFPGCALQMYLTHALGTT
ECVLLAMMAYDRYVAICNPLRYTIIMNTRVCVQLAAVSWIVGTINSLLQTILALRLSFCGNNIIDHFFCEILAVLKLACVDISLNAFVMLVALVLVILPQVLLILISYVF
ILATILRLNSTKGRKKAFSTCSAHLTVVIIFFGTIIFMYSKPKAKDPDSDKLIALFYGVVTSMLNPIIYSLRNKEVKAAVKKVMFSCRT*
6 >lcl|XP_001362414.2|Plus1178193..179122 NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100009862 __SEG__ Chr6 {Monodelphis domestica} MDGTNQTIVMEFILLGLSKHHNVEIILFVLCLGIYLVILLGNSFLIVLNILDSNLHTPMYFFLSNLSFMDIFGTSSFVPLMLVNFLSVRKTVSLQGCALQMYLTLALGTS
ESVLLAMMAYDRYVAICNPLRYTIIMNMRVCVQLAALSWIIGGINSLVQTTLAWRISFCGNNIIDHFFCEILAVLKLACVDISLNAFVMMIALVLVTLTPVLLIFISYVF
ILATILRLNSAEGRKKAFSTCSAHLAVVIIFFGTITFMYSKPKAKDPDSDKLIALFYGAVTSMLNPIIYSLRNKEVKAALKKVIDSSRT*
7 >lcl|XP_001362444.1|Plus1complement(559082..560125) NW_001581931 cannabinoid receptor 2-like LOC100010312 __SEG__ Chr4 {Monodelphis domestica} MEGCWNSGVANASHGDLTFSIFRNYTVLNIPQKTAIAVLCSLLGVLCALENAIVLFLILSSPRLRRKPSYLFISSLAGADFLASLFFVISFVNFHVFHQEDSRDIFLLKL
GGVTMTFTGSVGSLLLTAIDRYLCLRHPAKYKALFTRGRALVMLTAMWAISAVVSYLPLMGWTCCPRLCSELFPLIPNDYLLSWILFIAILFVAIFYTYAYVLWKAHQHT
STLVMYQQKRLAGMSRMRLDVRLAKTLGVVLMVLVLCWLPVLALMVYSLTASLNEHIKKVFAFCSMLCLINSMVNPVIYALRSREIRVSAKNCLTRWKNMLRGTRTDSME
DAQKSSVTETEGETRVT*
8 >lcl|XP_001362484.1|Plus18113613..8116159 NW_001587047 SLIT and NTRK-like family, member 2 SLITRK2 __SEG__ ChrX {Monodelphis domestica} MLNGVWFLSVLTVAGILQTESRTTGKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYLLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNELQEIRTGAFSGLK
TLKRLHLNNNKLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPNNVFRFVLLTHLDLRGNRLKMMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSASDSNHKGNHPSFSDTHMQKLSPTLNPALTPTRAPKASRPPKTRNRPTPRVTVSKDRQSFGPI
MVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISALHPKPTSPKKLYLTGNYLQTVYKTDLPEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEI
LYPSMFDGLQSLQYLYLEYNIIKEIKPCTFDALINLQLLFLNNNLLRALPENVFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHA
NSPVIINEITCESPAKHAGEILKFLGRETICPDNPGLSDATILSMSHNTDTPRSLSVAPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSGPSST
NNLDISSFQLQYGSYNADTADKTEGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYGNLETKKEGPTTLAYTISASELLEKQSTPREPELLYQNIAERVKELP
SAGVVHYNFCTLPKRQFAPSYESRRQNQDRLNKTVLYGTPRKYFADQSKPEHPLLQAKQQTEPDYLEVLEKQTAISQL*
9 >lcl|XP_001362486.2|Plus1102504..103439 NW_001581839 olfactory receptor 2D2-like LOC100009885 __SEG__ Chr1 {Monodelphis domestica} MGQTNQTWVTEFFLLGLSDDPQTQLLLFALFLAVYLCTILGNLLLTSLVLLDSQLHTPMYFFLCNLSLADLCFSTTIVPQTLIHMLSRRKFISFTGCAVQLLLILFFGCT
QCSLLAVMSYDRYLAICNPMHYPLIMTWRVCVLMALACWSSGVVVSMVDTTFTLRLPYQGENRIAHFICEPPALLVVASADTHNSEMAVFLMGVVILLAPVSLIMISYVC
IIASVVRMKTASGRLKAFSTCGSHLIVVIIFYGSAIINYMTPKSAKELGKMVSVFYAVINPMLNPLIYSLRNKDVKRAFKNVANRRLFCTV*
10 >lcl|XP_001362487.2|Plus1245573..247549 NW_001581842 hypothetical protein LOC100009887 LOC100009887 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQRESQKSPEWSRELTPEPPGSPMSTEPCGSPREQTAVGERRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTLGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRGSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARDVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
11 >lcl|XP_001362489.2|Plus1124028..124966 NW_001581879 olfactory receptor 6C4-like LOC100009891 __SEG__ Chr2 {Monodelphis domestica} MGNQTAVTEFFLVGLTDDPEIQVILFIFLLLTYLLSFTGNMTIIILTLLDSQLQTPMYFFLRNFSFLEISFTTVFVPKMLVNIGTGNKTISFPGCFTQYFFAILLGATEF
YLLAAMSYDRYVAICKPLHYTMMMNKKLCLQLVLSSWFSGFMVVIGPHIMTTMLPFCASNVINHYCCDYTILLQLACADTHIIEMIEFVLAVVTLLFTLVLVIISYVYIM
GTIMRIPSAQKRKKAFSTCSSHMIVVSLSYGSCIFMYVNPSMKEAATFNKGVAVLNTSVAPLLNPFIYTLRNQQVKRAFKDMVRRIKFFSVK*
12 >lcl|XP_001362493.2|Plus1224533..225462 NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100009897 __SEG__ Chr6 {Monodelphis domestica} MNGGNESIVLEFLLLGLSKHPKIEIFLFVLCLGIYLVILLGNSYLIILSIVDSNLHTPMYFFLSNLSFIDIFGTSSCVPLMLVNFLSVRKTISFAGCALQMYLTHALGTT
ECVLLAMMAYDRYVAICNPLRYTIIMNTRVCVQLAAVSWIVGTINSLVQTILALRLSFCGNNIIDHFFCEILALLKLACVDISLNNFVMMVAVVLVTMTPVLLILISYMF
ILATILRLNSAEGRKKAFSTCSAHLAVVIIFYGTLLFMYSKPKAKDSDSDKVIALFYAAVTSMLNPIIYSLRNNEVKAAVKKLIFSIRT*
13 >lcl|XP_001362539.1|Plus1complement(5636941..5638863) NW_001581971 leucine-rich repeat-containing protein 4C LRRC4C __SEG__ Chr5 {Monodelphis domestica} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLRDIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPANLKGRYIGELDQNYFTCYAPVIVEPPTDLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTLQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTENNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINNGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPIESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
14 >lcl|XP_001362567.2|Plus1249523..251499 NW_001581842 YTH domain-containing protein 1-like LOC100009931 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQRESQKSPEWSRKLTPEPPGSPMSTEPCGSPREQTAVGKRRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTLGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRRSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARGVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
15 >lcl|XP_001362580.2|Plus1240282..241211 NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100009948 __SEG__ Chr6 {Monodelphis domestica} MNGVNQTIVLEFFLLGLSKHHNVEIFLFVLCLVIYLVILLGNSSLIILSIVDSNLHTPMYFFLSNLSFMDIFGTSSFVPLMLVNFLEVRKTVSFPGCALQMYLTLSMGTS
ECVLLALMAYDRYVAICNPLRYTIIMNTRVCVQLAALSWLIGSINSLVQTILALRLSFCGNNIIDHFFCEILAVLKLACIDISLNAFVMIVAVLLVTLTPVLLIFISYVF
ILATILRLNSTEGRKKAFSTCSAHLAVVIIYFGTILFMYLKPKAKDPDSDKLIALFYGAVTSMLNPIIYSLRNKEVKAAVKKLMFSDRT*
16 >lcl|XP_001362585.2|Plus1complement(441472..442323) NW_001582020 hypothetical protein LOC100009954 LOC100009954 __SEG__ Chr8 {Monodelphis domestica} MRRSVRRRRRRPRAAAPAVVAAAAAAAAAAPGGGLRARGGDGLAAEREEKVVYSRSQLSLAGSTKALGDAFKLFMPRSTEFMSSDAELWSFLCSLKHQFSPHILRSKDVY
GYSSCRALVPDPPGPPPAANSHLARGGESPSPLLPPPPSRRPAPGAAAKRRRRGAGAARRVKKQQPALPQQPQPAPLLLLPPPRPEPSPPTPALPSPPPPLLLLPHAGRF
GGRTLEEIWKAATPVLTTFPTIRVGHDVWGERSLAAARRRAQQVLRVNLEPVVRLRRFPVATS*
17 >lcl|XP_001362659.2|Plus1253483..255459 NW_001581842 hypothetical protein LOC100009979 LOC100009979 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQPESQKSPEWSRELTPEPPGSPMSTEPCGSPREQTAVGERRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTLGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRRSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARGVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
18 >lcl|XP_001362671.2|Plus1256854..257798 NW_001581979 olfactory receptor 13C2-like LOC100009993 __SEG__ Chr6 {Monodelphis domestica} MEVTNKTILTEFILLGLSKYPKLEIFFFVLCMIIYMIVLFGNSVIILLSILDSHLHTPMYFFLSNLSFLDICYTSSFVPKMLVNFLSTRKSMSVLGCAAQMSISFAMGTT
ECVLLAVMAYDRYVAICNPLRYPIIMKRTVYVYLTALCWLIGSLNSLFQTILTMQLPFCGKNVIDHFTCEILAVMHLACVDISLNELIMLVATIILTLTPLLLIFVSYVF
ILSTILKIRSAEGRSKAFSTCSAHLTVVIIFYGTILFMYMKPKSKASLTTDKLIAMFYGIFTPMLNPIIYSLRNKDVNAAVKKMLSRKLYLQKM*
19 >lcl|XP_001362704.2|Plus12386983..2387924 NW_001581911 olfactory receptor 24-like isoform 1 LOC100012829 __SEG__ Chr3 {Monodelphis domestica} MDGRNHSAISEFILLGLSNQPEQERLLFLLFLVMYLITVLWNLLIILAIKTDSHLHTPMYFFLSNLSFIDICFTSSTVPKMLVNHISGNKAISYSGCLTQVFFFSWFAGL
DSIILASMAYDRYVAICAPLHYTMIMTPKFCAHLVAVCWFWACIDALIHTVSLTRLSFCDHNEIPHFFCDLSVVIRLACSDTFFNDLMVYIVGGLTAVMPFIGILISYTR
IFVAVLRIPSAHGKQKAFNTCGSHLAVVCLFYGTIIGVYFNPTSTHTAQKDTASAVMYTVVTPMLNPFIYSLRNNDMKGALKMLFTRKPGLSL*
20 >lcl|XP_001362720.2|Plus1573865..574806 NW_001581980 olfactory receptor 13D1-like isoform 1 LOC100012450 __SEG__ Chr6 {Monodelphis domestica} MEKGNYTPVTEFFMMGLSNYPEIQVFLYVLCLLMYLVILLGNGTLLTITILDSRLHTPMYFFLGNLSFIDICYTSSSIPQMLVNFTSKRKSMTFIGCALQLVISLGLGST
ECLLLAIMAFDRYVAICSPLRYTIIMNRGICIHMAAWTWILGFLIALVQSVLALILPFCENIIDHVACEILALLKLICVDISLNIFIMIIASIILLITPLVFIFFSYVFI
LSTILRINSTEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKDTKLFDEIFGLSYWVITPMLNPIIYSLRNKEVKEAVEKVLIRNLYLRKM*
21 >lcl|XP_001362746.2|Plus1210966..211892 NW_001581839 olfactory receptor 2D2-like LOC100010024 __SEG__ Chr1 {Monodelphis domestica} MNQTWITEFLLLGLSDDSQNQLLLFALFLVVYLVTLLGNLLLITLVLTDSQLHTPMYFFLCNLSTADLFFSTSIVPQALFNLVSRRKVISFIGCAAQLLLFLLFGCTECA
LLAVMSYDRYLAICDPMHYPLIMTWRVCGYMALGCWASGILVSLVDTTFTLRLPYQGDNRIAHFFCEPPAILALASADIHSAETAIFLMGVVILLAPLSLILVSYGSILM
TVVRMKTTSGRLKAFSTCGSHLLVVILFYGSGIISYMTPKSAKLLGKLVSMFYSVITPMLNPLIYSLKNKDVKKALRDVAIKRLLLKL*
22 >lcl|XP_001362747.2|Plus1257442..259418 NW_001581842 YTH domain-containing protein 1-like LOC100010025 __SEG__ Chr1 {Monodelphis domestica} MAASNRDEKDGDFNVLDYILGEAYDQDDSLCHPEMEQDENEERASKRRCDRMETTQRESQKSPEWSRELTPEPPGSPMSTEPCGSPREQTAVGKRRVQSRSESSTADGSQ
SLGQDVDRWHSRSQLPSKEESGCVEYDREIGSRNCSEEESGKGRRNEAEGVGEEEERDAARKDEEDGGEQEEPEERSARDLRSEAGGSFSETLSFPEGSAAAGSSTDGSE
EKKQGRKRARGIASIVFRRSPSCASESSAGPRSKHKRSSSSVAAVPEDPTRRLRYILRDARFFLIKSSNRENISLAKARGIWSTLPANEKKLNAAFRSARNVILIFSVTE
SGAFQGFARLCSESHHGGPPIHWVLPEGMNLKTVGGVFRIAWICRHELPFTKCVHLTNALNGHKPVKIGRDGQEVDLECATELCLLFPPDEGVDLYQVMGDRHHQVRVLS
PLRSRGLPPRREADRDARRRRRSEDDEVPNSRKRPRMDYAPGFRERPARREDARHPAADRRFSGVARGVFMKGSYEDDLRAFHNSRPPRPMRDMSPGRGRGQPSYRAGHQ
QRALPFQDSRSGRRPVPQEARHRGQPACDSDRRVEDFLRETRAIFGSQRRRPREWDRPGECDSSPYGRRDREAREWRERRRDEERRERRRRERRLTRCSCPEHLPFIS*
23 >lcl|XP_001362750.2|Plus1194395..195522 NW_001581910 sphingosine 1-phosphate receptor 4-like LOC100010030 __SEG__ Chr3 {Monodelphis domestica} MNLSSCYQLVDQGHPDLILQHYNHTGRLEFRGPPEEGLGWLRALFVAVSCLIILENLLVLVAITTHMRSRRWVYYCIVNITLSDLLTGVAYLANIVLSGGRTFRLTPARW
FLREGLLFMALAASTFSLLFTAVERFATMMRPVVARSTSKMVRVYGFIGLCWLLALLLGLLPLLGWNCVCDFSNCSSLLPLYSKWYILFCVVIFSLILASIMLLYGAIFR
LVRANGQKVPRGHAQCKAQRLLQTVLMILVAFLLCWGPLFGLLLADIFGTAAWAQEYLRGMDWILTLAVLNSAINPLIYSFRSREVCRAVLGFLCCGCLRLGLRGPGDCL
VRAMETHSVSSTESSLRPRDSLRTSRSLSFRMREPLSSVSSVRSV*
24 >lcl|XP_001362755.2|Plus1<268578..269558 NW_001581979 olfactory receptor 13C3-like LOC100010036 __SEG__ Chr6 {Monodelphis domestica} SSYGFLKSDEMERINRTFVTEFLLLGLSGYPRLEIIFFVLILVMYLVILFGNSVLIIASIFDSHLHTPMYFFLSNLSFLDICYTTTSIPSTLVSFLSKKKTISFTGCATQ
MFLGFAMGSTECLLLGMMAFDRYVAICNPLRYPIIMNKTVYVLMASGSWLSGGINSVVQTALAMQLPFCGNNVINHFSCEILAVLKLACADISLNVITMVVSNMAFLVLP
LLVIFFSYLFILYTILRMNSAKGRRKAFSTCSAHLTVVIIFYGTIFFMYAKPKSKDPLDKLQATDKLISMFYGVVTPMLNPIIYSLRNKDVKAAVRNLLNPKPSPQ*
25 >lcl|XP_001362842.2|Plus1293234..294196 NW_001581979 olfactory receptor 13C8-like LOC100010080 __SEG__ Chr6 {Monodelphis domestica} MNETNHPTVKEFILLSLSDYPKLETILFVLILWMYLIILLGNGVLITATIYDSHLHTPMYFFLSNLSFLDICYTTSSVPLILDSFLTPKKTISFSSCAVQMFLSFAMGAT
ECMLLSMMAFDRYVAICNPLRYPAIMSKTTYVSMAAGSWMAGAIDSIVQTSLAVQVPFCDANVIDHFVCEILAVLKLACGDITINVLSMMGSNLIFLVIPLISISISYIF
ILATILRIPSAEGRRKAFSTCSAHLTVVIIFYGTIFFMYAKPKAKDSFNSNKQDIIDKFISLFYGVVTPMLNPIIYSLRNKDVKTAVKTMLSQKCFTKKI*
26 >lcl|XP_001362883.1|Plus113975084..13975560 NW_001581968 low molecular weight phosphotyrosine protein phosphatase-like LOC100011148 __SEG__ Chr5 {Monodelphis domestica} MAAEGTRSVLFVCLGNICRSPIAEAVFRKLVADQNISDKWSIDSAATSTYEIGNPPDYRGQNCMKKHGITMNHIARQITKDDFLTFDYILCMDDSNLRDLNRKVNQVKNS
KAKVELFGSYDPQKQLIIEDPYYGNDSDFETVYEQCMRCCKTFLEKAH*
27 >lcl|XP_001362912.2|Plus1complement(627226..628164) NW_001587030 olfactory receptor 13H1-like isoform 1 LOC100012498 __SEG__ ChrX {Monodelphis domestica} MNNLETENYTKITKFILVGVSEQPMLQIILFMLGLTMYLITIIGNSLIIVVIILDARLHTPMYFFLSNLSLLDICGSTTTAPQSLINCLQDYPSISYNACYAEMGISLCF
AVTECFLLAIMAYDRFIAISNPLRYMVIMNKAVCIGLTMTSWLISFLVSVIPLLVTPVSFCGQNVVNHFACEMQAVMKLVCSDTSTSLVLIFIGSIFTLIFPFGLIIISY
LRIIVAVLRIRSAEGRRKAFSTCGSHLMVVTIYYGTLIYMYVKPQSKESEDKDKIISIFYGAVTPMLNPLIYTLRNKDVKGALKKITGQAKA*
28 >lcl|XP_001362915.1|Plus1838649..839695 NW_001587053 p2Y purinoceptor 4-like LOC100011857 __SEG__ ChrX {Monodelphis domestica} MANLDTLMLTSPGPSPGPGPGSDDMEVDCWFDEEFKFILLPVSYAVVFVLGLALNIPTLFLFLFRLHPWDATATYMFHLALSDTLYVLSLPTLIYYYAARNDWPFGTGLC
KFIRFLFYWNLYSSVLFLTCISVHRYLGICHPLRALRWGRPHIASLICLAVWLTVAVCLVPNLFFVTTSTRGATTLCHDTTKPEYFDHYVHFSSAVMALLFGLPFLVILV
CYGLMARRLWRPPPGAAHSSTRLRSLRTIAVVLTVFAVSFVPFHITRTIYYLARLLEADCQTLGIVNITYKVTRPLASANSCLDPVLYLLTGDKYRRQLQHLCCKKPNQV
PAVSSLALVSRSEDGSCR*
29 >lcl|XP_001362930.2|Plus1302379..303329 NW_001581979 olfactory receptor 13C8-like LOC100010126 __SEG__ Chr6 {Monodelphis domestica} MEGTNQTIVTEFVLLGLSNYPKIKIIFFVLVLWMYLIILLGNGVLIIVSIYDSHLHTPMYFFLGNLSFLDICYTTFTVPLTLDSFLTLRKTISFSSCAIQMFLAFAMGAT
ECVLLSMMAFDRYVAICKPLRYPVIMSKGTYVAMASVSWVAGVLNSVVQTSLAVRLPFCADNVIDHFICEILAVLKLACGDISINVLSMAGSNFIFLVIPLISITISYIF
ILNAILRIPSTEGRHKAFSTCSAHLTVVIIFYGTIFFMYAKPKSKNSIRADNDITDKFITLFYSVVTPMLNPIIYSLRNKDVKAAVKNILNQKTFH*
30 >lcl|XP_001362939.1|Plus1complement(4914454..4915938) NW_001581836 UDP-glucose 6-dehydrogenase-like LOC100010848 __SEG__ Chr1 {Monodelphis domestica} MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSATLPIYEPGLKEVVESCRGTNLFFSTDIDAAIKEADLVFISVNTPTKTYGMGKGRAADLKYIE
ACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDWVLIGGDETPEGQKAVCALSAVYEHWVPKEKILTTNTWSSELSK
LAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKATVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKK
IAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTITKDPYEACDGAHAVVICTEWDVFKELDYERIHKKMLKPAFIFD
GRRVLDDLHSELQTIGFQIETIGKKVSSKRIPYAPSSEIPKFSLQDPPNKKPRV*
31 >lcl|XP_001362986.1|Plus1complement(18781204..18782157) NW_001581990 protein sprouty homolog 2 Spry2 __SEG__ Chr7 {Monodelphis domestica} METRAQNGSGSQPFVQAPRDSGRQHGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVAPRPGLKPAPRPSTQHKNERLHGFPSEHRQLGRVQHSQTHSFVRAPLSR
SISTVSTGSRSSTRTSTSSSSSEQRLLGSSFSSSGLVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTC
VCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGLMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCRVPTVPPRNFEKPT*
32 >lcl|XP_001362989.1|Plus17497069..7500020 NW_001581996 SLIT and NTRK-like family, member 3 SLITRK3 __SEG__ Chr7 {Monodelphis domestica} MKPPMAEALQKGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFVHLNNAVSINLGN
NALQDIQSGAFSGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLSYRGMLDHI
GRSLMEIQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTELCPLLSDSEVEASLGIPQLSSSKENAWPTKPSSMLSSVHFTASSVEYKGSN
KQPKPTKQPRTPKPPPTSRGLYPGPNQPPIAAYQTRPPIPIICPTGCICSLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIERLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPLKQWIETISSVSVVGDVLCGSPENLTHRDVRTVELEVLCPEMVHLAPAGASPAMPGDVHPAGGPTGASPYEFAPPGGPVPLSVLILSL
LVLFFSAVFIAAGLFAFVLRRRRKKLPFRKRQEGVDLTGIQMQCHRLFEDGGGGGGGGGGGGVGGRPSHPSPEKAPPVGHVYDYIPHPVTQMCNNPIYKPREEEEASTVV
AGQEAGVPERGGPGTQPPGMGELLGGEQFPETSKENNSNYRTLLEKEKEWTLAVSSSQVNTIVTMNHPHPHPHPHHPAGSGVAGVVGSTGGDLAGFRHHEKNGGVVLFPP
GGGCGPSSILLDRERPQPTPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDPQTQKSEYLELRAKLQTKPDYLEVLEKTTYRF*
33 >lcl|XP_001363002.1|Plus11864944..1865891 NW_001587053 olfactory receptor 3A2-like LOC100012619 __SEG__ ChrX {Monodelphis domestica} MGLRPRYNVTSVTEFILLGLTERRELQPVLFLLFLLAYAATVGGNLGILAAILVEPKLHTPMYFFLGNLSLLDIGCVSVTVPPMLVRLLSQEQAVPFATCLSQLFFFHLL
AGVDCFLLTAMAYDRFLAICRPLTYTTRMGRGVQGVLVAASWTCSLGNALTHTVALSTLDFCGPNVVNHFYCDLPPLFSLACSSTHLNELLLFALGIIMAGVPMILIVTS
YLQVAAAVLRIRSSEGRKKAFSTCSSHLAVVGIFYGAGIFSYMRLGSVEASDQSKGVGILNTVLSPMLNPLIYSLRNPDVQGALRRVFTGQRVSV*
34 >lcl|XP_001363012.2|Plus1complement(200204..201175) NW_001581946 olfactory receptor 6C75-like LOC100010168 __SEG__ Chr4 {Monodelphis domestica} MTPGRWSELGNYSEGTEFILMGITDLRGLQLLLFAVLLPTYLLTLLGNLFIMVLSLADQRLQIPMYYLLRNFSLLEMGFTSAVTPQVLSHLLTGQKTISLPRCFSQMVLY
FILGTVEFFLLAVMSMDRYLAICYPLRYPALMTSRTCLGLVLGCWAGSFLFLSGPCIWLLLLPLCGPKVLNHFFCDSTPLLALVCTDTRPLQLFAFLVAVCTLAGALAVT
AASYTCIIWTLLHLPSAQGRHKAFSTCSSHLLVVSITYGSCIIMYLNPTLTGRLDLNKGVAFFNTTVAPLLNPFIYCLRNKLVQQVSRDMLVRGRGPSRHLRV*
35 >lcl|XP_001363015.2|Plus1complement(334340..335296) NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100010173 __SEG__ Chr6 {Monodelphis domestica} MEGANQTTVTEFVLLGLSGHPMLETVFFVLVLWMYLVILLGNGILIIVTVYDSHLHTPMYFFLGNLSFLDICYTTSSVPLVLDSFLTQRKTISFSGCTVQMFLSFAMGAT
ECVLLSMMAFDRYVAICKPLRYPVIMSKGTYVSMATGSWIAGAITSTVQTSLAMKLPFCGDNVINHFTCEILAVLKLACADILPNVISMTVADIIFLVFPVLFIFTSYVF
ILSTILRIPSAEGRRKAFSTCSAHLTVVIIFYGTIFFMYVKPKSKDSLGVTKEDVTDKFISMFYGLVTPMLNPLIYSLRNKDVKTAVKRLLGQKIFTK*
36 >lcl|XP_001363098.2|Plus1complement(355055..356011) NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100010207 __SEG__ Chr6 {Monodelphis domestica} MEGTNQTTVTEFVLLGLSGHPTLETIFFVLVLWMYLVILLGNGILIIATVYDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCTVQMFLSFAMGAT
ECVLLSMMAFDRYVAICKPLRYPVIMSKGTYVSMATGSWITGGITSTVQTSLAMKLPFCGDNVINHFTCEILAVLKLACADILPNVISMTVADIFVLVFPVLFIFTSYVF
ILSTILRIPSAEGRRKAFSTCSAHLTVVIIFYGTIFFMYVKPKSKDSLGVTKEDLTDKFISLFYGVVTPMLNPLIYSLRNKDVKTAVKSLLGQKIFTK*
37 >lcl|XP_001363108.1|Plus1901480..902628 NW_001587051 casein kinase I isoform alpha-like LOC100010218 __SEG__ ChrX {Monodelphis domestica} MASSSNSCTNNILSSEFIVGGKYKLIRKIGAGSFGDIYLAINITNNEELAVKLESQKARHPQLLYESRLYKLLQGGMGIPRTRWYGQEKEYNILVMDLLGPSLEDLFNFC
SRKFTLKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRPRNRAAGSAAGKRKRGGAAANRAQDPSFSGLNQLFLIDFGLAKRYRDNRTKQHIPYREDKNFTGTA
RYASINAHLGIEQSRRDDVESLGYVLMYFNRSSLPWQGIKAATKKQKYEKIIEKKMSIPVDILCQGFPTEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRSLSYKYDFM
FDWTLLKQKAEQEQAASSSEQGPQTQPPPPPKQTKPRRVTRRVSKQEEEQMK*
38 >lcl|XP_001363181.2|Plus1395132..396091 NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100010256 __SEG__ Chr6 {Monodelphis domestica} MEEVNQTTYVTRFVLLGLSAHPKLEKIFFVLILVMYLVILLGNGVLIIITIYDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGA
TECVLLSMMAFDRYVAICNPLRYPIIMSKSAYVPMAMGSWIAGAVNSIVQTSLAMQLPFCGDNVINHFTCEILAVLKLACADIITNVISMVVANMIFLVMPVLFIFVSYV
FIISTILRIPSAEGKRKAFSTCSAHLTVVIIFYGTILFMYAKPKSKDSLGVDKQQIADKLISLFYGVVTPMLNPLIYSLRNKDVKTAVKNMLTQKLFTE*
39 >lcl|XP_001363254.1|Plus11253406..1255409 NW_001587043 transcriptional regulator Kaiso ZBTB33 __SEG__ ChrX {Monodelphis domestica} MESRKLISATDIQYSGNLLNSLNEQRDHGLFCDVTVIVEDRKFRAHRNVLSASSTYFHQLFSVAGQVVELNFLRAEIFAEILNYIYSSKLMRIRSDLLDEIIKSGQLLGV
KFIAELGVPLSQVKSISGSIKPDSGETLSGTDENGLQMQKAENEGSDAGVTMMPVITETFSLCAEDYETKKIGTDSDEDDDVIFCSEILPPKEGLPGSTSVAQVQPDPEP
VAYADKACGTSSSPPLTNKPLQTLATSVSQTVPSQTRNSEETLKSAAPKHLTPNIILLNQPSLNSMPSSSHPSQMSPAVNLLVQNHPQIPNNATALPKHRTNVDMEAEII
DDDDDTISSSPDSGVSNTSLVPHPDTQKNVSFNGSAIQSKQVSLFHQEPLSNSLKISNVITESSKDSGGGSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYDIV
IPVKDDPDEKEAKHDNEVPKTSGDEPSNKRVKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLTC
GKSFINYQFMSSHIKSVHSQDPSGDTKLYRLHPCRSLQIRQYAYLTDRPRSIPVIKEDGIVYKVDGKEPSEGTATSTPQNKPMTWDDIFIQQGNDSMFKQNVTDGSTEFE
FIIPESY*
40 >lcl|XP_001363257.2|Plus1complement(257271..258218) NW_001581839 olfactory receptor 10A4-like LOC100010284 __SEG__ Chr1 {Monodelphis domestica} MDWGNWSIVNEFVLVSFTALHPELQILLFLLFLFIYFVTFMGNVLIILVTTADSALHSPMYFFLRNLSFLEISFNMVIVPKMLSTLLTKNTTISFVGCATQMYFFFFFGA
AECCLLATMAYDRYVAICNPLRYPVIMDQQACVQLAAASWFSGFPVATVQTSWIFSFPFCGPNKVNHFFCDSPPVIALVCADTSLFELEALTATILFILFPFLLILGSYV
RILSTIFRMPSAEGKQKAFSTCSSHLVVVSLFYSTAILTYFRHRSNTSPETKKLLSLFYTVVTPMLNPIIYSLRNSEVKAALHRTLRKALGAQKL*
41 >lcl|XP_001363264.2|Plus1327482..328453 NW_001581946 olfactory receptor 6C75-like LOC100010293 __SEG__ Chr4 {Monodelphis domestica} MTPGRWSELGNYSEGTEFILMGITDLRGLQLLLFAVLLPTYLLTLLGNLFIVVLSLADRRLQTPMYYLLRNFSLLEMGFTSAVTPQFLSHLLTGQKTISLPRCFSQMVLY
FILGTAESFLLAIMSVDRYLAICYPLRYPALMTSRTCLGLVLGCWAGSFLFLSGPCIWLLLLPLCGPKVLNHFFCDSTPLLALVCTDTRLLQLFAFLVAVCTLAGALAVT
AASYTCIIWTLLHLPSAQGRHKAFSTCSSHLLVVSISYGSCIIMYLNPTLTGRLDLNKGVAFFNTTVAPLLNPFIYCLRNKLVQQVSRDMLVRGRGPSRHLRV*
42 >lcl|XP_001363339.2|Plus1complement(279751..280698) NW_001581839 olfactory receptor 10A5-like LOC100010326 __SEG__ Chr1 {Monodelphis domestica} MAKGNWTTVNEFVLLSFSSLQPELQVLLFLLFLSIELVTLLGNTIIIVVTSADSALNSPMYFFLRNLSVLEVGFNMVIVPKMLATLLAHDTTISFLSCATQMYFFFFFGV
SECCLLTTMAYDRYVAICDPLRYPVIMSHRACVHLAAASWFSGLPVATVQATWLFSFSFCHSNKVNHFFCDSPPVLSLVCGDTTLFEIYAIIGTIVFVMIPCLFILSSYA
RIVAAILRMPSAEGKRKAFSTCSSHLVVVSLFYGSLSLLYFRPKSNNSPESKKVLSLSYTVVTPMLNPIIYSLRNNEVKAALSRTFLRAISFCKL*
43 >lcl|XP_001363342.1|Plus1408745..409032 NW_001581876 casein kinase II subunit beta-like LOC100010330 __SEG__ Chr2 {Monodelphis domestica} MLPIGLPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTDFPQTLFMVPPEYRPKPPANQFVPRLYGFKIYPMVYQLQLQAASNFKSPPQHLRL*
44 >lcl|XP_001363413.1|Plus16868677..6870803 NW_001582020 leucine-rich repeat neuronal protein 3-like LOC100010950 __SEG__ Chr8 {Monodelphis domestica} MKDMPLKIQVLLGLALTALVQGIDKKVDCPPSCTCEIRPWFTPRSIYMEALTVDCNDLGLFNFPDRLPADTQILLLQTNNIAKIENTVNFPVNLTGLDLSQNNLFSVTNI
NVRKMPQLLSIYLEENKLTELPEKCLSRLNNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNKLQMINSKWFEAIPNLEILMIGENPIIRIKDMNFKPLINLRSLVIA
SINLTEIPDNALVGLDNLESISFYDNRFVKVPHEALQKVINLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLAIDNLPDLRKIEATNNPRLSYIHPNAF
YRLPKLESLMLNSNALSALYHGTVESLPNLKEISIHSNPIRCDCVIRWINMNKTNIRLMEPDSLLCVDPPEFQGQNVRQIHFREMMEICLPLIAPESFPSNLDLEAGSYV
SLHCRATAEPEPEIYWITPSGHKLLPNTLSEKFYVHSEGTLEISDITPKDGGLYTCIATNLVGADLKSIMIKVDGSFPQDNNGSLNIKIKDIQSNSVLVSWKANSKILKS
SVKWTAFVKTENSYAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQQNKKQCINVTTKGLDLDLKGYEKNNVTAFIACLGGLLGVISVICLFSCISQEMNCDAGHS
YVRNYLQKPTFAFSELYPPLISLWDSRKEKSTALEVKATVIGVPTNIS*
45 >lcl|XP_001363422.2|Plus1460199..461134 NW_001581839 olfactory receptor 2D2-like LOC100010371 __SEG__ Chr1 {Monodelphis domestica} MNQTNQTWVTEFFLLGLSDDPQTQVLLFALFLVVYLSTMLGNLLLTSLVLLDSQLHTPMYFFLCNLSLTDLCFSTTTVPQSLIHMLSRRKLISFTGCAGQVLFFLFFGST
QCVLLGVMSYDRYLAICDPMHYPLIMTWKVCGLLALGCWSAGFVASMVDSIFILSLPYQGDNQIAHFFCEAPALLVLASADTHSTNMVIFLMGSVIIVTPMFLILISYVC
IIISVIRMKTASGRLKAFSTCGSHLTVVIIFYGSAIIKYMTPKSSKDIGKVISVFYAVISPMLNPLIYSLRNNDVKRAFRNVANSRPFCRI*
46 >lcl|XP_001363461.1|Plus1complement(8636150..8637919) NW_001581896 ectoderm-neural cortex protein 1-like LOC100011601 __SEG__ Chr3 {Monodelphis domestica} MSVSMHENRKSRASTGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQSSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTISKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLSKRHCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEQYDPVTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
47 >lcl|XP_001363535.1|Plus11979948..1981000 NW_001581903 sphingosine 1-phosphate receptor 2-like LOC100012444 __SEG__ Chr3 {Monodelphis domestica} MGSPYEDYLNPDKVFEHYNFTKETLATPDTSSRQAFSVFIVLVCCAIILENLLVLVAVARNSKFHSAMYLFLGNLAASDLLAGVAFMANTLLSGPRTLQLTPVSWFAREG
SAFIALSASVFSLLAIAIERHVAITKVKVYGSDKSFRMLLLIGACWVISVALGGLPILGWNCLGHLDACSTVLPLYAKSYVLFVVTVFTAILLAIVALYVRIYCVVRSSH
AEVAVPHTLALLKTVTIVLGVFIVCWLPAFTVLLLDTSCPVRACPILYKAHYFFFFAMFNSLLNPVIYTWRSRDLRREVFRPLCCWEQRAQQARGGTPGRCLLPLRSSSS
LERGTQMPTSPTFMEGNTVV*
48 >lcl|XP_001363578.2|Plus1552865..553797 NW_001581839 olfactory receptor 2D2-like LOC100010459 __SEG__ Chr1 {Monodelphis domestica} MSQMNQTWITEFLLLGLSDDSQTQLLLFVLFLVIYLVTVLGNLLLITLVLTDSQLHTPMYFFLCNLSTADLFFSTTIVPQALFNLSRRKVISFIGCAAQILLFLLFGCTE
CALLAVMSYDRYLAICDPMHYPLIMTWRVCGYMALGCWTTGILVSLVDTTFTLRLPYQGDNRIAHFFCEPPAMLALASADIHSAETALFLMGVVILLAPLSLILVSYGSI
LMTVIRMKTTSGRLKAFSTCGSHLLVVILFYGSGIISYMTPKSAKLLGKLVSMFYSVITPMLNPLIYSLKNKDVKKALRVVSIKRLFVKL*
49 >lcl|XP_001363581.2|Plus1complement(512274..513227) NW_001581876 olfactory receptor 2T2-like LOC100010462 __SEG__ Chr2 {Monodelphis domestica} METLYQNSTDFIFLGLFANSKIPGLIFTILLSIFVVAIMANVVMILLIHVDSKLHTPMYFLLSQLSVMDTVYICITVPKMLADILSEEKNISFLGCAVQIFLYLTLFGSE
SFFLGLMAYDRYVAVCNPLHYPLLMNHRVCLLMVIGSWIGGSLDGFMLTPVTMSFPYCGSRKINHFFCEIPAVLKLSCADTSLYETLMYACCVLMLVVPISLISFSYIRI
LITVTQMKSAEGRHKALTTCSSHIMVVSIFYGAAFYSNVLPRSFHTPEKDKIVSAFYTILTPMLNPLIYSLRNKDVSAALKKALRKCASSQEIQVRD*
50 >lcl|XP_001363634.1|Plus1complement(16090416..16092446) NW_001581976 zinc finger and BTB domain-containing protein 5 ZBTB5 __SEG__ Chr6 {Monodelphis domestica} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFTVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSDRVQEQNARMQRSFMLQQLGLSIVSSALNSSQSTEEQQTTMNLSMRSNIEQRTTFPIRRFHKRKQSSEDRARQRMRPTLDESMISDVTPE
NGQAVVHSREEFFSPDSLKIVDNSKSDSVTDNQEDNAIMFDQSFNGQEDAQMPSQSDNTAGNISQMSMASQATQVETSFDQEATSEKNGFQCENTEVGLSEKDHMRVVVK
SEPLSSPEPQDEVSDVTSQAEGSESVEVEGGVVSAEKIELSPESSDRSFSDPQSSTDRVGDIHILEVSNNLEHKSTFSISSFLNKSRSSTFSANQNNDDNIPNTTSDCRM
DNDTSYLMSPESGPTSGHSSAAVSHVENPFSEPADSHFVRPLQEVMGLPCVQTSGYRAAEQFGMDFPRSGLGIHSLSRAMMGSSRGGASNFPGYRRIAPKMPVVTSVRSS
QIQDNSANSQLLMNGPTSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL*
51 >lcl|XP_001363650.1|Plus110355788..10356576 NW_001582021 leucine-rich repeat-containing protein 61-like LOC100014349 __SEG__ Chr8 {Monodelphis domestica} MEPLGERAGQGDRVHITAPMLKALTGEFSLESILLLKLCGLGLVDLGCLGECLGLEWLDLSRNILTHLGPLASLRQLAVLNVSANRLTGIEPLASCESLQSLNVAGNLLA
GVGQLQCLAGLQRLEHLRLQDPLARLSNPLCNSSSYRADVWELLPGLKVIDGERASGKGSEFYQLCRDLDKSLHRSPGPVADLASCEAKPWVEPSYWKSPQDQDNSILED
ACRQFQDTVQEFQELSQKADDTLAQAEKALRPASGNSTSFVF*
52 >lcl|XP_001363657.2|Plus1589747..590682 NW_001581839 olfactory receptor 2D2-like LOC100010506 __SEG__ Chr1 {Monodelphis domestica} MSDTNKTWVTEFFFLGLSDDLQIQQLLFILFLIVYLVTVLGNLLLISLVLIDSQLHTSMYFFLCNLSLADLCFSTCIVPQVLAHMLSKRKVISFTGCAAQLLFSIFLGGT
ECALLAVMSYDRYLAICDPMHYPIIMTSRLCGHLALGCWVSGILVALVDTTFTLRLPYQGDNRIAHFFCESPALLALASADTHSSKMAIFLMGSVILLAPVSLILASYGS
IIVTVIKTQTTSGRRKAFSTCGSHLLVVIVFYGSAIINYVTLKPSKEQAKVASVFYAVINPMLNPLIYSLRNKDVNKALRKVVKKRKLFIS*
53 >lcl|XP_001363737.2|Plus1649467..650402 NW_001581839 olfactory receptor 2D2-like LOC100010540 __SEG__ Chr1 {Monodelphis domestica} MSDINKTLVTEFFFLGLSDDLQIQLLLFILFLIVYLVTVLGNLLLISLVLIDSQLHTSMYFFLCNLSLADLCFSTCIVPQVLAHMLYRRKVISFTGCVAQLLFSLFLGCT
ECALLAVMSYDRYLAICDPMHYPIIMTSRLCGHLALGCWVSGILVALVDTTFTLRLPYQGDNRIAHFFCESPALLALASADTHSSKMAIFLMGVVILLAPVSLILASYGS
IIVTVIRMKTTSGRRKAFSTCGSHLLVVIIFYGSAIINYMTLKPSKEQAKVVSVFYTVINPMLNPLIYSLRNKDVNKALRNIAKKRKCFIS*
54 >lcl|XP_001363741.2|Plus1593610..594572 NW_001581876 olfactory receptor 2T29-like LOC100010544 __SEG__ Chr2 {Monodelphis domestica} MKQTMWLENHTLGTDFILMGLFSQSKHPTLLCSVIFIIFMVALIGNATLILLIQRDSHLHTPMYFFISQLSLMDMMYISVTVPKMLLDQVTGTHSISTPSCGIQMFLYVT
LVGTEFFLLAAMSYDRFVAICHPLRYPILMNHRVCILLVTVCWFLGSIDGFMLTPITMNFPFCKSREIQHFFCEVPALMKLSCSDTSVYETVMYLCCVLMLLIPITVISG
SYSLILLTVHRMNSATGRRKAFATCSSHMAVVILFYGAAIYTYMLPSSYHTTEKDMIVSVVYTILTPVLNPLIYSLRNKDVTAALKKVLWEELVLANLQK*
55 >lcl|XP_001363759.2|Plus1complement(471326..472477) NW_001587052 type-2 angiotensin II receptor-like LOC100010566 __SEG__ ChrX {Monodelphis domestica} MTSELSSQRFQADISLTPFAIKNNYSSSTKSENMVNDPYIGPINTSNNNTSTAKCLLKLSGYHLAFIPVLYYIIFVLGLIGNSVVVSLFCCHRGPKKVASIYIFNLAMAD
LLFLATLPLWATYYSYGYNWFFGSVMCKISSALLCLNMYASVFFITCMSIDRYQAVVYPFQSQRRTPWQMSFIVPLVWGLACVSSLPTFYFRDTKPIEHLGVNACIMAFP
PEQYSQWSAGMAFMKNALGFVIPLVFIATCYAGIRKHLMKASGFGKNQLMRDRVLKMAAAVVLAFVICWLPFHVLTFLDTLAWLHVITNCDVISAIDTAMPFGICMGFAN
SCINPFLYCFVGNQFQERCRRLFKLRVSQLRKNRDSMSSRKGNSLKEVETLME*
56 >lcl|XP_001363813.1|Plus1complement(9317092..9318204) NW_001582020 probable G-protein coupled receptor 85-like LOC100011315 __SEG__ Chr8 {Monodelphis domestica} MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFTSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAF
MLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQF
VAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLALWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFA
QAGINPFVCIFSNRELRRCFSTTLLYCRKSRLPREPYCVI*
57 >lcl|XP_001363824.2|Plus1682276..683211 NW_001581839 olfactory receptor 2D2-like LOC100010583 __SEG__ Chr1 {Monodelphis domestica} MSQTNKTWVTEFLLLGLTDDSQTQLLLFVLFLVVYLITVLGNLLLISLVLYDSQLHTPMYFFLCNLSTADFCFSTTIVPQALVHMISRRKFISFMGCAAQLLFILLFGCT
ECALLAVMSYDRYLAICDPMHYPLIMTWKVCIKLALGCWVSGILVSMVDTTFTLQPPYQGENRIPHFFCEPPALLALASADTHSSQMAIFLMGVVILLAPVSLILVSYGC
IIITVVRMKTTSGRLKAFSTCGSHLLVVVIFYGSAIISYMTPRTAKEQGKLVSVFYAVITPMLNPLIYSLKNKDVKKAFRNAVIQGPLQRF*
58 >lcl|XP_001363879.1|Plus18523968..8525557 NW_001581963 DEP domain-containing protein 1B-like LOC100013426 __SEG__ Chr4 {Monodelphis domestica} MEHRIIGPGPYRATKLWNETIELFRSNMPLRKHRSHFKSYERCFTASEAVDWLHVLLRHSQNFGPEVTRKQTVQLLKKFLKNHVIEDIKGRWGQEDFEDNRHLYRFPPSS
PLKPYPKRSPHQASVIRFPDWTHEPPGTSQENIPVRPIVMNSESWYKRHSIAIGEVPACRLVYRRQLTEANVEEIWKSMTLSHLQKILDLDSLEEVLDTKLVNSKFIIHN
VYSVSKQGVVILTDKSKELPHWVLSAMKCLANWPNCSDLKHPMYSGFEKDVFKTIADYYGHLKEPLLTFQLFDAFVSVLGLLQKEKIAIEAFQICCLLLPPENRGKLQLL
IRMMVKICLNKEMPPLCDGLGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNHQEILQAPSSLQNSIEERVAHLRRVQIKYPGADTDATLSAPPFCRQISPEEF
EYQRVCGSQEPLEKLLEEIIMDSKLSVKDKKKKLKQFQKSYPEVYQERFPTPESEALIFPEKSKPKPQLLMWALKKPFQPFQRTRSFRM*
59 >lcl|XP_001363880.1|Plus112468603..12469457 NW_001581965 protein phosphatase 1 regulatory subunit 3B-like LOC100013167 __SEG__ Chr5 {Monodelphis domestica} MAVDIEYRYGCVASPLLRDRFPCKISPKASKPLRPCIQLSGRSEASGVVALPVQEKKAKKRVSFADGRGLALTTVKVYSEFDDPLDIPFDITALLENIVTLTTAECESFV
LDFEQPSADYARFRRRLQAERVCLENCVLKDKALSGTVKVQNLAFEKRVKVRITFDTWKSFADVECQYVKDTYAGSDRDTFSFCIGLPDKVQPYERMEFAVCYECSGRTY
WDSNQGRNYRIVQAELQGCQGGGPAPGGADLGISFDHFGSPRCSYGLYPEWPSYLGYERLGPYY*
60 >lcl|XP_001363915.2|Plus1624180..625142 NW_001581876 olfactory receptor 2T29-like LOC100010631 __SEG__ Chr2 {Monodelphis domestica} MKQTIWLENHTLGTDFILIGLLSQSKYPTVSSSVIFIVFIVAVTGNATLILLIYCEPHLHTPMYFFISQLSLMDMMYSFIIVPKMLLDQVTGIHNILIPSCGMQMFLYLT
LVGAEFFLLAAMSYDRFVAICHPLRYPILMNHRVCKFLIIGCWFLGSIDGFMITSITMTFPFCKSREIQHFFCETPALTKLSCSDTSFYKIAMYLCCFLMILIPVIVILG
SYSLILLTVYRMNSVTGYKKAFSTCSSHMIVVILLYGAAAYNYMLPPSYHTAKKDMMVSVFYTIITPALNPFIYSFRNKDITGSLRKLLAVKRVTGTYGE*
61 >lcl|XP_001363925.1|Plus14496492..4497256 NW_001581990 coiled-coil domain-containing protein 70-like LOC100010645 __SEG__ Chr7 {Monodelphis domestica} MVVLGSKWIVKGQLSRLFPSLTPEQSQLHLEQQQQQYEVKKNLWRDNKIFRDENKALRKENKFLWIENKALQGENKTFRIENQVLRESNQSLRQQNQMLWEDKRVVWEHT
KALYEKSNALSKEKKAFLEQNRALQAQIKALQEQERAFQNEEKALQEEIKSLHEEIKALQHQKSALNMEEQALWKEGKALRLEEQALWKEEQALREENKALREENNALQE
EERALREEANILEEWNKILKGDGENTTPTYEIVE*
62 >lcl|XP_001363959.1|Plus1complement(7408221..7409168) NW_001581928 olfactory receptor 52K1-like LOC100013918 __SEG__ Chr4 {Monodelphis domestica} MSGWNMTFNISYTTFFLLGFPGLRESRSLLILPFSCLYMVILSSNGLIIYIVTTQRSLHQPMYILISLLLAVNICTATTVVPIMLFSFSTHLNRISFTCCLVQMFFIYCL
LVFDCNILLVMALDRYIAICYPLRYTEIMTGQVLMGLVGVAATRSVGIVAPVVVLASRVHFCRSNVIHHFTCEHMALMKLSCGDISLNKTVGLALRVSNRILDLLLLGSS
YTRIIHAAFRISSGGARSKALHTCGSHLLVIFTVYGSTLSSSIVYRVARTASQDVHNLISAFYLLIPSLVNPVIYGARTKEIRQQLAKLFQRERS*
63 >lcl|XP_001363979.1|Plus124093545..24094666 NW_001581989 probable G-protein coupled receptor 45-like LOC100014540 __SEG__ Chr7 {Monodelphis domestica} MACNNTPLETYDSLLLNMSSLSPASRSVVLSTPFRILLALVMMLMIAIGFLGNAIVCLIVYQKPAMRSAINLLLATLAFSDIMLSLCCMPFTAVTMITVNWHFGAYFCRF
SAMLYWFFVLEGVAILLIISVDRFLIIVQRQDKLNPRRAKMMIAASWALSFCISFPSLVGWTFVEVPTRAPQCVLGYTEFLADRAYAVILVVTVFFVPFIIMLYSYLCIL
NTVRRNAIRVHNHTESLGLSRESKLGLMGLPRSYPLNVDMSFKTRAFSTILILFIGFSFCWLPHTIYSLMSVFSRKFYYSSSFYITSTYVLWLSYLKSVFNPVIYCWRIK
KFREACVELLPKTFKILPKVPGRTTRRIQPSTIYVCSEHQSAV*
64 >lcl|XP_001363997.2|Plus1705666..706601 NW_001581839 olfactory receptor 2D2-like LOC100010666 __SEG__ Chr1 {Monodelphis domestica} MNLSNQTWVTEFFFLGFSDDPQTQLLLFISFLIIYFVTALGNLLLIILVLADSKLHTPMYFFLCNLSVADLCFSTSIVPQALVHMLTRRKIISFMGCATQLFLFLIFGCT
GCALLSVMSYDRYLAICDPMHYPLIMTKKVCVQLALGCWVSGVVVSIVDTTFTLQVPYRGENKISHFFCEAPALLALGSADTYRAEKVIFIMGVVILLAPVSLILVSYGS
IIVTVVRIKTTSGRLKAFSTCGSHLLVVTIFYVSAIMTYMTPKSSKEQGKLVSVFYAVIAPMLNPLIYSLRNKEVKRALRNTITKGQICKL*
65 >lcl|XP_001364038.2|Plus17940576..7941517 NW_001581928 putative olfactory receptor 52P1-like LOC100014688 __SEG__ Chr4 {Monodelphis domestica} MTPNNRSHVHPTSFILMGVPGLEASHFWIAFPFCSMYILAVLGNLFVLLVVWMEPGLHQPMYLFLCMLSALDLVLCTSTVPRMLALFWAGVAEITFGACATQMFFIHGFS
AVESGILLAMAIDRYVAICRPLHYGTLLPLGTVGRMGLAAVLRGLGLMTPLTCLLGRLRYCRWVIEHSYCEHMAIVKLACGNTRANNVYGITAATLVVGTDSICIAISYA
LILRAVLALSSKEARAKTFGTCGSHLGVILLFYTPGLFSFYTQRFGQHVPHHVHILLADLYLVVPPMLNPIIYGMKTKQIRDGALRLLQRRPA*
66 >lcl|XP_001364051.2|Plus1complement(5861125..5862063) NW_001581980 olfactory receptor 15-like isoform 2 LOC100014318 __SEG__ Chr6 {Monodelphis domestica} MGGTNMSSFKGFILKGVSDHPQLEMIFFVAILFSYLLTLMGNLTIILISRLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLMNLWGPDKTISYGGCITQLYVFLWLGAT
ECILLVVMAFDRYVAICRPLHYMTIMNPRLCWQLAAIAWLGGLGNSLIQSTFTLQLPLCGHQEVDNFLCEVPALIKLACGDTNLNQALLNGVCAFFTAVPLSIILISYGY
IARAVLKIPSAAGRRKAFNTCGSHLIVVFLFYGSAIYAYLLPAKSSSQDRGKFISLFYSVVTPMVNPLIYTLRNKEVKGALRRLLGKGREQG*
67 >lcl|XP_001364073.2|Plus1728735..729682 NW_001581839 olfactory receptor 2D2-like LOC100010708 __SEG__ Chr1 {Monodelphis domestica} MNQTNQIWVTEFLLLGLSDDPQTQLLLFVLFMGVYLVTMLGNLLLISLVLIDSQLHTPMYFFLCNLSFADLFFSTNIVPQALVHLLSKRKVISFIGCAAQLLLFLIFGCT
QCALLSVMSYDRYLAICDPMHYPLIMTWKVCSQFSLGCWVSGILVSLVDTTFTLQLPYQGDNKIAHFFCEAPALLVVASADIHKAETAIFFMRVMILLAPVSLILVSYGA
IIVTVVKMKTTSGRLKAFSTCGTHLLVVILFYGSAIITYMTPKSSKKQGKLVSVFYAVINPMLNPLIYSLRNKDVKRAFRNVINRGKLFRFILSL*
68 >lcl|XP_001364079.2|Plus1752731..753687 NW_001581876 olfactory receptor 2T1-like LOC100010714 __SEG__ Chr2 {Monodelphis domestica} MDGYNTTSSTDFTLVGLFSNRETSGLLFAIICAIFFTALLANGIMIFLIYTDLHLHTPMYFLLSHLSFIDMMYISTIVPKMLVDYLLGQRTISFVGCTAQHFLYLTLVGA
EFFLLGLMAYDRYVAICNPLRYPILMNRRVCLMIIAGSWFGGSLDGFLLTPITMSFPFCDSRKINHFFCEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVIASYAR
ILTTVHQMSSVEGRKKAFATCSSHMTVVTLFYGAAMYTYMLPHSYHTPAQDKILSVFYTILTPMLNPLIYSLRNKDVAGAMKRVLGKCKASHRVAGTF*
69 >lcl|XP_001364087.1|Plus13797014..3798090 NW_001581989 p2Y purinoceptor 8-like LOC100010727 __SEG__ Chr7 {Monodelphis domestica} MNSNISQPDNETIIMLGNPTIGVALPIVYSVVALISIPGNFFSLWILCCHTKPKSPSVIFMINLCITDLMLAVALPFQIFYHLNSNNWPFGKFLCNLVTVVFYTNMYSSI
LTMTCISVERFLGVVYPLTSTRWRRKRYAVLTCLGIWLLLLLALSPLAITDLTYEVKALGIVTCFDVLKWNMLPSLAMWAIFLFTLFIFLFFIPFIVTVACYIATILKLI
RTSERYGNGQKSRSICLAGIVLLAFVTCFAPNNFVLLVHMISRLYFHKSYYHIYKLTLCLSCLNNCLDPFIYYFASKEFHQKLKKFLGKNALFSDSSEARRESLFSARTL
SARSMSSGQVEGSAGGSRACLKRQESLF*
70 >lcl|XP_001364107.1|Plus114941550..14942614 NW_001581879 membrane progestin receptor beta-like LOC100013708 __SEG__ Chr2 {Monodelphis domestica} MTTAILERLSTLSVSGQQLRRLPKLLEDGFPKMPCTVPESDVPQLFREPYIHTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFRAFAETEALPWTSAHSL
PLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDPAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FVLDISPVAHRVALCHLSGCQEQAAWYHTLQIFFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRQEIFLQRHSPLSVYLACLSFFLL
AACSGTTAAFLRRKIKAGLTKKDS*
71 >lcl|XP_001364121.2|Plus1complement(9401468..9402496) NW_001581963 olfactory receptor 8D4-like LOC100013754 __SEG__ Chr4 {Monodelphis domestica} MSNNGKYYFVYCVSSFLHRVASLKLCKTMASLNHSTVTLFILEGLTDQPELQVFLFVLFLGIYVVTVVGNLGMILLIGIGPQLKSPMYYFLSNLSFVDLCYSSAITPKLL
VNFIEDKNIISYNECMTQLFFFCFFIVSEFYMLTAMAYDRYVAICSPLLYNVIMSPRVCCFLATAVYTMGTFAALVHTSCMVRLSFCGPNIIKHYFCDIIPLLKLSCSST
YLDELLLVVVGTFNVFSTTIAIFISYAFILSSILSIQSAEGRSKAFSTCSSHLAAVAILYGTVIFMYLKPPSSSNMTQEKVASVFYTTVIPMLNPLIYSLRNKDVKDVLK
KIMRCTMHNTSM*
72 >lcl|XP_001364157.2|Plus1752932..753867 NW_001581839 olfactory receptor 2D2-like LOC100010754 __SEG__ Chr1 {Monodelphis domestica} MNQTTHFRVTEFLLLGLSDDPKIQLLLFILVLGVYLVTVLGNLLLIFLVLTDTQLHTPMYFFLCNLSTADLFFSTNIVPQALVHMLSKRKVISFIGCAAQLLLFLIFGCT
QCALLAVMSYDRYLAICDPMHYSLIMTGRLCCLLSLGCWISGFLVSIVDTTFTLHLPYQGDNKISHFFCEAPAILAIASGDTHSSKMAIFLMGVVILLAPVSLILVSYGS
IIVTVIRMKTASGRLKAFSTCGSHLLVVILFYGTGIMTYMTPKSSKEQGKLVSVFYAVINPMLNPLIYSLRNKDVKRAFRNATNRGKICKL*
73 >lcl|XP_001364160.2|Plus1786797..787747 NW_001581876 olfactory receptor 2T27-like LOC100010757 __SEG__ Chr2 {Monodelphis domestica} MEWGNYSMYADFVLLGFFSNTKFPWLFFSLIFLVFVISVVSNVIMIILIHIDPRLHTPMYFLLSQLSIMDILYISTIVPKMLVDQLMGQKTISFAGCTAQHFLYLTLAGA
EFFLLGLMSYDRYVAICNPLRYPVLMNRKVCLLIVTAAWLGGSVDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSCTDTSTYETAMYVCCIMMLLIPFSVISASYTR
ILITVYRMSEAEGRRKAVTTCSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGALKKALGQCFSRRIRVF*
74 >lcl|XP_001364182.1|Plus115185852..15186907 NW_001581872 protein Tob1-like LOC100012985 __SEG__ Chr2 {Monodelphis domestica} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGDKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPTNLGLNVNDLLKQK
AISSSMHSLYGLGLGGQQQPQQQQQQQQQQQQQQQQQQQPSQQQQQQQQKTSALSPNAKEFIFPNMQGQGSNNGMFPGDSPLNLSPLQYSNAFDMFAAYGGLNEKSFVDG
LNFSLNNMQYSNQQFQPVMAN*
75 >lcl|XP_001364196.2|Plus18470617..8471558 NW_001581928 olfactory receptor 51F2-like LOC100015564 __SEG__ Chr4 {Monodelphis domestica} MLPFINTTASLTFLLTGVPGLEAFHTWISIPFCCLYATALSGNSMILFVIITEPSLHEPMYYFLSMLSTTDLGLSISTLVTMLGIFWFNAREISFNACLAQMFFIQLFTV
MESSVLLAMAFDRFVAISNPLRYATILTESRIAQIGVVIVTRGTVILTPMVVLLKRLSYCSSHVLHHSYCFHPDVMKLSCTDTKVNSAVGLAALISTAGVDSIFILLSYV
LIIKTVLSIASPMERQKAFSTCISHIGAVAIFYIPLISLSFVHRFGKQAPPYVHTLIANAYLLIPPVMNPIIYSVKTKQIRKAVLKVLLPKGS*
76 >lcl|XP_001364236.2|Plus1821169..822128 NW_001581876 olfactory receptor 2T11-like LOC100010797 __SEG__ Chr2 {Monodelphis domestica} MKPENQTSSSGFILLGLLVDDKISGIVFAIILSIFVVALTANVVMIFLIQVDSRLHTPMYFLLSQLSVMDTLFICTTVPKLLIDMISEEKTISFVGCGIQIFLYLTMIGS
EFFLLGLMAYDRYVAVCNPLRYPVLMNRRMCLLLAAGSWFGGSLDGFLLTPITMNVPYCGSRTINHFFCEIPAVLKLACADTTLYETLMYICCVLMLLIPISIISTSYSL
ILLTVHRMRSADGRKKAFTTCSSHLTVVSIFYGAAFYTYVLPRSYHTPEKDKVVSAFYTIVTPMLNPLIYSLRNKDVMGALKKVLFKCSPTQKLTASAA*
77 >lcl|XP_001364249.1|Plus15611498..5612475 NW_001581837 transmembrane protein 121-like LOC100012949 __SEG__ Chr1 {Monodelphis domestica} MVLPPPDKRHVCLTTVVIMSSMAFMDAYLVEQSQGPRKIGVCIIVLVGDVCFLLVLRYVAVWVGAEVRTAKRGYAMILWFLYIFVLQIKLYFIFQNYKAARRGAADPVAR
KALTLLLSVCVPGLFLLLVALDSMEYVRTFRKKEDLRGRLFWVALDLLDLLDIQANLWEPPRTGLPLWAEGLMFFYCYMLLLILPCVSLSEISMQGEHISPQKMMLYPVL
SLVTVNVVTVLVRAANMVLFHDSRVSTIFIGKNVVALATKTCTFLEYRRQVRDFPPPHGALALELQPPQPPPPQLLHNSVPHAPPIHSGPGAPHGPSPTRDTLDT*
78 >lcl|XP_001364251.1|Plus121702024..21702761 NW_001581839 calpain small subunit 2-like LOC100014811 __SEG__ Chr1 {Monodelphis domestica} MFLAKALLEGAEKGLGEALGGVRGGGGQKGKGHLADLVGGIVNLISEASAAKYTPEPPPPYQHFTNVEASESDEVRQFRRVFYRLAGDDMEVGPADLMNILNKVISKHRE
LNTDGFSLDTCRSIVAVMDSDATGKLGFEEFKYLWNNIKKWQCVYKQYNTDHSTSLGGGQLKQAIQAAGFQLHEQLYQMIIRRYTEEDGSMEFTSFISCLVRLDAMFRAF
KSLDGDRDGQVQVNIQEWLELTMYS*
79 >lcl|XP_001364274.1|Plus1complement(8875076..8876011) NW_001581928 olfactory receptor 51A7-like LOC100016367 __SEG__ Chr4 {Monodelphis domestica} MSTLNISEGIVSTFILIGIPGLEHIHIWISIPICLMYIIAALGNCTILFIIKTEPSLHEPMYYFLSMLAISDMGLSFSSLPTMLKIFVFNSPAIFPNACFAQEFFIHGFT
DMESSVLLIMSFDRFLAIRNPLRYSSILTSARVTQLGLVLAIKSILLVLPLPFILKRLIYCKKRLLSHSYCLHQDVMKLACSDNQVNFIYGFFVALCMMSDFVFIVISYM
LILKTVLSIASHGERLKALNTCVSHICAVLIFYVPIITLAAMHRFAKHKSPLAMIIIADVFLMVPPLMNPIVYCVKTRQIREKILGRLGLK*
80 >lcl|XP_001364349.1|Plus1complement(91507..92448) NW_001581929 olfactory receptor 51A7-like LOC100016845 __SEG__ Chr4 {Monodelphis domestica} MSTLNITEDEISTFFLTGIPGMEHVHIWISIPICLIYIIAALGNSTILLLIKTEPSLHEPMYYFLSMLAFSDLCLSFSSLPTMLRIFLFNATGISTDACIAQEFFIHTFT
AMESSVLVIMSFDRFIAIRNPLRYSSILTSVRVVQIGLIFAIRCFIFILPFPITLRKLRYCKGNHLSYSYCLHQDIMRLACSDNRINVIYGFFIAILSMLDFSVIVMSYV
LILKTVLGIASHQERLKALNTCVSHFCAVLIFYMPIISLSIVHRFAKHGSPIIRILIADIFLLVPPLMNPIVYCVKTRQIRERVLGKLGLKKT*
81 >lcl|XP_001364385.2|Plus1812240..813160 NW_001581839 olfactory receptor 2D2-like LOC100010870 __SEG__ Chr1 {Monodelphis domestica} MNQNNRTWVTEFFLLGLSGDPQTQLLLTVLFLGVYLGTVLGSLLLIYLVLTDSQLHTPMYFFLCNLSLADLGLSTVIVPQAIIHMLTRRNAISFMGCAAQIFFSIISGAT
QCSLLAVMSYDRYVAICDPMHYSLIMTGKVCGQLALVCWVSGIVASSVDTIFTLCLPYQGDNRIAHFFCEAPVLLTLASGDTHKAEMAIFFVGVWILIAPMSLILVSYGL
IIVTVIRMNTMSKRLKAFSTCGSHLLVVILFYGTLIIGYMTPKSSREQFKQVAVFYGVINPMLNPLIYSLRNKEVKRAFKNAIKRK*
82 >lcl|XP_001364390.2|Plus1complement(897571..898518) NW_001581876 olfactory receptor 2W3-like LOC100010875 __SEG__ Chr2 {Monodelphis domestica} MMDGTNESIQDDFILLGFSDRPQLEVVLFVVILIAYLLTVVGNTTIILLCHIDPRLSSPMYFFLTHLSFLDLCFTTSSIPQLLYNLNGPDKTISYTGCAFQLFLFLALGG
VECLLLAVMAYDRFVAVCKPLHYMVIMYPKLCLGLVSIAWFGGVLNSLTMSPITLKLPRCGHNKVDHFLCEMPALIRLACVNTAIIEGTVFVLAVIIVLTPLVLILVSYG
YITQAVVQIKSAVGRRKAINTCSSHLIVVSLFYGNIIYMYMQPGNNASQDQGKFLTLFYNIVTPLFNPLIYTLRNKEVKGALRRLLGEKKGRREK*
83 >lcl|XP_001364431.1|Plus1complement(158674..159609) NW_001581929 olfactory receptor 51A7-like LOC100016960 __SEG__ Chr4 {Monodelphis domestica} MSAFNTSEIQISTFLLIGIPGLEHVHIWISIPICLIYIIATIGNCIILLLIKTESSLPMYYFLSMLAISDLGLTLSSLPTMLRIFLFNATRISIDACIAQEFFIHTFTAM
ESSVLLIMSFDRFIAIRNPLRYSSILTNTTIIKIGFILAIRCLVFILPFPITLKRLRYCNRNLLSHSYCLHQDIMRLACSDNRVNVIYGFFVTVIGMLDLAIIAMSYILI
LKTVLGIASHQERLKALSTCISHICAVLIFYVPVVTLSIIYRLAKHGSPLIRILIADIFVLFPPMMNPIVYCVKNHQIQEKVIRKLCLKEA*
84 >lcl|XP_001364506.1|Plus1350674..351606 NW_001581929 olfactory receptor 52J3-like isoform 1 LOC100017286 __SEG__ Chr4 {Monodelphis domestica} MSQPNATTFHLNTFILLGIPGLEDIHIWLSLPFCSFYLVAILGNVTILLVIWNEKKLRDPMFYFLAFLSSTDLALSTTSVPRMLGIFWFGAHEISFGACMTQMFFIHSFT
GMESGVLFFMAFDRYVAICTPLRYTTILTPRVLTGIGMIIVLHPVLLMIPVITLACRLPFCQARVIAHSYCEHMGIIKLACANIRVNAIYGLFAASFLVVDLVLIGVSYV
YILRTVFRLPSHDARLKALSTCGSHVGVMCVFYTPAVFSFLTHRFGHRIPPYVHILIANLYMSIPPALNPVIYGVRTKQIRERVLLFITG*
85 >lcl|XP_001364523.1|Plus129386562..29388712 NW_001581982 leucine-rich repeat neuronal protein 1-like LOC100013170 __SEG__ Chr6 {Monodelphis domestica} MAKISFALVVCHLVLELLMNSLTESSIQSNECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNLSGDTQVLLLQSNNIAKTSDELQQLFNLTELDFSQNNFTSI
REVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISSISANAFSGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLSNLRSL
VLAGMYLTDIPGNALVGLDSLESLSFYDNKLVTVPQLALQKVPNLKFLDLNKNPIHKIQEGDFRNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHR
LAFRNVPALESLMLNNNALNAVYQKTVESLPNLREISIHSNPLRCDCVIHWVNSNKTNIRFMEPLSMFCAMPPEYRGQQVKEVLIQDSSEQCLPMISHDTFPNHLNMDIG
MTVFLDCRAMAEPEPEIYWVTPLGNKITVETLSDKYKLSNEGTLEITSIQIEDSGRYTCVAQNIEGADTRVATIRVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVM
TSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYVAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWDGDSEKDKDGSAETKPTQVDTSRSYYMW*
86 >lcl|XP_001364543.2|Plus11040949..1041893 NW_001581876 olfactory receptor 11L1-like LOC100010956 __SEG__ Chr2 {Monodelphis domestica} MEFWNATTIMKFQLLGFQNISEWQNFLFAIFLFFYILTIIGNILIIVVVSQDQRLHLPMYSFLKHLSFLEIWYTTTIVPLLLTNLLSQGLSISFSACMIQLYFFVFFGAT
ECFLLAMMAYDRYLAVCNPLHYTTLMSSEVCIKLIFGSWITGIGTGFLPALMISELNFCGPNQINHFFCDLPPLMQLSCSSTFITEITIFILSIAVLCICFLLTLVSYVF
IVSSVLRIPSASGRIKTFSTCGSHLAVVTIYYGTMISMYVRPNAHKSPELNKIISIFYTVVTPLLNPVIYSLRNKDFKEAVRKVIKRKCSMYSV*
87 >lcl|XP_001364560.1|Plus16866811..6868388 NW_001581847 leucine-rich repeat transmembrane neuronal protein 1-like LOC100019660 __SEG__ Chr1 {Monodelphis domestica} MDFLLLGLCLNWLLRKPPGWIVCVLGVGFQMLPAAQSGCPQLCRCEGRLLYCESLNLTEAPHNLSGMMGLSLRYNSLSELRDGQFTGLMQLTWLYLDHNHICSVEGDAFQ
KLRRVKELTLSSNQISQLANTTFRPMPNLRSVDLSYNNLQALAPDLFHGLRKLTTLHMRANAIKFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHND
LVKVNLAHFPRLVSLHSLCLRRNKVAIVVNSLDWVWRLEKLDLSGNEIEYMEPHAFEAVPHLESLQLDSNRLTYIDPRILNSWKSLSSITLAGNVWDCGRNVCALASWLS
NFKGRYDGNLLCASPEYAQGEDVLDAVYAFHLCEDASADPTSGHLLSAVTNHSDGAARASPATTISADGLLDVEGARTTDGVGGVTVPVEHAENAVQIHKVVTGTMALIF
SFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCSCHQQPARECEV*
88 >lcl|XP_001364623.2|Plus112080942..12081868 NW_001581855 olfactory receptor 13A1-like isoform 1 LOC100015179 __SEG__ Chr1 {Monodelphis domestica} MAVSNQSIVTEFFLQGFSETPPLQLALFFIFFFLYIMALIGNALIVLAISIDSGLHTPMYFFLANLAILDIGCTSTVLPKLLENLVDKKFISYDGCMTQLYFLTWFLGAE
LLLFTAMAYDRYVAICHPLHYTTMMSRMVCIFLAGSVWTISAISSAVHTGLMVQLTFCGPNKIKHFLCEIPTLLLLSCTSTYLNNIMIVIADVYFGVINFGFTMVSYGFI
ISSILKIRTKEGKKKAFSTCSSHLIVVTIYYTTIIYTYILPGSGSSMDNGKIVAVLYTTISPTLNPLIYTLRNKDFKTAVKKMFPFIQ*
89 >lcl|XP_001364675.2|Plus11116893..1117852 NW_001581876 olfactory receptor 6M1-like LOC100011035 __SEG__ Chr2 {Monodelphis domestica} MEKRNWTMVTEIILVGIPTTHAVLGGLLFLLFLLAYLVTVLGNFLIIILIWVDYRLHSPMYFFLSHLSFSEILTTTCAVPKMLVDFLSEKKTISFAGCFSQSYFYFLSGC
TEFILFAIMSYDRYIAICNPLQYPTIMTCPLCIRLVVLSWLGGFLLIFPSTVLKGGLPYCGPNVIDHFFCDSAPLLHLACTDIRAIELLDFLSSLVLLISSLTLTVVSYV
YIISTILKIPSGQGQRKTFATCASHFTVVSLGYGISIFVYVRPSQKSNLHFNKILFILSSIVTPLLNPFIFSLRNETMKEALKDISAKIQTFLKNLRFN*
90 >lcl|XP_001364711.1|Plus1400054..400989 NW_001581929 olfactory receptor 52E2-like LOC100017396 __SEG__ Chr4 {Monodelphis domestica} MPHYNDTQFHPPFFILLGIPSLENFHIWIGFPFCIVHLIALLGNITILFVIQTEKTLHQPMFYFLAMLATIDQGLSTTTIPKMLGIFWFKLREITFGTCLTQMFFIHLLT
WMESAVLSSMAYDRYVAICNPLHYSTVLTNRVVAIMGIVGVVRSFFAVIPCVFLVLRLPFCGNRVIPHTYCEHMGIARLACASIRVNMIYGLCAIGTLIFDIVAIAVSYI
LILQAVFHLPSHDARLKALSTCGSHVCVILAFYTPALFSFMTHRFGQNVPRDIHILLANLYVIVPPMFNPVIYGVRTKQIREKVFKMLLKN*
91 >lcl|XP_001364716.1|Plus1complement(28181708..28182184) NW_001581960 low molecular weight phosphotyrosine protein phosphatase-like LOC100016133 __SEG__ Chr4 {Monodelphis domestica} MAAEGTRSVLFVCLGNICHSPIAEAVFRKLVADQNISDKWITDSAAVSDWNVGRSPDARAKNCLRNHDINTAHKARQITKEDFLTFDYILCMDDNNLRDLNRKVNQVKNS
KAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYEQCMRCCKAFLEKAH*
92 >lcl|XP_001364723.2|Plus1complement(14125605..14126540) NW_001581971 olfactory receptor 4S2-like isoform 3 LOC100013386 __SEG__ Chr5 {Monodelphis domestica} MENNVTEFILTGLSQIEEVEQVCFYLFLLFYTIIIFGNFLIIMTIRVSPNLNSPMYFFLSFLSFVDICYSSVTAPKLIVDFQSKVKTISFVGCMTQLFVVHFFGCTEIFI
LTVMAYDRYVAICKPLHYATIMDQRVCTILMVSSWVGAFTHSIIQTLLTVQLPFCGPNVIDHYFCDVHPLLKLACTDTYVVGVIVVANTGMISLTCFIILVGSYAVILLY
LRTHSAEGRRKALSTCASHVIVVILFLVPCIFIYMRPSTTFTEDKMVAVFYTIITPMLNPLIYTLRNAEVKNALKKLWSKKLMGEARKDLK*
93 >lcl|XP_001364739.1|Plus1992224..993165 NW_001581839 olfactory receptor 6B3-like LOC100011074 __SEG__ Chr1 {Monodelphis domestica} MRGKNISNIREFILLGFPTALWLQYLLFILFLFVYLFVLVENFIIIFTIWANSSLHKPMYYFLGNMSFLEVWYVSDIIPKMLSGFLFQQKSISFVGCMTQLYFFISLICT
ECVLLASMAYDRYVAICFPLRYGVIMTTGLCVQLVAFSYVIAFAISVIKVYFISHATFCGSSIINHFFCDVSPILKLACTDFSTAELVDFVLGFIILVFPLISTMLSYGY
ISSTVIRIPSSIGRWKAFSTCASHLIVVIIFYTALIFMYVRPQAIDQRSSNKLISVIYTVVTPIVNPLIYCLRNNEFKNSLKKTMAVAHTPEK*
94 >lcl|XP_001364745.2|Plus1complement(1155307..1156263) NW_001581876 olfactory receptor 2B11-like LOC100011081 __SEG__ Chr2 {Monodelphis domestica} MRSNNQSLLGTFTGNFFLLGVSDRPWLELPLFVILLISYVLAVLGNIAIILVSRLDPLLSSPMYIFLSHLSFLDLCYTTTTVPQMLFNMGSSKKTISYSGCTVQYAIFHW
LGCTECVVLAAMALDRYVAICKPLRYAVIMNRPLCQQLVGTAWISGFGNSLVQVVLTVQLPFCGRRVLNNFFCEVPAMIKLSCANTSINDATLAVLVAFFVLVPLVLILI
SYGFIAQAVMRIKSSKGRSKAFGTCSSHLIVVSLFYLPAIYMYLQPPSSYSQDQGKFISLFYSIITPTLNPFIYTLRNKDVKGALRRLWERSWRLFQR*
95 >lcl|XP_001364749.1|Plus1complement(2223988..2225406) NW_001581901 probable G-protein coupled receptor 150-like LOC100011085 __SEG__ Chr3 {Monodelphis domestica} MEDPFGPSPLPPVPNLSISIPLSRGFNLSSVGDSGAGMLLQPPTPPSRKVRLVSLGIILVVAVVGNATVLCTLCGSGGGPWAGPKRRKMDFLLVHLALADLYVCGGTMLS
QLAWELLGDAHMVAGDLACRVVKLLQVSALLASSNILALICLERHRVVSRPLGPPFPTRALAALSWLLALLLALPQAFVVHGGTTSGLPDGYSGVPALPSAALMPSYTLA
ASQSPPGLQASAGSWSGERRCRTIFGALPRWHLQVYTVYGTVAGFLAPLAILGVACGRLLQTLWHQRLQASAPVAWSPYVWEAGHCRARTRSALPPAKVQSLKMTLVLAL
LFVMCELPYFAAELAAAWSSNSRGEGQGEGLTSALGIVVVTNSALNPYVYLFFQTGDSRLRRLWRRLSTVCCCDRCLKKGEGEDEDEVARGHQPLHRHRWPHHHYHHHHR
REPPGAFTTEGSPHPALSSAPKQLPCSCESIF*
96 >lcl|XP_001364763.1|Plus1204084..205853 NW_001581861 ectoderm-neural cortex protein 2-like LOC100013826 __SEG__ Chr1 {Monodelphis domestica} MSVSVHENRKSRTSTGSMNITLFHKPSHPDCVLSHLNTLRKHRMFTDVTLWAGDRSFPCHRAVLAASSCYFEAMFSHGLRESLDDAVNFHDSLHPEVLELLLDFAYSSRI
IINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYELSWRMCLVHFETVQQSEDFKNLSKDTLLDLISSDELETEDERVVFEAIIQWVKH
DLDGRKVYLPELLRSVRLALLPSEILKEAIACEDLIMADERNKLIMDEALHCKKKILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSACAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTAVAGVFPASPSVSLKQVEKYDPGANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPADNRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWTCITTVPYSLIPTAFVSTWKHLPA*
97 >lcl|XP_001364780.1|Plus1420065..421000 NW_001581929 olfactory receptor 52E2-like LOC100017477 __SEG__ Chr4 {Monodelphis domestica} MPHSNNTLFHPPFFILLGIPGLENFHIWIGFPFCIVYLIALLGNITILFVIQSEKTLHQPMFYFLAMLATIDQGLSTATIPKMLGIFWFKLREITFDTCLIQMFFIHIFT
VMESAVLSSMAYDRYVAICNPLHYSTVLTNRVVTIMGIVVVVRSFFTVIPFVFLVLRLPFCGNHVIPHTYCEHMGIARLACASIRVNMVYGLCAIGTLMLDIVAIALSYI
QILLAVFHLPSQDARLKALSTCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVIVPPMLNPVIYGVRTKQIREKVLKMLLKN*
98 >lcl|XP_001364791.2|Plus115604457..15605362 NW_001581971 olfactory receptor 4C6-like LOC100015106 __SEG__ Chr5 {Monodelphis domestica} MENKNTTKFILLGLTQSPELRKIFFVIFLIIYIITVTGNLLIVLTMTVSQSLRSPMYFFLTFLSLMDAAYSSVIAPKMIVDLLYERTTISLEGCLIQVFSEHFFGSVGII
LLVVMAYDRYVAICKPLHYMTIMNPRVCHLLVAAAWIGGSIHGTIQLLFMINVPFCGPNIIDHFLCDLFPLLKLACMDTQVLGLLVIANSGILCLLTFLLLIVSYIIILS
SLKGGSSEGRRKAFSTCSSHITVVILFFAPCIFLYVRPVTTFTIDKAVSVCCTLITPMLNPLIYTLRNTEVKNAMRKLWIR*
99 >lcl|XP_001364850.1|Plus1432691..433626 NW_001581929 olfactory receptor 52E2-like LOC100017512 __SEG__ Chr4 {Monodelphis domestica} MHSTNNTQFHPFSFLLLGIPGLEAFHTWIGFPFCLVYLIALAGNITILFVIKTEKTLHQPMFYFLAMLSTIDLGLSTATIPKMLGIFWFKLREISFGACLSQMFFIHNFT
GMESIVLVSMAYDRYVAICNPLHYSSVLTNRVVAMMGLGVLVRSFLTVIPFVFLILRLPFCGNHIIPHTYCEHMGLARLACASIKVNIIYGLGTICILFLDIMAIAFSYI
QILQAVFRLPSQDARLKALSTCGSHVCVILAFYTPALFSFMTHRFGKKVPQYIHILLANLYVVIPPALNPVIYGVRTKQIQEKVLRMFSQK*
100 >lcl|XP_001364863.1|Plus116348562..16349506 NW_001581971 olfactory receptor 5D13-like LOC100016492 __SEG__ Chr5 {Monodelphis domestica} MRKADRNESDMIIFILLGFSDYPEIQMPLFLVFLVIYMITVVGNLGMIVIIRTNPKLHIPMYFFLSHLSFLDFCYSTVVTPKLLQILIVEDRTISFAPCITQYSFAVLCV
VTEAFLLAAMAYDRFVAICNPLLYIVVMSQKRCILILTGVYAWGLISSLIFIYSLLILSFSGINILNNFLCEYSAILSASISDKHVTELIFFILANFNTFSTLIVVLTSY
LFIFITVLKMQSASGRYKAFSTCASHLTGVTIFFGTILFLYCLPSSKSSWLLVRVNTIFYTVVIPMLNPLIYSLRNKDVKECIGKLIDVQIFSH*
101 >lcl|XP_001364866.1|Plus18808669..8809640 NW_001581981 lymphokine-activated killer T-cell-originated protein kinase-like LOC100014462 __SEG__ Chr6 {Monodelphis domestica} MEGPNPFKTPSKLPEKKKSSSCLTPSSVAIPASPFMKKLGYGTGVNVYLMKKSPKGLSRSPWAVKKINSKCNDHYQSIYQKRLNDEAKILKDLQHPNIVGYQAFAPAQDG
SMCRAMEYGGEKSLNDLIEERNTNCHSPFPAAIILKVALHMARGLKYLHQEKKLLHGDIKSSNVVIKGDFEAIKICDVGVSLPLDENMTVSDPEAHYISTEPWKPKEALE
ECGIITDKADIFAFGLTLWEMLTLTIPHVNLPEDEDDEDKIFDESMFDDEAYYEALGTRPAINMEELDESYQKVIELFSICTNENPKDRPSAAYIVEALEINM*
102 >lcl|XP_001364871.2|Plus1complement(406652..407590) NW_001582011 olfactory receptor 6C2-like isoform 2 LOC100016175 __SEG__ Chr8 {Monodelphis domestica} MRNHTGITLFILRGLTDDPRLQVLLFIFLFLTYMLSVTGNVTIITLTLVDPHLQTPMYFFLRNFSFLELSFTTVCIPRFLYNMSTGDYTVTYNECATQLFFGILLGAAEF
FLLAAMSYDRYVAICKPLHYTTIMNNRVCNRLLVGSWLAGLMIILPPLSLGLQLEFCDSNVINHFVCDASPLLEITCSDTEFIERMVLVFAVLTLIITLVLVVLSYAFII
RTILRFPSAQQRKKAFSTCSSHMIVVSMTYGTCIFIYMKPSAKEGVALNKVVSVLATSVAPVMNPFIYTLRNKQVIQAFRDSFKRFMLISKL*
103 >lcl|XP_001364921.1|Plus1complement(556396..557349) NW_001581929 olfactory receptor 52A1-like isoform 1 LOC100017770 __SEG__ Chr4 {Monodelphis domestica} MIKMHNTSSLDPPMVTLIGIPGLEHVQFWIGFPFCALCMVAFVGNVLLLVIIPSESSLHQPMYVFLAVLAANDLGLCASIAPKMLAIFWFSACTLTFDACLTQLFFIHAL
QGMESGILLAMAFDRYVAICNPLRHSTILTPSVMGQLVGMVAARAVVLVSVVPILLKRLHFFHSTVVAHSYCEHMAVVKLAAVDTRINKAFGLFVAFSILGFDMIFVLVS
YMLILQAIFRLPQKEARIKAFNTCTAHIFVFLEFYVLAFFSFFSHRFGHVAPYVHILLSTIYLLVPPALNPIVYSVKTKEIRVRVVRIFAPKYSSIK*
104 >lcl|XP_001365005.2|Plus1complement(16962685..16963623) NW_001581971 olfactory receptor 10AG1-like LOC100017833 __SEG__ Chr5 {Monodelphis domestica} MADRNLTLMEEFILLGFSEYPTVQGYLFVLFLFIYICILIGNGLIIIITSVESALHTPMYYFLGNFSFVEICYTSNILPRMLVNIWRQKGNISLLSCALQLCFFFILGVT
ESFLLAVMAYDRYVAICKPLYYPIIMNQRMCVQMVFGSWVIGIPILIGQTYQVFSGPFCGSNKLNHIFCDMPPLLKLACGDTSGDEFFFYVDCFLFDLTPFLMILMSYIR
ILSTILKLPSTTGRSKAFSTCSSHIMVVCLFYVSGLIAYFQSKSSHSGSIDKFFSVFYTIVTPMINPMIYSLRNKDFIAAIKKYFLNGKYKE*
105 >lcl|XP_001365042.2|Plus1complement(1300425..1301369) NW_001582021 olfactory receptor 9A4-like LOC100011249 __SEG__ Chr8 {Monodelphis domestica} MSDNHSGILELKLLGFSGSQEFRHMLFSIFFLLYMVTIIGNSLIVIMVCMDYRLHSPMYFFLGNISAMEILTTTIVIPTMLGGLLTTQIQTMSFGACMAQLFLLLSVGTS
QFVLLAAMAVDRYVAICNPLRYSVIMNHQVCLWVVIVSWVFGFLFQIWPIVATCQLYFCGPNVLNHFYCERGQLLRLTCGDSRFQQFILFLMAAFVLFGSLLPTIISYIY
IICTILRIPSASGRRKAFSTCASHFTMVVIGYGSCLFLYVKPKQTDAIEYNKMISLITSVVTPLLNPFIFTLRNDQFIEVLRDGMKRLSHLLKK*
106 >lcl|XP_001365070.1|Plus1612602..613546 NW_001581929 olfactory receptor 52R1-like isoform 1 LOC100017911 __SEG__ Chr4 {Monodelphis domestica} MSAFNGTNVHPSCFFLLGIPGLENVHIWISIPFCLVYVLAVLGNCTLLFIIKSDPNLHEPMFLFLSMLSVADLMLTTTTMPKILSLFWFNDREIYFEACLTQVFLIHALS
NIESGIILAMAFDRYVAICNPLRHSTILTYAVIQRLGLVIVLRGLVLLGPHPFMLKWLPYCRTNIIPHTYCEFMALIKLACAPTKIYRAYSLFVAFITAGLDFIIIICSY
ILILRTVFRLPSNDARLKTLSTCGSHVWVILISYTPAFFSFLTHRFGHHIAPSLHIFVANIYVLVPPMVNPIIYGVKTKQIRERFIRIFTDKNP*
107 >lcl|XP_001365090.2|Plus11751478..1752416 NW_001582012 olfactory receptor 6C76-like LOC100016928 __SEG__ Chr8 {Monodelphis domestica} MGNRTTVTVFILLGLTDDPQWKIVLFLFLFLTYILSVAGNLTIILLTLLDSHLKTPMYFFLRNFSLLEISYTTVCIPKFLVSIATGDKTITYNCCVAQLFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTTIMSSKVCTQLVLSSWVSGFLIIFPGLIAGLQLDFCASNAIDHFYCDTAPMLQLSCTDTEFLELLSFILALVTLLVTLTLVILSYVHIA
LTILRIPSASQRKKAFSTCSSHMIVLSLSYGSCIFMYIKPSAKERISLTKGISLLNTSVAPLLNPFIYTLRNQQVRQAFKDAIQRAATFSNK*
108 >lcl|XP_001365100.2|Plus11305614..1306540 NW_001581876 olfactory receptor 13G1-like LOC100011278 __SEG__ Chr2 {Monodelphis domestica} MNHSTVTEFVVMGLSGQPELQGIFFIIFFFIYLVALLGNVIIVIAIIYNTTLHSPMYLFLLALGVVDVICTSTIIPKMLENMLVLDKTISYEGCMSQLFFFTWSLGAEMV
LFTVMAYDRYVAICFPLRYSTIMNRNMCMALLCTVMAIAIANSWVHTGLILRLTFCGPNTINHFFCEIPPLLALSCSPVRTNEVMVFAADIALAMGDFILTCISYGFIIA
AILRIRTTEGKRKAFSTCSSHLLVVSLYYSPVIYTYIRPASTYNFERDKVVAALYTLVTPTLNPLVYSFRNKEIQGGIKKVFSFLKCH*
109 >lcl|XP_001365112.2|Plus1complement(1342063..1343016) NW_001582021 olfactory receptor 9A4-like LOC100011293 __SEG__ Chr8 {Monodelphis domestica} MVGNYTGVIKFYIEGFSGSPEFRHTLFAIFFFSFFVTIMGNVIIIVVVCADHRLHSPMYFFLGHLSFLDILITSTIIPSMLGSLLMSETLTMSFSACITQLFLYLSLGTI
EFVLLGAMAVDRYVAVCNPLRYSIIMNNQVCISVVILAWVFGFLFQIWPIYATFQLSFCRSTLVNHFFCERGLLLKLSCDDTAFLEFILFLMATVILLGSLFPTIISYTY
IISTILKIPSNSGRRKAFSTCASHFTVVVIGYGTCLFLYVKPKQTQAAEYNKIVSLMISVVTPFLTPFIFTLRNNQVKEALKHVIFLRFSPSQGSSQ*
110 >lcl|XP_001365142.2|Plus159774..60718 NW_001581942 olfactory receptor 2AJ1-like LOC100017162 __SEG__ Chr4 {Monodelphis domestica} MLEEKNHTFSKDFILLGILDPNKYGFLFLSFLLIIFMVAIMGNSILILLIRLDIRLHTPMYFLLSHLSFMDILHISNIFPKMANNFISGRKSITFTGCGFQVFFSLIFLG
AECLLLTVMSYDRYVAICHPLRYPILMSHRISVIMAASCWLVAIINSTIHTTYVLYIPFCGTRAIDHFFCEVPAMLKLSCVDTSHYERGVYVSAVFFLLIPFSIILASYG
QILRTVLHIKSMEAQKKAFSTCSSHLTVVVMYYGPFIFTYMRPKSYHTPGQDKILAVLYTILTPMLNPMIYSLRNKDVLCAMKKVLGSVLMHRN*
111 >lcl|XP_001365151.2|Plus118303101..18304039 NW_001581971 olfactory receptor 1052-like LOC100019634 __SEG__ Chr5 {Monodelphis domestica} MAKENYTVVTEFLLLGLTDREELKVFLFLLFLVIYIISLVGNLGMIILIQITPKLHTPMYFFLSCLSFVDACYCSVFGPKMLMNFFKEKATISFNACIVQYFLFVVLLTT
EGFFLAVMAYDRYVAIANPLLYMVVMTKRVCIILVIGSCIGGMINSLTHTIGLVRLSFCGPNIISHFFCDLPPLLKLSCSDTSRNELLLLIFSGIIAIITFLTVIISYIF
IVVAILRIRSAAGRYKAFSTCASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSVFYTMVIPMMNPLIYSLRNKEVKDAVKRAIELKPSFF*
112 >lcl|XP_001365152.1|Plus1complement(32053745..32055565) NW_001581976 leucine rich repeat and Ig domain containing 2 LINGO2 __SEG__ Chr6 {Monodelphis domestica} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCDCLPHNKSVSCHRKRLIAIPEGIPIETKILDLSKNRLKSVNPEEFMSYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRNLISLHLRYLNINVMPVYA
FKRLFHLKHLEIDYWPLLDLMPANSLYGLNLTSLSITNTNLSTVPYPAFKHLVYLTHLNLSYNPISTIEAGMFADLIRLQELHVVGAQLRTIEPHAFQGLRFLRVLNVSQ
NLLETLEENVFYSPRALEVLSISSNPLACDCRLLWILQRQPLLQFGGQQPMCAGPDSIREKPFKDFHSTALSFYFTCKKPKIRDKKMQYLLVDEGQTVQLVCNADGDPQP
VISWATPRRRLITTKSNGRVTVLGDGTLEIRFAQDQDTGVYVCIASNAAGNDTYTASLTVKGFASDRFLYANRTPMYMTDSNDTSSNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
113 >lcl|XP_001365161.2|Plus11784476..1785414 NW_001582012 olfactory receptor 6C76-like isoform 1 LOC100017000 __SEG__ Chr8 {Monodelphis domestica} MRNHTMVTMFILLGLTDDPQWKIVLFTFLFLTYILSVAGNLTIILLTLLDSHLKTPMYFFLRNFSLLEISYTTVCIPKFLVSIATGDKTITYNCCAAQLFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTTIMSSKVCTQLVLSSWVSGFLIIFPGLIAGLQLDFCASNAIDHFYCDTAPMLQLSCTDTEFLELLSFILALVTLLVTLTLVILSYVHIA
LTILRIPSASQRKKAFSTCSSHMIVLSLSYGSCIFMYIKPSAKERISLTKGISLLNTSVAPLLNPFIYTLRNQQVRQAFKDAIQRAAPFSNK*
114 >lcl|XP_001365205.1|Plus11003271..1004215 NW_001581929 olfactory receptor 52D1-like isoform 1 LOC100018679 __SEG__ Chr4 {Monodelphis domestica} MTFSNKTNVHPSTFILIGIPGLETAHIWISIPFCLVYILALLGNFALLFIIKTDPSLHEPMYLFLCMLAVADLIVCTTAIPKLLSLFWFKDREIRFEACLTQVFLIHSCS
TMESGFFLAMAFDRYVAICKPLRHSAILTHTVIGSMGLAVIFRGAVLLCPHPFLLRWLPYCKTNIISHTYCEFMALIKLACAETRIRRAYSLIVAFLTGGLDFILIICSY
IFILHTVFQLPSKDARLKTLGTCGSHVCVILVSYTPAFFSFLTHRFGHHIAPHVHIFVANIYLLVPPMVNPIIYGVRTQRIRERILKVFNPLKA*
115 >lcl|XP_001365245.1|Plus116555567..16556616 NW_001581838 probable G-protein coupled receptor 21-like LOC100015305 __SEG__ Chr1 {Monodelphis domestica} MNSTLEGNQSSYPFCLLAVNYLETINFCLLEVMIIVFLTVLIISGNIIVIFVFHCAPLLNHHTTSYFIQTMAYADLLVGVSCLVPSLSLLHYPLPLEESLTCQIFGYVVS
VLKSVSMASLACISIDRYIAITKPLTYNTLVTPWRLRICILVICLYSALVFLPSFFHWGKPGYHGDVFQWCAEYWSTDPYFTFFIVMMLYAPAAFIVCFTYFNIFRICQQ
HTKEISERRARFSSQSGEAGEVQSYPDKRYAMVLFRITSVFYILWLPYIIYFLLESSAGFSNRTASFLTTWLAISNSFCNCVIYSLSNSVFQKGLKRLSGAVCASCVRPK
TAKDPYPSKSKGPSNGCHV*
116 >lcl|XP_001365307.2|Plus11402683..1403624 NW_001582021 olfactory receptor 6V1-like LOC100011415 __SEG__ Chr8 {Monodelphis domestica} MGNLSHPSEFILLGFSTFGKLQVLLYGPFLVLYLLALLGNILIIAMVLADAHLHTPMYFFLGNFALLDILVTITVVPKMLSDLLVSTKTISFTSCMVQFYFYFSFGSTTS
LILADMALDRFVAICHPLRYSTLMSWTVCFSLAGTAWAAPFLAMVPTVLSLIQISFCHNNIINHFFCDNAPLLQLACSDTSLLEFWDFILSLAFVLSSFLITLISYAYIV
TTVLHIPSASGRQKAFSTCSSHLTLVFIGFGSTIFVYVQPGKAHSVETNKFVVLVTNILTPVLNPLIFTFRNETVKAVIWRQMQKLKNLKNSK*
117 >lcl|XP_001365373.2|Plus1138473..139411 NW_001581911 olfactory receptor 7C2-like LOC100011448 __SEG__ Chr3 {Monodelphis domestica} MVPGNQTQFTEFLLLGFSETPEQQGPLFGLFLGMYLVTVVGNLLLMLTIASDSHLHTPMYFFVSNLSFVDLCVITTTVPKMLVNILTQSKAISYAACVAQMYFFMALTCV
DNFLLTAMAYDRFVAICQPLHYATIMSPRLCVLLMMLSWIISLVEALIQNLMVMRLSFCGDHEIQHFFCDFPQVLKLSCSDTFNNYMLLYIMAAILGIVPLTGIVFSYSQ
ICSTILKVPSAKGKYKAFSTCGSHLSVISLFYGTGMGVYFSSSITHSSWKSTVASAMYAVVTPMLNPFIYSLRNKDIKDAVRRLIGRVTSFE*
118 >lcl|XP_001365376.1|Plus1757588..758679 NW_001581946 G-protein coupled receptor 4 GPR4 __SEG__ Chr4 {Monodelphis domestica} MGNTTLEGCHVDSRVDHLFPPSLYIIVMGIGLPTNCLALWAAYRQVRQHNELGVYLMNLSIADLLYIATLPLWVDYFLHHDNWIHGRGSCKLFGFVFYTNIYISIAFLCC
ISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRIFIGFLFPWSLMLFSYRGILRAVRGSVSTERQEKA
KIKRLALSLIAIVLVCFAPYHVLLLSRSAVYLGRPWDCGFEEKVFAAYHSSLAFTSLNCVADPILYCFVNEGARGDVAKALHSLLRFLASDKPQEMANVSLTLETPLASK
RNSVGRLGWGGALASHSHSRGDDVQLKMLPPSQ*
119 >lcl|XP_001365395.1|Plus125760747..25761829 NW_001581868 probable G-protein coupled receptor 52-like LOC100016127 __SEG__ Chr2 {Monodelphis domestica} MNESSRLTEPRAHNMSFGNVSEHHSCPLGFGHYNAEDVCILETVIIVLLTFLIIAGNFTVIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLNYSTGVHES
LTCQVFGYIISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTNAYFTGFIVCLLYAPAAFVICF
TYFHIFKICRQHTKEINDRRARFPSHEVDAAGETGHSPDKRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPALSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRRL
SQTICSSCMCLKDQDIQDPKPRKRANSCSI*
120 >lcl|XP_001365406.2|Plus1complement(720573..721514) NW_001581907 olfactory receptor 24-like isoform 1 LOC100016330 __SEG__ Chr3 {Monodelphis domestica} MELGNKTNAQEFFLMGLSDKPEQQPLLFAIFLCMYLVILTGNLLIIVAIGSDSHLHTPMYFFLSNLSFVDLCLATNTVPKMLANIQSKTKSISYVCCLTQMYFFHFFGIV
DSVLITVMAYDRFVAICHPLHYTTIMSPRLCGLMVGLPWLFSIVISLAHTLLMSRLYFCASTELPHFFCDLTPLLRLSCSDTTVNKILVLIVGGMVIVTPFLCILASYAR
IVVAILKVPSAGGRKKAFSTCSSHLSVVALLYGTTIGVYLSPSSIHTTVKDKASAVMYTVVTPMLNPFIYSLRNRDLKGALKKLINRKIVSSP*
121 >lcl|XP_001365419.2|Plus118428203..18429153 NW_001581971 olfactory receptor 8K5-like isoform 2 LOC100019856 __SEG__ Chr5 {Monodelphis domestica} MGNWNETKWTQVTEFILRGVTDLPELQIPLFIVFLIIYTVTTLGNLGLIILTKIDSRLKTPMYFFLRNLAFIDLGYSTAIGPKMLGNFVMERNTISYVGCAMQLVVFITL
IISELFMLSVMAYDRYVAICNPLLYMVIMSDRLCCLLVAIPYLYSSSVALVTTIKIFNSSSWKSNIISHFYCDSLPLLSILWNDAKDVELIILSLSAFNLVSSLVVVLLS
YALILVAILRMNSAEGRRKAFSTCGSHLTVVVVFYATLTFMYLQPKSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKGALKKALENRFKCVL*
122 >lcl|XP_001365445.2|Plus1166769..167707 NW_001581911 olfactory receptor 7C1-like LOC100011504 __SEG__ Chr3 {Monodelphis domestica} MVPGNQTQFTEFLLLGFSETPEHQGPLFGLFLVMYLVTVVGNLLLMLIVTSDSHLHTPMYFFVSNLSFVDLCIITTTVPNMLVNFLKRSKVIPYAGCLAQLYFFMAFGSL
DNFLLTAMAYDRFVAICHPLHYATIMSPRLCVLLVLLSWIISLVQSLIQNLMVTRLSFCRDHEIQHFFCDFPQILKLSCSDTFINYMLLYITTGLLGIVPLTGIVFSYSQ
IFSSILKVPSAKGKYKAFSTCGSHLSVVSLFYGTGIGVYLSSSTTQSSWKSTVASAMYAVIIPMLNPFIYSLRNKDIKDALRKIISKGTSFE*
123 >lcl|XP_001365510.2|Plus1complement(201469..202407) NW_001581911 olfactory receptor 7C1-like LOC100011546 __SEG__ Chr3 {Monodelphis domestica} MAPGNQTKFTEFILLGFSETPEQQRTIFGLFLGMYLVTVFGNILIILAVGSDSHLHTPMYFFLSNLSFVDLCVVSSTVPKMLVSILTQNKAISYAGCLAQMSLFMFFGCL
DNFLLTAMAYDRFVAICHPLRYTSIMSPELCCLMVLLSWILSLLNTLLHSLMVTRLSFCTGHEIQHFFCDLEKVLKLSCSDTLINYVLLYVIAGLLGVLPLTGILFSYSQ
IFSSILKVPSARGKYKAFSTCGSHLSVVSLFYGTGLGVCLSSSVTQSSWKSTVASAMYAVVTPMLNPFIYCLRNKDIKGALWRLISRISSSQ*
124 >lcl|XP_001365581.2|Plus1complement(1475243..1476193) NW_001582021 olfactory receptor 6V1-like LOC100011591 __SEG__ Chr8 {Monodelphis domestica} MMNNHTVVRDFVLWGFSHLQEFQILLFLFFLLVYVLIILGNSFVITITFLDSRLHSPMYFFLCNFSLMEMLVTSTVVPRLLADLFSTHKTISLTECLIQSFFYFSLGSTD
FLILTAMAFDRYVAICRPLHYPTIMSGQVCVKMVIACWVVGFFSIISPTIQKSRLWFCGPNVIDHFFCDSAPLLKLSCSETHHIERMDFFLSLLFVLTTMLLIMISYIFI
VASVLRIPSSSGRQKAFSTCASHLTVVVLGYGSAIFIYVRPSKGHSTDLNKVVALMTALVTPFLNPFIFTFRNEKVKEVIEDIVKKILSKDSEGFR*
125 >lcl|XP_001365644.2|Plus11572621..1573139 NW_001582021 olfactory receptor 6V1-like LOC100011629 __SEG__ Chr8 {Monodelphis domestica} MANESHPSEFVLLGFSAFGELQVALYGPFLVLYVMAFTGNIIIIAMVLASAQLHTPMYFFLGNFALLETLVTMTVVPKMLSDLHVSTKTISFTGCMIQFYFYFSFGSSTF
LTLADMALDRFVAICHPLRYGTLMSWVVCIRLTGAAWAAPFLAMVPTVVSRVQLSYCRGNII*
126 >lcl|XP_001365655.1|Plus119961991..19962572 NW_001581861 cysteine and glycine-rich protein 2-like LOC100016597 __SEG__ Chr1 {Monodelphis domestica} MPNWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTAAIHDDEVYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPENVQPHRPTTNPNTSKFA
QKFGGAEKCSRCGDSVYAAEKGIGAGKPWHKNCFRCAKCGKSLESMTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ*
127 >lcl|XP_001365669.2|Plus1complement(2239164..2240108) NW_001581929 olfactory receptor 52B4-like LOC100020949 __SEG__ Chr4 {Monodelphis domestica} MSITNISVTSHTFFYLLGIPGLEDQHIWISIPFFTSYIIALLGNSLLIFIIVTDHSLHEPMYIFLCMLAVLDIGLSTITVPKALTIFWFNYGGISLDGCITQLFFVHLTY
IAESGILLVMAFDRYVAICYPLRYTMILTPSVITKLSMGVYLRSFSAVFPLIFLLKRLSFCKNNLLPHTYCEHIGLAKYACSSIRVNIWYGVFVGLLSVILDFILVVASY
CVILYTIFRIPSQDARHKALHTCGSHICVTFLFFIPGIFTVMVQRFGKQIPPHIHILMANVCMLVPPVMNPIIYGIKTKQIKNRALHLLFQRQR*
128 >lcl|XP_001365698.2|Plus1258595..259533 NW_001581911 olfactory receptor 7C2-like LOC100011657 __SEG__ Chr3 {Monodelphis domestica} MVPGNQTQFTEFLLLGFSETPEQQGPLFGLFLGMYLVTVVGNLLLMLTIASDSHLHTPMYFFVSNLSFVDLCVITTTVPKMFVNILTQSKAISYAACVAQMYFFMALICV
DNFLLTAMAYDRFVAICQPLHYATIMSPRLCVLLMMLSWIISLVEALIQNLMVMRLSFCGDHEIQHFFCDFPQVLKLSCSDTFNNYMLLYIMAAILGTVPLTGIVFSYSQ
ICSTILKVPSAKGKYKSFSTCGSHLSVISLFYGTGMGVYFSSSITHSSWKSTVASAMYAVVTPMLNPFIYSLRNKDIKDAVRRLIGRVTSFE*
129 >lcl|XP_001365705.2|Plus1139788..140723 NW_001582014 olfactory receptor 14C36-like LOC100011665 __SEG__ Chr8 {Monodelphis domestica} MSNFTSETEFLLMGFSDIRELQIFYSFLLGLIYSAGLMGNLLIVIITTFDKRLHTPMYFFLRNLAMLDACYLSITVPQASFNSLVNNRIISVTGCATQVFLVILMAYVEV
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTITCLLTGLVYSAFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLLASALVVGTGCYGFITASYVRIF
SAVLKFPVKEDQKKAFSTCIPHISVVSLFVISGIYVYSQPPSDSESLKDIIPSVFYTIIPPFLNPIIYSLRNKQIKDAMGILMKRTIFIRK*
130 >lcl|XP_001365731.1|Plus1complement(2540409..2541374) NW_001581929 olfactory receptor 52N4-like LOC100021318 __SEG__ Chr4 {Monodelphis domestica} MQRTNATTLTPVSFILNGVPGLEDMHIWISLPFCSMYIVAMVGNCGLLCLIHYEDSLHKPMYFFLAMLSFTDIIMCSSTLPNTLGIFWFNLKEIDFIACLTQMFFIHTFT
LMESGVLMLMALDRYVAICYPLRYATILTNPIIVNAGFITFLRGVILVIPFTLLTKRLPYCRGNVIPHTYCDHMSVAKVSCGNVKINAVYGLMVALLIGGFDILCITVSY
TMILRAVVKLSSADARQKAFGTCTAHICAIVFSYTPAFFSFFTHRFGGHRIPHSLHIIMANIYLLLPPTMNPIVYGVKTKQIRDCVIRFFVGSKDTKSHNI*
131 >lcl|XP_001365759.2|Plus1278250..279188 NW_001581911 olfactory receptor 7C1-like LOC100011696 __SEG__ Chr3 {Monodelphis domestica} MVPGNQTQFTEFLLLGFSETPEHQGPLFGLFLVMYLVTVVGNLLLMLIVTSDSHLHTPMYFFVSNLSFVDLCIITTTVPNMLVNFLKQSKVIPYAGCLAQLYFFTAFGSL
DNFLLTAMAYDRFVAICHPLHYATIMSPRLCVLLVLLSWIISLVQSLIQNLMVTRLSFCRDHEIQHFFCDFPQILKLSCSDTFINYMVLYITTGLLGIVPLTGIVFSYSQ
IFSSILKVPSAKGKYKAFSTCGSHLSVVSLFYGTGIGVYLSSSTTQSSWKSTVASAMYAVIIPMLNPFIYSLRNKDIKDALRKIISKGTSFE*
132 >lcl|XP_001365763.2|Plus14681516..4682760 NW_001581968 neuroepithelial cell-transforming gene 1 protein-like LOC100011700 __SEG__ Chr5 {Monodelphis domestica} MVAHDEIGSFLPIKRTIRVLDVNNQSFREQEEPSNKRVRSLARVSSLANLISPVRNGAVKRFGQTIQSFTLRGDNRSPACAQKSFNRATVPTPSKRRNSVRWSEMLDINM
KESLTTKEIKRQEAIYEMLRGEQDLIEDLKPARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARLGEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAN
ALLDQKKQDARVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHTDIKPLEEALLVIQGVLSDINLKKGESECQYYIDKLEYLDDKQKDPRIEAS
KVLLCHGELKNKNGHKLYIFLFQDILVLTRPVIRNERHSYQVYRQPIPVKELVLEDLQDGDVRMGGSFRGAFSNSDKGKEKSFR*
133 >lcl|XP_001365809.1|Plus132483617..32485749 NW_001582021 frizzled-8-like isoform 1 LOC100018016 __SEG__ Chr8 {Monodelphis domestica} MEWSYLLEVTSLIAAFSLLQRSSGAAAASAKELSCQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSV
CERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTASPSQPHHHHPPPPPPPLPGEQPPPGSGHHRPSGGRPPHRGSGSGKGSEAAAPPARGGGGKS
RTPGGGSSPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYL
VRLVAGHEKVACSGGAAGAGGAGGAGAGAGAAGAAAGAAGGPGGRGDYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYS
QYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVV
ACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAGPGGGAAAAAAAVGAGGGGGGVGGGGSGGGV
GGGGGGGGGVGGGGMGGGGSMYSDVSTGLTWRSGTASSVSYPKQMPLSQV*
134 >lcl|XP_001365818.2|Plus1complement(304941..305879) NW_001581911 olfactory receptor 7C1-like LOC100011737 __SEG__ Chr3 {Monodelphis domestica} MAPGNQTKFTEFILLGFSETPEQQRTIFGLFLGMYLVTVFGNILIMLAVGSDSHLHTPMYFFLSNLSFVDLCVVSTTVPKMLVSILTQNKAISYAGCLAQMSLFMFFGGL
DNFLLTAMAYDRFVAICHPLRYTSIMSPELCCLMVLLSWILSLLNTLLHSLMVTRLSFCTVHEIQHFYCDLDKILKLSSSDTLINYVLLYIVAGLLGVLPLTGILFSYSQ
IFSSILKVPSAGGKYKAFSTCGSHLSVVSLFYGTGLGVCLSSSVTQSSWKSTVASAMYAVVTPMLNPFIYCLRNKDIKGALWRLISRISSSP*
135 >lcl|XP_001365909.1|Plus1complement(3199621..3200562) NW_001581929 olfactory receptor 56A1-like LOC100022308 __SEG__ Chr4 {Monodelphis domestica} MALISNSSSPLPSEFLLICFPGYQSWQHWLSLPLSLLFLLAMGANVTLLLTIRLEASLHEPMYYLLSILSLLDIVLCVTVIPKVLSIFWFDLRPISFSACFLQMYIMNSF
LTMESCTFTVMAYDRYVAICKPLRYPTIITNQFVVKATMFIVARNALLTAPIPILSAQLHYCGDNIIKNCICTNLSVSILSCDDITFNRIYQFVTGWTLLGSDLILIILS
YTFILRAVLRIKAEGAAAKALSTCGSHFILILFFSTILLVLVITNVARKKIPRDVPILLNILHHLIPPAMNPIVYGVRTKEIKQGIQKLLRRL*
136 >lcl|XP_001365964.1|Plus141940583..41942190 NW_001581902 suppressor of cytokine signaling 6 SOCS6 __SEG__ Chr3 {Monodelphis domestica} MKKISLKTFRKSFNLNKSKEENDFVVVQQPSLTTDFGKDDSLFSSCYGKDLASCEINSEDEKSGKNRSKSESLMGTLKRRLSAKQKQKGKGSPPSVNSADEDTFSSSSAP
IVFKDVRAQRPLRSTSLRNHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSNPSPALNGVRKDFHDLQSDSVFQEQNSALKSTESQNGDLHLHIDEHVPVVIGLMPQDY
IQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSTVPSQVGRNSFHEDESQVDQDIVVAPDIFVDQAVNGLLIGTTGVMLQSPRVNHSDVPPLSPLLPPMQNNQIQRNFSGLN
GTDTHVSESMRCHLNFDPNTAPGVGRVYDSVQNSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRF
SFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY*
137 >lcl|XP_001366029.1|Plus1complement(3272569..3273510) NW_001581929 olfactory receptor 56A1-like LOC100022381 __SEG__ Chr4 {Monodelphis domestica} MALISNSSSPLLSEFLLICFPGYQSWQHWLSLPLSLLFLLAMAANVTLLLTIRLEASLHEPMYYLLSILSLLDIVLCVTVIPKVLSIFWFDLRPISFSACFLQMYIMNSF
LTMESCTFTVMAYDRYVAICKPLRYRTIITNQFVVKATMFIVARNALLTAPVPILSAQLHYCGDNIIKNCICTNLSVSILSCDDITFNRIYQFVIGWTLLGSDLILIIIS
YTFILRAVLRIKAEGAAVKALSTCGSHFILILFFSTILLVLVITNVARKKIPHDVPILLNILHHLIPPAMNPIVYGVRTKEIKQGIQKLLRRL*
138 >lcl|XP_001366055.2|Plus1436246..437184 NW_001581911 olfactory receptor 7A10-like LOC100011907 __SEG__ Chr3 {Monodelphis domestica} MAPGNQTKFTEFILLGFSETPEQQGAIFGLFLGMYLVTVFGNILIILAFGSDSHLHTPMYFFLSNLSFVDLCMVSTTVPKMLVGILTQNKAISYAGCLAQMYFFIVFAGL
DNFLLTAMAYDRFVAICHPLHYTSIMSPELCCLLVLLSWILSLLDALLHSLMVTRLSFCTGHEIQHFFCDLDQVLKLSSSDTLINYVLIYIVVSLLDILPLTGILFSYSQ
IFSSILNVPSSAGKYKAFSTCGSHLSVVSLFYGTALGVYFSSSVTQSSWKSTVASAMYAVVTPMLNPFIYCLRNKDIKGALWRLISRISSSQ*
139 >lcl|XP_001366180.2|Plus1482788..483726 NW_001581911 olfactory receptor 7C1-like LOC100012003 __SEG__ Chr3 {Monodelphis domestica} MVPGNQTQFTGFILLGFSETPEEQGPLFGLFLGMYLVTVLGNLFIMLAIGSDSHLHTPMYFFLSNLSFVDLCVVSTTVPKMLVNILTQNKAIPYADCFAQMYFFIIFASL
DNFLLTVMAYDRFVAICHPLHYAAIMSPRLCVLLVLLSWILSLLDSLLHCLMVTRLSFCAHKIQHFFCDLDQVMKLSCAGTFINYVLVYLAIGLLGIIPLTGILFSYSQI
CSSILKVPSSGGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSSTTHSSWKSTIASVMYAVVTPMLNPFIYSLRNKDIKNALRRLISKIISSRS*
140 >lcl|XP_001366205.1|Plus151856698..51858005 NW_001581879 trophoblast glycoprotein-like LOC100018221 __SEG__ Chr2 {Monodelphis domestica} MPAGCARGPAAAAAVGDRRLRLARLLLVLLGWVSSSTSTSSSSPSSSSTSSSSLSSVSAQPPPQPPPPPGHCPAPCECSEAARTVKCVNKNLTEVPGDLPRYVRTLFFTG
NHLAVLPASAFASRPPLAELAALNLSGSHLQNVSFDAFEHLPSLRQLDLSHNPLVVLSPFSFSGGGGSSNASGLDRSSLAELFLNNILPPGYSDLHNLSFSGMVEVLQSR
GALRNLVRLELSGNNFISLPQEMFSALPKLKHLDLHNNSLVGLGNLALSNLTQLETLDLGNNALKTLYNATLVQLQALPNLRVNLDSNPWRCSCELADMVAWLKETNLVE
GKTTLSCFSPEKMRNRPLVKLNSSDLDCGPPSLVDPLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWLYNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
141 >lcl|XP_001366278.1|Plus1complement(29919370..29921322) NW_001582020 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr8 {Monodelphis domestica} MKLLWQVTVYHTWNAILLPIVYLTAQVWILCVAIAAAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRN
SIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVG
LEELEMSGNHFPEIRPGSFRGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRC
HAPLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRIAELKCRTPPMSSVRWLLPNGTVLSHASHHPRISVLNDGTLNFSHVLLTDTGVYTCMVTNVAGNSNASAYL
NVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKVAVTTADTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKL
RKRHQQRSTVSAARTVEIIQVDEDIPATTAAAAPSSVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
142 >lcl|XP_001366295.1|Plus11100578..1102347 NW_001582005 kelch domain-containing protein 7B-like LOC100012096 __SEG__ Chr8 {Monodelphis domestica} MVLRSHPFPSSAKRQGEAPQTGPVDRSSAAAEPSRSSQTRDLPPGVSAVGTEPQATVRDQPLSAGMETPAATTPSSSRGLNGAPVEEKRPATTEPPRVTRGPSSPPGPPP
ERKQQEPTVPRETRPEGQPAPRPRKRSICQMADSLAQRAGPAAPPQRESPPGMVTPLTERQLQDSQLMAFLRRPGTWGRAEGPRKPSHPPKDLAGAVAAVRRHLDLGSCV
AALAFAQQHGELALAEEVYALMSDNFLLVLGDAPLYRQLSGGDRERILALRKTRGRPVLGLLVLPSVYGVSRSALAGEPQATEVPATPSAGVPRTYLYTFEPGRNAWQPL
TLVPEEAPLRGCGLCTMYNYLFLAGGVRGSGPAAVSTNEVFCYNPLTDIWSPVRPMLQARAQLKLVALEGLLYAIGGECLYSMECYDPRTDHWASRASLPEGTFPVAHEA
VACRGDIYVTGGHLFYRLLKYSPAQDSWAECPYSASHRRSSDMVALGGFLYRFDLLRGVGAAVMRYNTVTGSWSQAAPLPLPEPLPLRCAVLANTIYCLNQQVTATFTVS
EGTAQFEARQLKPFPLGGRGALCPFTLTLPTSSPLQTPL*
143 >lcl|XP_001366328.2|Plus118773628..18774575 NW_001581971 olfactory receptor 8K1-like isoform 2 LOC100020485 __SEG__ Chr5 {Monodelphis domestica} MEDMIKQNETIGNQVTEFILMGITNRLELQGPLFGVFFLNYLVTALGNIGMIILTSVDSRLQTPMYFFLKHLAFVDLGYSTVIGPKMLVSFIVEKNRISYNGCATQLVFF
VTFIISELFILSAMAFDRYVAICKPLLYTVIMSDRVCCILVAIPYVYSIMVSLLVTIKIFNSLFCASNVIRHFYCDSLPLLSIVCSDTSEIELIIMTLSAFNLISSLFIV
LVSYMFILVAILKMNSAEGRHKAFSTCGSHLTVVAVFYGTLLFMYLQPQSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKGACKRFFKKMM*
144 >lcl|XP_001366329.1|Plus1complement(45320509..45322113) NW_001581976 inositol 1,4,5-triphosphate receptor-interacting protein-like 2-like LOC100018710 __SEG__ Chr6 {Monodelphis domestica} MSVHYTLNLRVFWPLVTGFCTALVCLYHVLSGRGGPAASQDTEDTGFPLLKAIFLLLLGYLLLRFRHAARQRFLRRAPHQGLATSSKRLLREPGLDVLLESYYEHEVRLS
PHVLGHSKAHVSRIVGELVRAGRARGSPGPSPGGALALAFRGDFVQVGSAYEQHKIRRPDGFDVLVPLRLPPLVALEPRGLGAEPELPLALRGCFLCALKASPSSPSGGV
GSQWQRDSKPFSDGFCVDLRGRRHLSAALVSRWFQAHLQRCLATVRYSLEERCRVSLSPGGLDQPPTLHILPCRTDYGCCRLSMAVRLIPAVHLGDGVFLVAPPLSPLGL
PSELPGGLRAEALWGLNTARQEQRLLAWLQERAPPGACHLKCLQLLKALRDLGARGLDPVASSQWGRILSSYTLKTALLTLLLRGDPLHCWEEVRLRERLEELVLYLRDC
LLRHRPLFHCLLGPDRAVGLTLEMGQLPKVLREAAPVDLLASFDGRTREFVAARLVSTWRRLPQLLRAYGGPRYLARCPQPRSPRAQGFPEHDP*
145 >lcl|XP_001366357.2|Plus1complement(2141907..2142839) NW_001582021 olfactory receptor-like protein OLF3-like LOC100012145 __SEG__ Chr8 {Monodelphis domestica} MGADNVSWVNEFILLGLSTDQQTQTGLFVLFGATYLLTLLGNGLIILLIWLDSRLHSPMYFFLCNLSVVDIFYTTSGVPQMLAHFLMEKKTISYTRCATQLFFSLALGGI
EFLLLAAMAYDRYVAVCDPLQYVMVMHRGMYVSLAIVSWLIGLVNSAVETAVTVTLPTCGRNVLNHVACETLALVRMACVDITINQIIILISSVIVLLVPCCLVSLSYAH
IVAAILRIRSTEGRRKAFGTCTSHLTVVSMSYGMALFTYMQPRSSASAEQDKMVVLFYAVVTPMLNPLIYSLRNKDMKAALRKVIGRSSA*
146 >lcl|XP_001366405.2|Plus1611185..612120 NW_001581911 olfactory receptor 1I1-like LOC100012177 __SEG__ Chr3 {Monodelphis domestica} MGQDNHTSVSEFLLLGLSEKPEQQLLLFGIFFTMYMVTMIGNLLIILAIYSDSHLHTPMYFFLSNLSFVDLCQISTTMPKMLINILTHNKAIPYAGCLVQMYSFHLFGTM
DSFLLAVMAYDRFVAICHPLRYATIMSPRLCVLLVGGPWGITNLQSVVHTSLMAKLTFCADNKIPHFFCDLMPLLKLSCSDTHINELVILIFGIFMGISPLVCILLSYIC
IFCAVLRVPSAKGKWKAFSTCGSHLTVVLLFYGTIFAVYLQPSGPTSPQKDKAAAVMCAVVIPMLNPFIYSLRNRDMKSALRKLISRTSSQ*
147 >lcl|XP_001366498.1|Plus118846855..18847793 NW_001581971 olfactory receptor 5M9-like isoform 1 LOC100020638 __SEG__ Chr5 {Monodelphis domestica} MPSPNYTDVTECILLGLTSQQELQILFFVIFLFVYVITLVGNLGMIILINVSPKLQSPMYFFLSHLSFVDAWFSSNVTPKMLENLLSKTKTISYVGCLIQCYFFIALVYM
EINILAVMAFDRFMAIWNPLLYGSKMSRIVCIWLITVPYVYAFSISIICTWWTHGLHFCGNVEINHFYCADPPLIKIACGGVHIKEYTMLVLAGISITCSLAVVLISYTC
IVVAILRIRSAEGRRKAFSTCSSHLTAVTIFYGTLIFMYLRHPTNESVQQSKMVAVFYTTIIPMLNPMIYSLRNKDVKEAMNKAIQRSCLMK*
148 >lcl|XP_001366526.1|Plus12484842..2485894 NW_001581994 c-X-C chemokine receptor type 1-like LOC100012266 __SEG__ Chr7 {Monodelphis domestica} MSSRYILNEYNWGSAFDNYTDFIASDAMPCDVGSWRINKYFVMVIYSLVFLLSLLGNSLVILVILYNRISRSVTDIYLLNLAIADLLFALSLPIWAASKIKGWLYGTALC
KIVSLLKEVNFYSGILLLACISVDRYLAIVHATRSLTQKRHWVKFVCLGIWGLSLLLSMPIILSREAFKSEDYGFVCYEDLGKKTEIWRLVLRILPQVFGFVLPLLVMLF
CYGFTLRTLFEARMGQKHRAMKVIFAVVLIFLLCWLPYNLVLVADTLMRTHIIEETCERREEIDQAISVTEVLGFLHSCLNPIIYAFIGQKFRYSFLKILAAHGVVSKEF
LSRHQISSSSFASSSVSAAV*
149 >lcl|XP_001366576.1|Plus1complement(2518749..2519819) NW_001581994 c-X-C chemokine receptor type 1-like LOC100012302 __SEG__ Chr7 {Monodelphis domestica} MSIEEIYNLTFGDDDFLYSGYGTGLPPLSEDAAPCHSESSGLNKYFVIIIYSLVFLLSLLGNSLVILVILYNRISRSVTDIYLLNLAIADLLFALSLPIWAASKIKGWLY
GTPLCKIVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHWVKFVCLGIWGLSLLLSMPIILSREAFKSDDYGFVCYEDLGKNTTTWRLVLRILPQVFGFVLPL
LIMLFCYGFTLRTLFEAHMGQKHRAMKVIFAVVLIFLLCWLPYNLVLVADTLMRTHIIEETCGRREEIDQAISVTEVLGFLHSCLNPIIYAFIGQKFRYSFLKILAAHGV
VSKEFLARHSKPSVHGSSSGNTSTTL*
150 >lcl|XP_001366631.2|Plus12367536..2368492 NW_001582021 olfactory receptor-like protein OLF3-like LOC100012347 __SEG__ Chr8 {Monodelphis domestica} MGTGNQTWVSSFILLGLSSDWKTQVLLFVLFLAMYLVTVLGNILIIILICLDSHLHTPMYFFLTNLSLVDVSYATTIVPQLLVHFLEEEKLIPYLSCATQLFFSLGLGGI
EFVLLATMAYDRYVAVCNPLRYSAIMHGGLCVRLVTASWVGGSLNSLMQTAITFQLPMCTNRVIDHISCELLALVRLACVDTSSNEVAIMASSIVLLMTPFLLVLLSYIK
IISTILKIQSTEGRKKAFQTCASHLTVVALCYGMAIFTYIQPHSSPNILQEKMISLFYALLTPMLNPLIYSVRNKEVKGAWQKLLGQFYELKSKLTSS*
151 >lcl|XP_001366671.2|Plus11934456..1935412 NW_001581928 olfactory receptor 2AT4-like LOC100012380 __SEG__ Chr4 {Monodelphis domestica} MDAWTCNNSDGSPISFYLMGIPSLSKSLFLPIFFIFLILYLIVIAGNFLILVAVMSDSNLHKPMYFFLTNLSVLDILFTTTTIPKMLSLYLLGDRILSFPACFLQMYFFH
SFSCSEAFMLVVMAYDRYEAICHPLHYTVRMTPQVNAGLAASAWLAALLLPIPAVVQSSQMAFGTLVQVLHCFCDHLAVVQASCSDPTFQTFLGFCCAMAVSFTPLLLVV
LSYARILISILKISSKEGRAKAFSTCTSHLLVVGTYYTSIIVSYVVYRANLPVDFHIMGNVVHSIFTPIVNPLIYTLRNKDVKAAITKFMSLWSRGYP*
152 >lcl|XP_001366678.2|Plus12387585..2388544 NW_001582021 olfactory receptor-like protein OLF3-like LOC100012393 __SEG__ Chr8 {Monodelphis domestica} METDNQTWVSSSFILLGLSSDWGTQIFLFILFLSIYLLAVLGNILIIILIRLDTRLHTPMYFFLTNLNLVDVSYATSIVPQMLAHFLEEQKTIPYVSCAAQLFFSLGLGG
IEFVLLATMAYDRYVAVCNPLRYSAIMHVGLCARLVTASWVSGSLNSLMQTAITFQLPMCTNRVIDHISCELLALVRLACVDTSSNEVAIMASSIVLLMTPFLLVLLSYV
KIISTILKIQSTEGRKKAFQTCASHLTVVILCYGMTIFTYIQPHSSPNILQEKMISLFYALLIPMLNPLIYSVRNKEVKGAWQKLLGQFYELKSKLTSS*
153 >lcl|XP_001366703.1|Plus1complement(65158351..65159430) NW_001581968 protein mab-21-like 2-like LOC100018254 __SEG__ Chr5 {Monodelphis domestica} MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTG
KQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALESAAKQTWRLAREILTNPKSLDKL*
154 >lcl|XP_001366723.2|Plus12029953..2030918 NW_001581928 olfactory receptor 2AT4-like LOC100012424 __SEG__ Chr4 {Monodelphis domestica} MTHCGNQSIPSHKTVFILLGFPALQETPLPLFFTVLALYTFIVVGNVLILVAVVGDPRLHKPMYFFLCNLSAVDILFTTTTVPKMLAMFLFQHNTISFEGCFLQMYSFHS
LGVMESFILVVMAYDRYEAICHPLHYPVRMTPQANARLAASAWAMALVIPAPVMVETSQLEYTARATVEHCFCDHLAVVRAACQDAGTEQQTFIGFCIAMTVSLVPLFLV
LFSYGKILASILRIASQEGRAKAFSTCTSHLMVVGTYYSSIAVAYVSYQMEMAIDLHVLSNVIYAILTPMLNPLIYTLRNKDVKEAIKTVFQHVFSHLKNP*
155 >lcl|XP_001366763.1|Plus1complement(68875171..68878059) NW_001581989 SLIT and NTRK-like family, member 5 isoform 1 SLITRK5 __SEG__ Chr7 {Monodelphis domestica} MYPCCSTLTLEQDLNRKMHIWMLQTIAFAVTSLVFSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLAEISPPRFPVYHLLLSGNLLNRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLESLEYLQVDYNYISAIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYIGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKP
PKGTRQPNKPRVRPTSRQPTKDLAYSNYGPSIAYQTKSPVPLECPTACSCNLQISDLGLNVNCQERKIESISELQPKPYNPKKMYLTENYITVVRRTDFLEATGLDLLHL
GNNRISVIQDRAFGDLTNLRRLYLNGNQIERLSPELFYGLQSLQYLFLQYNIIREIQVGTFDTVPNLQLLFLNNNLLQALPGGIFSGLTLLRLNLRSNYFSSLPVSGVLD
QLKSLIQIDLNDNPWDCTCDVVGMKLWVEQLKVGVLVDEVICKAPKKFEETDMRSIKSELLCPDYSDVVVSTPTPSSIQIPPRTTSLPSTVRFNSTGATAGGGSGNSASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYSSSGGSSHHHSHTHHRGPTLPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREGN
SVEDYKDLHELKVTYSSNHHLQPQQQQQPQQQPQQPQQQQQQPQQQLQLQQGEEERRESHHLRSPAYSVSTIEPREELLSPMQDADRFYRGILEPDKHCTATTAGSSLPE
YPKFPCSPAAYTFSPNYDLRRPHQYLHPGAGDSRLRETVLYSPPSTVYVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF*
156 >lcl|XP_001366780.2|Plus1complement(696330..697277) NW_001581911 olfactory receptor 10T2-like LOC100012468 __SEG__ Chr3 {Monodelphis domestica} MKLGNETWIVKEFVLVGFSNFPDLKPTLFSLFLLMYLITLSGNITIITIIYLDHTLHTPMYCFLGVLSLSETCYTLVTIPNMLVHLLMENQVISISSCRAQMFFFLGLGC
SNCFLLTLMGYDRYVAICHPLRYPMIMSPSVCIRLGALVFCSGFLVAIIETCLIFSSSFCNDNRVVHFFCDIAPVLKLSCTQSIAKALAIFFLSVIVVLFSFLLILLSYA
FIVAAILRIPSAEGRRKAFSTCVSHLTVVIVHFGCASIIYLRPESGSNPEKDLMVAVFYTVVTPLLNPVVYTLRNKEVRVALKRTLGRRLRTQSL*
157 >lcl|XP_001366786.1|Plus1complement(963540..964967) NW_001581972 zinc finger and BTB domain-containing protein 3-like LOC100012474 __SEG__ Chr5 {Monodelphis domestica} MEFPGHSEQLLQSLRDQRSQGFLCDCTVLVGSTPFQAHRAVLASCSPFFQLFYKERELDKRDLVCIHNEIVTAPAFGLLLDFMYAGQLALRGDTPVEDVLAAASYLHMND
IVKVCKRRLQARGLAEADSTKKEEESRAPRTTPEPLPSTSRGLLPVLPLQETPGWRDQNQWKAPAPALPSGPHAEEPPGPEGADTTQPGIDAPVAEGSHSSPTSSTEAVP
TGYFSPSLGAAPGEPPAPLEVGPENLGVVGPRGPSGPMEGFYPPPPVPVPVPAPGEAEPVQVKVEAIVISDEEPEGLEERPRAPEGLFPPGSGCRSRYAPAEAFEEAAVT
AASGAGGPGLEEVGPADHFLAPDSHLPYHLLAGPGHYHPGLVTPPPPAPSSLHESLYLPPEYEVAPGGFGVFTEDVPTCKTCGKTFSCSYTLRRHATVHTRERPYECRYC
LRSYTQSGDLYRHIRKAHNEDLAKRSKQDPEAAPS*
158 >lcl|XP_001366792.2|Plus12428460..2429407 NW_001582021 olfactory receptor 6B1-like LOC100012481 __SEG__ Chr8 {Monodelphis domestica} MDVENQTMVTEFILVGFPGSKTMRRLVFLMFLLAYILTVSENVIIILLVQKNPPLHKPMYFFLANLSFLETWYISVTVPKLLFSFWSLSNSISFSHCMTQLYFFIALMCT
ECVLLAAMAYDRYVAICRPLHYPTIMSHGLCFRLALGSWATGFGISLAKIYFISRLSFCGPNVINHFFCDISPVLNLSCTDMSMAELVDFILALIIFLFPLSITVLSYAC
ILFTVLKMPTGKQKAFSTCASHLVVVTVFYSATIFMYARPRAIHAFNMNKVISIFYAIVTPALNPFIYCLRNREVKEALKKLACVQDTRNDPSGH*
159 >lcl|XP_001366795.1|Plus1complement(34421755..34423740) NW_001581835 leucine-rich repeat transmembrane protein FLRT2-like LOC100016482 __SEG__ Chr1 {Monodelphis domestica} MGLKTTKWPSHRALLLKSWVIISLGLYMQVSKNMACPNVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHSVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLSKLKEFSIVRNSLSHPPPDLPGTHLVKLYLQDNQINHIPLTAFSNLHKLERLDISNNQLRMLAQGVFDNLSNLKQLTARNNPWFCDCGIKWVTEWLKFIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGFSLMTPPPSVIPPTTQIPTQPAATPSGNSTPLTPTVSKLLPTVPDWDGRERVTPVVSERILLSVHSVNDTSIQV
SWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQDLSLINLEPKSTYRICLVPLDAFNYRAGEDTVCSEATTHASHLNNGSNSASSHEQTTSHNMGSPFLLAGLIGG
AVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCH
T*
160 >lcl|XP_001366835.2|Plus1complement(752439..753386) NW_001581911 olfactory receptor 10T2-like LOC100012510 __SEG__ Chr3 {Monodelphis domestica} MKLGNETWIVKEFVLVGFSNFPDLKPTLFSLFLLMYLITLSGNITIITIIYLDHTLHTPMYCFLGVLSLSETCYTLVTIPNMLVHLLMENQVISISSCRAQMFFFLGLGC
SHCFLLTLMGYDRYVAICHPLRYPMIMNPSVCIRLGALVFCSGFLGGHHETALIFSSSFCNDNRVVHFFCDIAPVLKLSCTQSIAKALAIFFLSVIVVLVSFLLILLSYA
FIVAAILRIPSAEGRRKAFSTCASHLTVVIVHFGCASIIYLRPESGSNPEKDRMVAVFYTVVTPLLNPVVYTLRNKEVRVALKRTLGRRLRTQSL*
161 >lcl|XP_001366883.2|Plus12081109..2082074 NW_001581928 olfactory receptor 2AT4-like LOC100012548 __SEG__ Chr4 {Monodelphis domestica} MTHCSNQSIPSHKTVFILLGFPALQETPLPLFFTFLALYTFIVVGNVLILVAVVGDPRLHKPMYFFLCNLSAVDILFTTTTVPKMLAMFLFQHNTISFEGCFLQMYSFHS
LGVMESFILVVMAYDRYEAICHPLHYPVRMTPQANARLAASAWAMALIIPAPVMVETSQLEYTARATVEHCFCDHLAVVRAACQDAGTEQQTFIGFCIAMTVSLVPLFLV
LFSYGKILASILRIASQEGRAKAFSTCTSHLMVVGTYYSSIAVAYVSYQMEMAIDLHVLSNVICAILAPMLNPLIYTLRNKDVKEAIKTVFQHVISHLKNL*
162 >lcl|XP_001366894.2|Plus12498499..2499431 NW_001582021 olfactory receptor 2A1/2A42-like LOC100012563 __SEG__ Chr8 {Monodelphis domestica} MEDNQTMVTEFILLGFVLGPKMKMFLFGLFSLFYTLTLLGNAVILGLICLDSRLHSPMYFFLSHLAIVDISYASNTVPPLLGNHLDPVKPISFAGCLTQTFFFLTFALTE
CLLLLVMSYDRYVAICHPLRYSVIMNWKVCTALAITPWGSAAFLALVNVILILRVPFCGNLEVNHFFCELLSILRLTCANIWVNQVMVFITSFLFLLGPFCLVLVSYMRI
IWAILRIQSGEGRKKAFSTCSSHLCVVGLYFGSGIAMYMIPNSSNPEQQKKILSLFYSFFNPTLNPLIYSLRNAEVKGALRRVLGKERPK*
163 >lcl|XP_001366930.2|Plus1complement(5006916..5007851) NW_001581872 olfactory receptor 4D1-like LOC100012586 __SEG__ Chr2 {Monodelphis domestica} MEAGNLTSVTEFVLLGLSQAQELQGFLFLVFLIVYITTVMGNLLIIITVTSDTRLHTPMYFLLRNLAVIDLCYSSVTAPKMLMDFLSEAKTISYQGCMTQIFFFHLLGGG
TVFFLSVMAFDRYVAISRPLHYVTIMNSQMCLGLVVAAWAGGFVHSIVQLALLLPLPFCGPNVLDNFYCDVPQVLRLACTDTSLLELLMITNSGMLVLIWFLLLLASYTV
ILVMLRSHSGEGRRKASSTCTTHIIVVSLIFVPCIYIYARPFTSFPLDKAVSISYTVITPMLNPMIYTLRNQEMQSAMKRLGIRLLVCRRE*
164 >lcl|XP_001366934.2|Plus12109996..2110961 NW_001581928 olfactory receptor 2AT4-like LOC100012591 __SEG__ Chr4 {Monodelphis domestica} MAHCSNQSIPPHVTVFLLLGFPALQEAPLPLFFTFLALYTLIVVGNVLILVAVVGDPRLHKPMYFFLCNLSVLDILFTTTTVPKMLAMFLFQHNTISFEGCFLQMYSFHT
LTVMESFILVVMAYDRYEAICHPLHYPVRMTPQANARLAASAWAMALVIPAPVMVETSQLEYTARATVEHCFCDHLAVVRAACQDAGTEQQTFIGFCIAMTVSLVPLFLV
LFSYGKILASVLRIASQEGRAKAFSTCTSHLLVVGTYYSSIAVAYVSYQMEMAIDLHVLSNVIFAILTPMLNPLIYTLRNKDVKEAIKTVFQHVFSHLKNH*
165 >lcl|XP_001366939.2|Plus12533486..2534418 NW_001582021 olfactory receptor 2A5-like LOC100012600 __SEG__ Chr8 {Monodelphis domestica} MENNQTTVTDFILLGFLVSPKMKMILFGLFFLFYTFTLLGNGVILGLICLDSRLHTPMYFFLSQLALVDICYASNTVPQMLVNLLDPVMPISFAGCIMQNSFFLTFAHTE
CFLLLAMSYDRYVAICHPLRYILIMNWGVCIALAITSWACGSLLALVQVVLLLRLPFCGPREINQFFCELLSVLKLACADIWLNKVVSLIASVLILVVPLCLVLTSYTRI
LGAILKIQSGTGRKKAFSTCSSHLSVVGLFFGSAIIIYMTPKSKNSEELQKILFLFYSFFNPTLNPLIYSLRNAEVKGALKRLLRKESVS*
166 >lcl|XP_001366959.1|Plus1complement(35362215..35363219) NW_001581963 G-protein coupled receptor 12-like LOC100019540 __SEG__ Chr4 {Monodelphis domestica} MNEDLKVNLSWLPQDHLDASSPENVSAAVSSQIPVIEPEPELIVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLIINFIFAYLLQSE
ATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYNSERTVTFTYIMLIMLWGASICLGLLPVMGWNCLKDESTCSVIRPLTKNNAAILSVSFLLMFALMLQLYIQI
CKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALWLICCGCIPSNLSQRARS
PSDV*
167 >lcl|XP_001366967.1|Plus172572589..72575114 NW_001581989 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr7 {Monodelphis domestica} MKLWIHLLYSALIASASIQSPPALSPVRGSCDSLCSCEEKDGLLLINCEKRGIKTLSQINVPPSRPFHLFLVNNGLTTLHTNDFSSLNNAILIHLGFNNIVDIEPGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLHRLKVLILNDNAIEFLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
VCNCDLLQLKTWLENMPPQSIIGDVVCSSPPFVKGSVLSRLKKESICPTPPVHEEYEDPSGSLHLVVTSSINDGHISTKMTSILKSPTKVPGFVPYATKPSTPIPGPYCP
IPCNCKVLTPSGLLIHCQERNIESLSDLRPPPQNPKKLILAGNIIQTVMKSDLVEYSTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLIKLKRGLFLGLQNLEYL
YLEYNAIKEILPGTFNTMPKLKVLYLNNNLLQTLPPHIFLGVPLTRINLKTNQFAHLPVSNVLDELDFLIQIELEDNPWDCSCDLVGLQQWIQKLSKDVVTDDVLCTSPE
HLDKKDLKSLNSELLCPGLINSPSQQTHPSFIIVTTPSTTTNTADTLLRSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRCKKKQVDEQMRDSSPVHLQYSM
YGHKMTHHTTERPGASMYEQHMVSPMVHVYRSPSFSPKHLEEEEEKNDKDGNDSKHLQRSLLERENNSPLTGSNVKYKATDQSAEFLSFQDASSLYRNILEKERELQQLG
ITEYLRKNIAQLQPEIEVHYPGTHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
168 >lcl|XP_001366973.2|Plus1complement(5018367..5019317) NW_001581872 olfactory receptor 4D2-like LOC100012625 __SEG__ Chr2 {Monodelphis domestica} MEAGNFTRVTNFIFLGLSETPELQDFLFLVFLIVYITTILGNLLIMVIVTFDSRLHTPMYFLLRNLAVVDICFSSVTTPKMLIDFLSEPKTISYQGCMTQIFFFHFLGGA
TVFFLSVMAFDRYVAISRPLHYVTIMNSQMCLGLVVAAWAGGFVHSIVQLALLLPLPFCGPNILDNFYCDVPQVLRLACIDTSFLELLMITNSGLLDLIWFLILLASYTV
ILVMLRSLSGEGRRKASLTCTTHIIVVSLIFVPCIYIYARPFISFPIDKAVSISYTVITPMLNPMIYTLRNQEMRAAIKRFGRHPATCRMSEIHAS*
169 >lcl|XP_001366983.1|Plus1complement(11336467..11338389) NW_001581989 rab proteins geranylgeranyltransferase component A 1 CHML __SEG__ Chr7 {Monodelphis domestica} MADKLPSEFDVIVIGTGLPESITAAACSRSGQSVLHLDSRSYYGGNWASFSFSGLLSWIKEYQEQSDIGEEWTAWKELILETEEGIALRKKDQTIQHVEVICYASQDSDD
HAEEIGALQKNPASLTSAGTNHPPDSMDTASSDTSKLLAPLSEPETALVVPEVDMTLEKENDGSYTDCSQLDLEPKKTENILITEDVADAPKKSGITYSQIVKEGRRFNI
DLTSKLLYSRGLLIDLLIKSNVSRYAEFKNVTRILGFQEGSVLQVPCSRADVFNSKKLTMVEKRMLMKFLTFCLDYEQHPNEYKAYEESTFSEYLKTQKLTPILRHFVLH
SIAMASETSTSTLDGLRGTKNFLQCLGRYGNTPFLFPLYGQGEIPQCFCRMCAVFGGTYCLNHAVQCLVVDKESGKCKAIIDHFGQRINAKYFIVEDSYLSEKTCSNVTY
TQISRGVLITDRSILKTDSDQHISVLTVPPVEPGSAAVRVIELSSSTMTCMKGTYLVHLTCTSSKNTAREDLELVVQKLFTPYAEVELEREALEKPGLLWALYFNMRDSS
GINRDSYNDLPSNIYVCSGPDYVLGNEYAVKQAKTVFQHFLPNEEFCPPPPNPEDIVFDADSMQPDVLAPKPDTTEEIKVQRNTEEHAQE*
170 >lcl|XP_001367037.2|Plus12581620..2582552 NW_001582021 olfactory receptor 2A5-like LOC100012685 __SEG__ Chr8 {Monodelphis domestica} MESNQTTVTDFILLGFLVSPEVKRFLFGLFFLLYTCTLLGNGVILGLICLDSRLHTPMYFFLSQLALVDISYASNTVPQMLANLLDPAKPISFAGCITQTHLFLMFALIE
CLLLVMMSYDRYVAICHPLRYTLLMNRGLCTALAITSWAGGSLLALVHVILLLRLPFCGPREINHFFCEILSVLKLACADTWLNQVVIFVACVFILVVPLCFVLTSYTHI
LGAILGISSREGRKKAFSTCSSHICVVGLFFGSAIITYMVPKSRNSEKERKILFLFYSFFNPTLNPLIYSLRNAEVKGALRRLLRKERVG*
171 >lcl|XP_001367073.2|Plus12668436..2669374 NW_001581905 olfactory receptor 7C1-like LOC100012711 __SEG__ Chr3 {Monodelphis domestica} MGPGNQTCVSEFFLLGFSEKSEHQLPLFGLFLGMYIVTLFGNLLIMLAIGSDSHLHTPMYFFLSNLSLVDLCLVSTTIPKMLANILIHSKAISYAGCLTQMYFFLIFACM
DNFLLSVMAYDRFVAICHPLRYVAIMNPQLCGLLVLISWALSLLISLLHNLMVMHLSFCKDHEIPNFFCDLTQILKLSCSETLTNNILVYFTTGLLGIVSVTGILTSYTQ
ICSSILKIPSAGGKYKAFITCGSHLCVVSLFYSTVFGVYMTSSATHSSWKSMVASVMYAVVTPMLNPFIYSLRNKDIKDALKKFISRSSSSQ*
172 >lcl|XP_001367085.2|Plus12622471..2623403 NW_001582021 olfactory receptor 2A1/2A42-like LOC100012724 __SEG__ Chr8 {Monodelphis domestica} MESNQTTVTDFILLGFLVSPEVKRFLFGLFFLLYTCTLLGNGVILGLICLDSRLHTPMYFFLSQLALVDISYASNTVPQMLANLLDPAKPISFAGCIMQTHLFLTLAHVE
CLLLVMMSYDRYVAICHPLRYTLIMNRGMCIALAITSWAGGSLLALVHVILLLRLPFCGPREINHFFCEILSVLKLACADTWLNKLVTFIACIIIVVAPLSLVLISYTHI
LAAILRIHSREGRKKAFSTCSSHLCVVGLFFGNAIILYMTPNSRKSEEQHKILFLFYSFFNPTLNPLIYSLRNAEVKGAFRRMLRKERLG*
173 >lcl|XP_001367113.1|Plus130358378..30358827 NW_001582018 calmodulin-like LOC100018982 __SEG__ Chr8 {Monodelphis domestica} MADQLTEEQIAEFKEAFSLFDKDGNGTITTKELGTVMRSLGQNPTEVELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEICEAFRVFDKDGNGYISAAELRHIM
TNLGIKLTDEEVDEMIREADIDGDGQVNSEEFVQMMTAK*
174 >lcl|XP_001367121.2|Plus12686882..2687820 NW_001581905 olfactory receptor 7C1-like LOC100012756 __SEG__ Chr3 {Monodelphis domestica} MEPLNRTHSLEFLLLRFSEKLEQEMPLFGLFLSIYVVTVIGNLLIMLAIGSNSHLHTPMYFFLSNLSFVDLCLVSTIVPKMLENIMMHSKAISYAGCLAQMYFFMVFTCM
DNLLLTVMAYDRFVAICHPLHYVSIMSTQLCGLLVLLSWIVSLLISLLHSMMAMHLSFCKDHNIPHFFCDLSQVLKLSCSDTFINNILMYFATSLLGIVPLTGILFSYSQ
ICSSILRVPSPEGKYKAFSTCGSHLCVVSLFYGTAFGVYLSSSTAHSSWKNSITSVMYTVITPMLNPFIYSLRNKEIKDALRRLTIRPTFSQ*
175 >lcl|XP_001367130.2|Plus1complement(5246..6187) NW_001581980 olfactory receptor 13D1-like LOC100012766 __SEG__ Chr6 {Monodelphis domestica} MNEENHTTVTEFFLVGLSHYPGLLLSLYVLCLVMYLVILLGNSILIIISILDPRLHTPMYFFLGNLSFLDICYTSSSIPQMLIIVMSERKSISFTGCALQMVISLGLGCT
ECILLAVMAYDRYVAICNPLRYTIIMNKGLCAQMAAWTWITGFLVSLVQTVLALLKPFCGNVIDHLTCEILALLKLLCGDISLNVFIMTVASIVILIIPLTLIFFSYIFI
LSTILRINSSEGRKKAFSTCSAHLTVVVLFYGSALFIYMKPKSKDTKTSDELIGLSYGVITPMMNPIIYSLRNKEVKNAVEKFLIKNLYLKKI*
176 >lcl|XP_001367157.2|Plus121484447..21485385 NW_001581971 olfactory receptor 5B12-like LOC100023711 __SEG__ Chr5 {Monodelphis domestica} MASMENRTQVNEFILLGLTDAPELQVPFFLLFTLIYLITLVGNLGMVAMISWDSHLHTPMYFFLSNLSLVDFGYSSAITPKVMAGFLMGNKVISYNGCAAQMLFFLAFAS
TENFLLATMAYDRHAAVCRPLHYTTTMTTSVCAGLAIASYICGFLNSAIHTGDTFSLFFCNSNVIHHFFCDIPPLLDLSCSDSHTAEWVLFIVGGFTAFFAILVILASYL
FIFITILKIRSSEGRQKAFSTCATHLTAVSIFYGSTIFMYLQPSTNHSMDTDKTASVFYTMIIPMLNPLIYSLRNKEVKRALQKAARRQRCS*
177 >lcl|XP_001367176.2|Plus1complement(29932..30870) NW_001581980 olfactory receptor 13C4-like LOC100012815 __SEG__ Chr6 {Monodelphis domestica} MERQNKTSVTIFLLHGLDGYPVFYFIFFLLCLIMYIVILLGNSFLITVSILDSHLHTPMYFFLSNLSFLDICYTSASIPMLLVNFLSEEKSISFIGCGIQMFFSFAMGST
ECVLLAIMAYDRYLAICKPLRYPIIMNKGLGVTLVTSCWMAGGLTSVIQTTLTMKLSFCGNIIDYLTCEILAVLKLSCDDISLNVTVLMISNIFIILIPGAFIIISYFFI
LITILRINSVEGRKKSFSTCSSHLTVVIMFYGTALFMYMKPESKDSHATDELIALFYAVVIPMLNPIIYSLRNKDVKAAVKKLSKNIFSQST*
178 >lcl|XP_001367178.1|Plus111759477..11760433 NW_001581992 casein kinase I isoform alpha-like LOC100012818 __SEG__ Chr7 {Monodelphis domestica} MAHKKGSKNSELVFGGKYKLMKKIGAGSFGKIYLAVNVSNGEEVAVKMESQKARSPRLLHESRLYKALQGGVGIPHMRWYGRDKGYNVLVMDLLGPSLEDLFNFCSRRFT
MKTVLMLADQMISRIEYVHAKNFIHRDIKPDNFLMGTGRHANKLFLIDFGLAKKYRDNKTKQHIPYREDKNLTGTARYASINAHLGIEQSRGDDLESIGYVLMYFNRTSL
PWQGLNAATKKQKYEKISEKKLSTSVESLCKGFPAEFAMYLNYCRGLRFEEAPDYLYLRQLFRALFKTLNHQYDYTFDWTAMKQNSSQPAASSSGQGQ*
179 >lcl|XP_001367227.2|Plus12725013..2725954 NW_001582021 olfactory receptor 2A5-like LOC100012862 __SEG__ Chr8 {Monodelphis domestica} MWENQTMITEFILLGFSIGSEIQIFLFVLFSLFYVLTLLGNGIILGLICLDSHLHIPMYFFLSHLSIVDISYASNNVPKMLVILLNKGKTISFAPCIMQIFLYLAFAHVE
CLILVVMSYDRYVAICHPLRYTVIMSWRLCTTLTIISWAFSFLLALVHVVLILRLPFCGPQEVNHFFCEILSVLKLACADTQLNQLVIFTACVFILVGPLCLVLISYMRI
LSAILRIQSGEGRKKAFSTCSSHLCVVGLFFGSAIIMYMTPKSSHPEEQQKILSLFYSLFNPMLNPLIYSLRNAEVKGALRRMLKKENHSSKM*
180 >lcl|XP_001367274.2|Plus12737719..2738648 NW_001582021 olfactory receptor 13-like LOC100012901 __SEG__ Chr8 {Monodelphis domestica} MNNHTVVTEFILMGFPVGPDMRILLLGLFSLLYAFTLLGNGIILGLIYIETRLHTPMYLFLSHLAIVDISYACNTVPQMLANLLDPIKPISYSGCITQTFLFLTFALTEC
LLLVVMSYDRYVAICHPLRYSVIMSWRVCFTLSLTSWALGSLLSLAHLILLLPMPFCGPQKINHFFCEILAILKLACADTHILETLVLVGATSVLVGPLSSIVLSYIRII
CAILTIQSRKGRQKAFSTCSSHLCVVGLFYGTAIIMYIGPKHGNPKGQKKYLLLFHSLFNPMLNPLIYSLRNNEVKGALKRVLGKGRPS*
181 >lcl|XP_001367297.2|Plus1complement(23132287..23133222) NW_001581971 olfactory receptor 5AN1-like isoform 2 LOC100025133 __SEG__ Chr5 {Monodelphis domestica} MAGGKNSTAVTRFILLGFSDYPKLNAILFVIFLVIYLVTLTWNLCLITLIKVDSHLHTPMYFFLSNLSFLDICYVSSTAPKMLSDFFKEKKTISFGGCTAQYFIFSGMGL
TECCLLAAMAYDRYAAICNPLLYTSIMSPTLCVWMVVGSYLSGFFGSMIQLCSLLQLYFCGPNVIDHFFCDLPQLLVLSCSDTLALQILKFVIAVVFGLLSVLIIMVSYG
HIVEAILKISSAQGRSKAFNTCASHLMAVTLFYGSGLFVYMRPSSNDSFSYDKVVSVFYTMVIPMLNPLIYSLRNKEIKDALKRWEKRVFV*
182 >lcl|XP_001367313.2|Plus1complement(2766012..2766947) NW_001581905 olfactory receptor 7C1-like LOC100012932 __SEG__ Chr3 {Monodelphis domestica} MEPENQTYLSGFLLLGISEKEEQQMPLFGLFLGMYLVTVFGNVLIMLAIGSDSHLHTPMYFFLSNLSLVDLCLVTTLVPKMLVNMLTHNKAISYAGCFAQMYFFMNFACS
DNLLLTVMAYDRFVAICHPLHYVTLMSPRICSLLILISWTISILYSIFQIVMMMRLSFCTKREISHFFCELSEVIRISCSDTLINNIVVYFATGLLGVLPLTGILFSYSQ
ICSSILKVPSPGGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSATTHYSRNISIASVMYSVVTPMLNPFIYSLRNKDIKDALKRIINRTASP*
183 >lcl|XP_001367321.2|Plus1121335..122270 NW_001581980 olfactory receptor 2K2-like LOC100012941 __SEG__ Chr6 {Monodelphis domestica} MNWSTVAEFTLEGFSQYPKLEIILFILCLLMYLITLLGNNSILITISILDIHLHTPMYFFLSNLSFMDICYTTSSVTPLVVKIIGKRNTVPFIGCALQMYLSLAMGSTEC
LLLAVMAYDRYVAICHPLRYPIIMNKRVCLQMVAGSWITGCLTALLETSSALQLPLCGSAINHFTCEILALLKLACTSSLVMDMIMLVVSVLLLPIPMFLICISYSFILF
TILRINSADGRNKAFSTCSAHLTVVILYYGTALSMYLKPSSVDSQEIDKFITLFYRVVTPMINPIIYSLRNKEMKGAVKKLLRRNVFSQRF*
184 >lcl|XP_001367360.2|Plus1complement(2792585..2793520) NW_001581905 olfactory receptor 7C1-like LOC100012973 __SEG__ Chr3 {Monodelphis domestica} MEPENQTYLSGFLLLGISEKEEQQIPLFGLFLGMYLVTVFGNALIMLAIGSDSHLHTPMYFFLSNLSLVDLCLVTTLVPKMLVNMLTQNKVISYAECFSQMYFFMIFACS
DNLLLTVMAYDRFVAICHPLHYVTLMSPRICSLLILISWSISILNSIFQILMMLRLSFCTKREISHFFCDLSEVMKISCSDTLINTIEVYFATGLLGVLPLTGILFSYSQ
ICSSILKVPSPGGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSATTHSSRNISIASVMYSVVTPMLNPFIYSLRNKDIKDALKRIISRTASS*
185 >lcl|XP_001367366.2|Plus1207271..208203 NW_001581980 olfactory receptor 2K2-like LOC100012979 __SEG__ Chr6 {Monodelphis domestica} MNWSTVAEFTLEGFSQYPKLEIILFILCLLMYLITLLGNSILITISILDIHLHTPMYFFLSNLSFMDICYTTSSVSPLVVKIIGKRNTVPFIGCALQMYLSLAMGSTECL
LLAVMAYDRYVAICHPLRYPIIMNKRVCLQMAAGSWITGCLTALLETSSALQLPLCGSAINHFTCEILALLKLACTSSLVMDMIMLVVSVLLLPIPMFLICISYSFILFT
ILRINSADGRNKAFSTCSAHLTVVILYYGTALSMYLKPSSVDSQETDKFITLFYGVVTPMLNPIIYSLRNKEVKGAVKKLLRRNVFSQRL*
186 >lcl|XP_001367406.2|Plus1complement(2830901..2831836) NW_001581905 olfactory receptor 7C1-like LOC100013013 __SEG__ Chr3 {Monodelphis domestica} MESENQTYVSGFLLLGISEKEEQQMPLFGLFLGMYLVTVFGNVLIMLAIGSDSHLHTPMYFFLSNLSLVDLCLVTTLVPKMLVNMLTQNKAISYAGCFAQMYFFMNFACS
DNLLLTVMAYDRFVAICHPLHYVTLMSPRICSLLILISWSISILISIFEILMTRRLSFCKEREISHFFCDLSEVIKISCSDTLINNIVVYFATGLLGILPLTGILFSYSQ
ICSSILKVPSPGGKYKAFSTCGSHISVVSLFYGTGLGVYLSSATTQSSRNISIASVMYSVVTPMLNPFIYSLRNKDIKDALKRIISGTTSP*
187 >lcl|XP_001367413.2|Plus1complement(220832..221773) NW_001581980 olfactory receptor 13D1-like LOC100013022 __SEG__ Chr6 {Monodelphis domestica} MNEENHTTVTEFFLVGLSHYPGLLLSLYVLCLVMYLVILLGNSILIIISILDPHLHTPMYFFLGNLSFLDICYTSSSIPQMLIIVMSERKSISFTGCALQMVISLGLGCT
ECILLAVMAYDRYVAICNPLRYTIIMNKGLCAQMAAWTWITGFLVSLVQTVLALLKPFCGNVIDHLTCEILALLKLLCGDISLNVFIMTVASIVILIIPLTLIFFSYIFI
LSTILRINSSEGRKKAFSTCSAHLTVVVLFYGSALFIYMKPKSKDTKTSDELIGLSYGVITPMMNSIIYSLRNKEVKNAVEKFLIKNLYLKKI*
188 >lcl|XP_001367418.2|Plus1complement(2924243..2925178) NW_001582021 olfactory receptor-like protein OLF3-like LOC100013028 __SEG__ Chr8 {Monodelphis domestica} MAHNNQTWMNEFILLGLSNDWKIQIYLFVLFLAMYLVTMLGNFLIIHLIRIDIRLHTPMYFFLSILSFVDICYMNSTVPQMLIHFLSSRKSIPFHSCVVQLYITLALGGT
EFFLLGAMAYDRYVAVCYPLHYTVIMHGGLCIALAAACWTAGFLNSLMETIITFRLPLCKDVINHFACETLAVLRLACVDISFNKVMVAFSGFVVLMLPCSLVLFSYAQI
VKAILRIRSAQGRRKAFGTCASHLTVVSLCFGASIFTYMKPQSNSSAENEKMLALFYTTVAPMLNPMIYSLRNKEVMGALRRALGRFSEET*
189 >lcl|XP_001367463.2|Plus1complement(245823..246761) NW_001581980 olfactory receptor 13C4-like LOC100013070 __SEG__ Chr6 {Monodelphis domestica} MEKQNKTSVTIFFLHGLDGYPVFYFIFFLLCLIMYIVILLGNSFLITVSILDSHLHTPMYFFLSNLSFLDICYTSASIPMLLVNFLSEEKSISFIGCGIQMFFSFAMGAT
ECVLLAIMAYDRYLAICKPLRYPIIMNKGLGVTLVTSCWMAGGLTSVIQTTLTMKLSFCGNIIDYLTCEILAVLKLSCDDISLNVTVMMISNIFIIVIPVAFIFISYFFI
LITILRINSVEGRKKSFSTCSSHLTVVIMFYGTILFMYMKPESKDSHATDEMIALFYAVVIPMLNPIIYSLRNKDVKAAVKKLSKNIFSQRT*
190 >lcl|XP_001367498.1|Plus111356713..11358668 NW_001581957 kelch-like protein 34-like LOC100013107 __SEG__ Chr4 {Monodelphis domestica} MSYFLSYCKAHGGAILTHYQLLRDEGFLCDVKLEAEGSEFLAHRSLLACSSDYFKALFKSYTQESQAPVIRLQVPSATGLQRLLDFIYTAWLPLSMDTLEDTLEAASYLQ
VSEAVGLCSRYLVRHLGLENCCFAANLASRFGLADALPEAESFIGRHMRELLDRGLEAAGLLELNSGSLRAVLGSSDVPFVAEVRLLNLALSWLQREPAAERLPQCCSLL
ERIRFGLVPPEVLRRVYSGSGLNLPARVKGLIIQALSYHTATSRQPLMQSEQTSCRSPKTRILLVGGRRAREAATQSTEDAQIAQQEDAGGVGGVVEEQAEEEVRPEEAD
DWKLTQDVVSFDVYNHRWRSLTRLPAPLQGHCVCTIGSFLYVLGGETPAGSSSSLFPTVPLEVTAQVHRYDSHFHRWASIPTMKEARAHFWCGAVGDSLLAVGGVGADGA
ALASVEIYDLGRDRWTAARELPQPVYGHAGAVGTCGTVYISGGKLGGRPVDGSLGRGGSIRDVYALSPREKVWSKRAPMSIARFGHHMATLRGAVFAFLGRYELFSEIER
YDPGADQWTRLRPLLYDRFCYGLAVVEETALLLGGLKWQDSRQVPTRNVVGYDLDLDCWEDIGCDMPQAWNGLKCAVLQLAEEEEESVEKTKKVETQAEVH*
191 >lcl|XP_001367501.2|Plus1complement(1219480..1220871) NW_001581972 muscarinic acetylcholine receptor M1-like LOC100013112 __SEG__ Chr5 {Monodelphis domestica} MNVSAAPAVSPNITVLEPVKGPWQVAFIILTTGLLSLATVTGNLLVLVSFKVNSELKTVNNYFLLSLACADLIIGVVSMNLYTTYLVMGHWALGSLACDLWLALDYVASN
ASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVKAGQCYIQFLSEPIITFGTAMAAFYLPVTVMCVLYWRIYRETENRAR
ELAALQGSETPGKGLGGGSSSSSERSQPGPEGSPDAPARRCCCCWGPRLLPSYSWKEEEEEEEDEGYLESLTSSEGEEAGFEVVIKMPMVGPEAPPPAKPPPRASPQTVK
RPTKKARERPGKEPKRKGKEQLSKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCSHCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRW
DKRRWRKIPKRPGSVHRTPSRQC*
192 >lcl|XP_001367504.2|Plus1complement(340046..340984) NW_001581980 olfactory receptor 13C4-like LOC100013115 __SEG__ Chr6 {Monodelphis domestica} MERQNKTSVTIFLLHGLDGYPVFYFIFFLLRLIMYIVILLGNSFLITVSILDSHLHTPMYFFLSNLSFLDICYTSASIPMLLVNFLSEEKSISFIGCGIQMFFSFAMGST
ECVLLAIMAYDRYLAICKPLRYPIIMNKGLGVTLVTSCWMAGGLTSVIQTTLTMKLSFCGNIIDYLTCEILAVLKLSCDDISLNVTVMMISNIFIIVIPVAFVFISYFFI
LITILRISSVEGRKKSFSTCSSHLTVVIMFYGTIFFMYMKPESKDSHATDEMIALFYAVVIPMLNPIIYSLRNKDVKAAVKKLSKNIFSQST*
193 >lcl|XP_001367510.2|Plus1complement(2981551..2982486) NW_001582021 olfactory receptor-like protein OLF3-like LOC100013123 __SEG__ Chr8 {Monodelphis domestica} MAKYNQTWVNEFILLGLSNDQKTQLYLFVLFLVMYLVTMLGNFLIIHLIRLDTRLHTPMYFFLSVLSIVDICYMNSTVPQMLIHFLSSRKSIPFCSCVFQFYISLGLAGT
EFFLLGAMAYDRYVAVCYPLHYTVIMHGGLCIALAAACWTAGFLNSLMETIITFRLPLCKNTINHFVCETLAVVRLACVDISFNKIMVTFSVFVVLMLPCSLVLFSYAQI
VKAILRIRSAQGRRKAFGTCASHLTVVSLCFGATIFTYMWPRATSTVELEKMISIFYTVVAPMLNPLIYSLRNKEVMNAMKKALGRFSEEK*
194 >lcl|XP_001367549.2|Plus1complement(360392..361345) NW_001581980 olfactory receptor 13C2-like LOC100013147 __SEG__ Chr6 {Monodelphis domestica} MEKINETSVTEFFLKGLSGYPRLEIIFFVLILVMYVVILLGNGILILISILDPHLHTPMYFFLSNLSFLDICYTSTSIPPTLVSFLSQRKTISFSGCTVQMFLGLAMGTT
ECVLLAMMAFDRYVAICNPLRYPIIMSKIVYVQMAAGSWAAGGVNSLVQTILVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMLVATTVFTLTPLLLIVVSYTL
IISSILKIHSAEGRSKAFSTCSAHLTVVIIFYGTILFMYMKPKSKPSLNSDKLQTTDKLISMFYGVMTPMMNPLIYSLRNKDVKEAVKLLGRKIFSK*
195 >lcl|XP_001367664.1|Plus1complement(40288413..40289834) NW_001582020 ras GTPase-activating protein-binding protein 1-like isoform 1 LOC100017041 __SEG__ Chr8 {Monodelphis domestica} MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQAFRRFMQ
TFVLAPEGSVANKFYVHNDIFRYQDEVFGGFITEPQEESEEEVEEPEERQQTPEVVPDDSGAFYDQTVSNDLEEHLEEPVVEPEPEPEPEPEQEAETESHEEKSEPALEE
PVSEETQKSSSSPVPVDTAPAVQEDLRTFSWASVTSKNLPPSGAVPVSGIPPHVVKVTASQARPESKPESQTPPQRPQRDQRVREQRTNIPPQRGPRPICEGGEQGDMDT
RRIVRYPDSHQLFVGNLPHDVDKAELKDFFQSFCVSFKGYGNVVELRINSGGKLPNFGFVVFDDPEPVQKILGSRPIMFRGEVHLNVEEKKTRAAREGDRRDNRPRGPGG
PRSGLGGGIRGSPRGGMSQKPGFGAGRGIGQCQ*
196 >lcl|XP_001367718.2|Plus12983983..2984921 NW_001581905 olfactory receptor 7C1-like LOC100013318 __SEG__ Chr3 {Monodelphis domestica} MAPENQTKFIEFILLGFSETPEQQRAIFGLFLGMYLVTVFGNILIMLAVGSDSHLHTPMYFFLSNLSFVDLCVVSTTVPKMLVSILTQNKAISYAGCLAQMYLFIVFAGL
DNFLLTAMAYDRFVAICHPLRYTSIMSPELCCLLVLLSWILSLLDALLHSLMVTRLSFCTGHEIQHFFCDLDQVLKLSCSDTLINYVLIYILAGLLGILPLTGILFSYSQ
IFSSILKVPSAGGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSSVTQSSWKSTVASAMYAVVTPMLNPFIYCLRNKDIKGALWRLISRIFSTQ*
197 >lcl|XP_001367724.2|Plus1491635..492576 NW_001581980 olfactory receptor 13D1-like LOC100013324 __SEG__ Chr6 {Monodelphis domestica} MDKGNFTPVTEFFLIGLSHYPGLQIFLYVICLVMYLVILFGNSFLIIISILDPRLHTPMYFFLRNLSFLDICYTSSSVPQVLIIIISERKSISFTRCALQMILSLGLGCT
ECILLAVMAFDRYVAICNPLRYTIIMNNGLCVQIAAWTWIIGCLNTLLPSVLALIKPFCGNVIDHLTCEILALLKLICGDISINVLLLTVGSILYLLTPLLLIFFSYVFI
LSTILRINSSEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKDTQIFDEIFGLSYGVITPMLNPIIYSLRNKEVKDAVVKLLFRNLYLKRM*
198 >lcl|XP_001367747.1|Plus140589714..40591120 NW_001582020 muscarinic acetylcholine receptor M2-like LOC100017080 __SEG__ Chr8 {Monodelphis domestica} MNNSTSPNSTNNGMALPSPYKTVEVIFIVLVAGSLSLVTTIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGAFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSN
ASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFVLWAPAILFWQFIVGVRTVKEGECYIQFFSNAAVTFGTAIAAFYLPVIIMSVLYWHISRASKSRIK
KDKKEAVANQDPVSPSLVQGRIVKPNNNNIPSNDDGLEHNKIQNGKATRDAVTENCIQGEEKESSNDSTSVSAMASNIKEDEITREENTISTSQDHSKEENSKLTCIKIV
TKTQKGDYCAPTNTTVEIVGPPGQNGDDKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIVTWTPYNVMVLINTFCATCVPNTVWTIGYWLCYINSTINPA
CYALCNATFKKTFKHLLMCNYKNIGATR*
199 >lcl|XP_001367757.2|Plus1complement(3043093..3044031) NW_001581905 olfactory receptor 867-like LOC100013358 __SEG__ Chr3 {Monodelphis domestica} MAPENQTKFTEFILLGFSETPEQQGAIFGLFLGMYLVTVFGNILIMLAVGFDSHLHTPMYFFLSNLSFVDLSMVSTTVPKMLVGILTQNKAISYAGCLAQMYFFTVFIGL
DNFLLTAMAYDRFVAICHPLRYTSIMSPELCCLLVLLSWILSLLVALLHSLMVTRLSFCRGHKIQHFICDLDQVLKLSCSDTLINYVLIYIVAGLLGILPLTGILFSYSQ
IFSSILKIPSTGGKYKAFSTCGSHLSVVSLFYSTGLGVYLSSSVTHSSWKSAVASAMYAVATPMLNPFIYCLRNKDIKGALWRLISRISSSQ*
200 >lcl|XP_001367764.2|Plus1534449..535390 NW_001581980 olfactory receptor 13D1-like LOC100013367 __SEG__ Chr6 {Monodelphis domestica} MDKGNYTAVTEFFLVGLSHYPGLQISLYVLCLLMYLVILLGNSILIIISILDSHLHTPMYFFLGNLSFLDICYTSSFIPKILINFTSERKSISFLGCTLQMVISLGLGST
ECILLAVMAYDRYVAICNPLRYTIIMNKRLCAQMAAWTWVAGFLIALIQTVLAMIKPFCGNIIDHITCEILALLKLICVDISLNVFIMTVGSIVLLITPLMLIFFSYIFI
LATILRINSSEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKDTKTSDEIIVLSYGVVTPMLNPIIYSLRNKEVKGAVKKVLFRTLFLQKT*
201 >lcl|XP_001367766.1|Plus111479561..11481027 NW_001582018 c3a anaphylatoxin chemotactic receptor-like LOC100013370 __SEG__ Chr8 {Monodelphis domestica} MPPTLTNTSSSDLISQPWGEPPVVISIALFSLTFLLGLPGNGLVFWVTGLKMKRTVNTVWFLHLTVADLLCCLSMPFSITHLVLQGYWPYGWFLCKLIPSIIILNMSASV
FLLTAISLDRCIVVLHPIWCQKHRTVRMAFAFCVGIWVLAFAMCMPVFLYRETFTEDNYTVCDYNFEMYSSPDISFNPSLEIEDSPEDFSELTGTMEDIFDLSSSRRDAY
PWPSTTTGTPKTSNVFFYSKITGGHSGSASYHPFSDLSELPGKLPHTESPTIPIALPEFNNNDSITDTLGNSDVLLHDNTKALLKASDNPLDLPEMTDSFLDIYGIYFNE
TQSLTPLVAITITRFLVGFLLPLIIMAVCYTLIIFRLSRGPFAKSRGKTLRVALVVVVTFFVCWTPYHIIGFLSLFASPYSPLEKVVMAWDHLSIALASVNSCLNPLLYA
FMGKDFRKKVQQSMQGILEAALNEDLNPSSSYPQSKTSLTKDILSTAV*
202 >lcl|XP_001367824.1|Plus1complement(46962207..46963286) NW_001581963 protein mab-21-like 1-like LOC100020950 __SEG__ Chr4 {Monodelphis domestica} MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAG
KQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALENAAKQTWRLAREILTNPKSLEKL*
203 >lcl|XP_001367828.1|Plus145133756..45134079 NW_001581978 28S ribosomal protein S33, mitochondrial-like LOC100019980 __SEG__ Chr6 {Monodelphis domestica} MSSLSEYAIQMALPSARIFGEVAIPTNSKSIKEVKLFSEQPLATRKETYDWYPPHNTYFALMRKLRRFGLYRDKHQDFKEEQRRLKKLHGKGKPKKKREGKRSAAKK*
204 >lcl|XP_001367840.2|Plus1complement(357553..358482) NW_001581947 olfactory receptor 13H1-like LOC100013449 __SEG__ Chr4 {Monodelphis domestica} MDRRNNTAVTYFILVGLSEYPRAQMLLFCLLLASYLVILLGNSLILVLVQFDSRLHTPMYFFLSNLSFLDICFTSSSIPQMIINCLVRMPVISAGQCMAQMCTLLYLGVV
ECLLLAVMAYDRCIAISDPLRYPVRMSNQFCVQLAGLSWVSAFLFSIVPTVATPLELCSHVINHFFCEVLAIMKLACSDLQLNELLMMATSSLTLLAPFVFILASYGRIL
GAVLKMRSTEGRKKAFSTCSSHLTVVVLFYGTAIAMYMMPQDKTSREQDKLASLLYGVVTPMLNPLIYSLRNKDVKEALRKLLGEKKVP*
205 >lcl|XP_001367888.2|Plus1608977..609918 NW_001581980 olfactory receptor 13C8-like LOC100013504 __SEG__ Chr6 {Monodelphis domestica} MEHQNQTLMTIFFLHGLAAHPIFHFVFFLLSLVMYIIILLGNSFLITIIILDSHLHTPMYFFLSNLSFLDICYTSSSVPLILANFLSDEKSISFVACGAQMFFSLALGST
ECVLLTVMSYDRYVAICRPLRYPIIMNKGLCGWMAASSWMTGVLNSLVQTILAMGLPFCGNNVIDYLTCEILAVLKLACTDISLNVIIMVISNVILLVIPVLLIIISYLF
ILFTILRINSTEGRKKAFSTCSAHLTVVTMFYGTILFMYMKPKSKDSHATDELIALFYAVVIPMLNPIIYSLRNKDVKAAVKKLSKNVFSQKT*
206 >lcl|XP_001367905.2|Plus1complement(64790402..64791340) NW_001581970 olfactory receptor 1030-like isoform 3 LOC100021845 __SEG__ Chr5 {Monodelphis domestica} MARGNRTTVTEFVLMGFTDRPELQVPLFVVFLAIYLITLIGNLGMILLIKLDSRLHVPMYYFLSHLAFIDLCYSSSIGPKMLQNLIVKKKTISFSGCFAQLYFSSAFATT
ECFLLATMAYDRYMAICNPLIYTAIMTKRVCSELVIGVYTYGFLNSVIQTILTFQLSFCDSNIIHHFYCADPPLLALSCSDTHSKEKQLLIFSALNLTSSLLTVLVSYIC
ILVSILKIRSSEGKCKAFSTCASHLTVVIIFYGTLFFMYLWQPKAGNSWKYNKVVSVFYSLVIPMLNPLIYSLRNTEVKDTLRKILEGKRSQ*
207 >lcl|XP_001367926.2|Plus1645416..646357 NW_001581980 olfactory receptor 13D1-like LOC100013544 __SEG__ Chr6 {Monodelphis domestica} MEKGNYTPVTEFLMMGLSNYPELQIFFYVLCLLMYLVILLGNGTLIIISILDPRLHTPMYFFLGNLSFLDICYTSSSIPQMLVNFTSERKSITFIGCALQMVLSLGLAST
ECLLLAVMGFDRYVAICNPLRYTIIMNKGLCVQMAAWTWILGFLIASVQSVLALRLPFCDNIIDHLFCEIVALLKLICVDISLNIFVMIIASIILLITPLLLISFSYVFI
LLTILKINSTEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKETKLFDEIFGLSYWVITPMLNPIIYSLRNKEVKGAVEKVIIRKLHLRRI*
208 >lcl|XP_001367960.2|Plus1complement(368260..369192) NW_001581947 olfactory receptor 13H1-like LOC100013576 __SEG__ Chr4 {Monodelphis domestica} MDGRNNTVVTYFILIGLSEYPRAQVVLFFLLLVSYLVTLLGNVLILFLIHYDSRLHTPMYFFLSNLSFLDICYTSASVPQMIINCLVTIPIISLGQCLAQMCASLYLGVV
ECLLLAVMAYDRCIAIGDPLRYSVRMGPQLCVQLSVGSWVSAFLLTVIPTLTTPLEFCGHHIINHFSCELLAVIKLACNDLRYNEYFMMASSFLTLLLPFAFILASYGRI
LRAVLKMHSTKGRKKAFSTCSSHLTVVVIFYGTAISMYMMPQDKASRDRDKIISMLYGVVTPMLNPLIYSLRNKDVKGALQKLCGEKTTT*
209 >lcl|XP_001367965.2|Plus1668459..669400 NW_001581980 olfactory receptor 13D1-like LOC100013581 __SEG__ Chr6 {Monodelphis domestica} MEKGNYTPVTEFFMMGLSNYPELQVFLYVLCLLMYLVILLGNGTLLIITILDPRLHTPMYFFLGNLSFLDICYTSSSIPQMLVNFTSERKSITFIRCALQMIFALGLGCT
ECLLLAVMGFDRFVAICHPLRYTIIMNKGLCVQMAAWTWTLGFLVALVQSGLALILPFCDNIIDHLFCEIVALLKLSCVDISFNIFVMRIAGIFVLIAPLLLIFFSYVFI
LFSILKIKSTEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKGTKLFDELFGLSYWAFTPMLNPIIYSLRNKEVKGAVEKVIIRKLFLKKF*
210 >lcl|XP_001367987.1|Plus13220836..3221918 NW_001581837 neuropeptide Y receptor type 6-like LOC100013602 __SEG__ Chr1 {Monodelphis domestica} MAPNQTTVKTNNSMFLYFESCPLPSLALLILVIAYIIVIIVGLFGNLSLIIIIIIKKQRKAKNVTNLLIANLSLSDILMCVMCIPFTVIYTLMDYWIFGDIMCKLTSYAQ
SVSITVSIFSLVLIAVERYQLIVNPRGWKPNISHAYWGIMIIWLFSLLLSVPFLLSYHLTNEPFLNLSLPHDLYTDQKACMEDWPSKGHQLLFTTSMLMLQYFLPLGFIF
VCYVRILICLYRRNGKVERSRESESKRINIVLISIIVTFGACWLPLNIFNAIFDWYHEALMICHHDLVFVVCHLVAMTSTCVNPLFYGFLNKNFQKDLIVLICHCRCFAP
QRKYENIAISTMHTDESKGFLKLAPTPAAN*
211 >lcl|XP_001368031.2|Plus1738255..739205 NW_001581980 olfactory receptor 13C3-like LOC100013658 __SEG__ Chr6 {Monodelphis domestica} MARQNQTLVTMFFLHGLAAYPNFHFIFFLLCLIMYIVILLGNSFLITISILDSHLHTPMYFFLSNLSFLDICYTSASVPLLLVNFISGQKNISFVGCGVQMFFSLGLGST
ECVLLTVMAYDRYVAICRPLRYPVIMNKGLCGWMAASSWMTGGLNSLIQTILAMRLPFCGNNVIDYLTCEILAVWKLACTDIFLNKIIMLISNVFFLVIPVVLIFISYSF
ILFTILRINSATGRQKAFSTCSAHLTVVIIFYGSILFMYMKPKSKDSHGTDELIALFYAVVIPMLNPIIYSLRNKDVKEAVKRLSKNIFLQETSIC*
212 >lcl|XP_001368062.2|Plus1complement(1911576..1912511) NW_001581911 olfactory receptor 1F1-like LOC100013689 __SEG__ Chr3 {Monodelphis domestica} MRNQTSVLEFLLLGLSEHPEEQQFFFRLFLGIYLIGTLGNLLTILAIGFDSHLYTPMYFFLSNLSFLDLCFTTTTVPKMLVNYLSGSNAISYSECLAQMYFINAFGASDS
ILLSAMAYDRYLAVCHPLHYGTIMTSRLCALLVAVPWISAHLISMVHTIFIGHLSFCMNNKIPHFFCDINTLIRLSCSDTHINEMLVLFLGGPVVLIPFICIVVSYTPIV
SAVWKVPSVQGKWKAFSTCGSHLSVVTLFYGTVIGVYFNPTSTHTTQKDMIATVMYTVVTPTLNPFIYSLRNNDLKGALGKLLGLKHFSKR*
213 >lcl|XP_001368065.2|Plus1760709..761671 NW_001581980 olfactory receptor 13C2-like LOC100013696 __SEG__ Chr6 {Monodelphis domestica} MEKTNETSVTEFFLKGLSGYPRLEIIFFVLILVMYVVILLGNGILIVISILDPHLHTPMYFFLSNLSFLDICYTSTSIPSALVSFLSERKTISFSGCAVQMFLGLAMGTT
ECVLLGMMAFDRYVAICKPLRYPTIMSKAAYVPMAAGSWVVGGVNSLVQTVLVVRLPFCRNNVINHFTCEILAVMKLACADISGNEFTMLVATTLFILTPLLLIFVSYTL
IIFSILKIHSAEGRSKAFSTCSAHLTVVIIFYGTILFMYMKPKSKESLNSDKLQATDKLISMFYGVMTPMMNPLIYSLRNKDVKQSVKHLLGRKFFSKQM*
214 >lcl|XP_001368095.2|Plus1complement(1948542..1949486) NW_001581911 olfactory receptor 10H1-like LOC100013726 __SEG__ Chr3 {Monodelphis domestica} MLGPNQTTVSEFILIGFSPFPQLQLLFFVLFLLMYLFTLLGNLLIMLTVWHERNLHKPMYFFLCTLSISEIAYTLAINPRMLADLISTHHTISLWGCANQMFFTFSCGLA
HAFLLTIMGYDRYVAICHPLRYGVLMSSQGCAWLVASSWLSGIVMGLVITLPIFSLTFCGPNEIHHFFCQVPPLVKLACGDVSAVALGIGVVYIIVLLVCFLLILLSYIF
IVATILKIPSAEGRHKAFSTCASHLIVVVIHYSFASVAHLKAKALEALEGDTLMGISYSVLTPFLSPIIFSLRNKELKDALKKVFLRNLCPSRL*
215 >lcl|XP_001368097.2|Plus1complement(379440..380372) NW_001581947 olfactory receptor 13H1-like LOC100013728 __SEG__ Chr4 {Monodelphis domestica} MDGRNDTAVTYFILLGLSEYPRAQAIFFCLLLVSYLTTVLGNSLILFLIHYDSRLHTPMYFFLSNLSFLDICYTSSSLPQVLVNCLVRIPAISLGQCLAQMCAGLYLGVV
ECLLLAVMAYDRCVAIGDPLRYPVRMSAQLCAQLAVASWVSAFLLTVIPTLTTPLEFCGHHIINHFSCELLAVLKLACNDLRLNELFMMASSSLTLLAPFAFILASYGRI
LRAVLKMRSAEGRKKAFSTCSSHLTVVILSYGTAISMYMMPQDKASRDRDKIISILYGVLPPMLNPLIYSLRNKDVKGALKKLMGKKDVS*
216 >lcl|XP_001368113.1|Plus132265058..32266641 NW_001581871 neuroepithelial cell-transforming gene 1 protein-like LOC100019004 __SEG__ Chr2 {Monodelphis domestica} MVAHDEIGSFLPIKRTIRVLDVNNQSFREQEEPSNKRVRSLARVSSLANLISPVRNGAVKRFGQTIQKSFNRATVPTPSKRRNSVRWSEMLDINMKESLTTKEIKRQEAI
YEMLQGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARLGEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDARVQDF
LQRCLESPFSRKLDLWSFLDIPRSHLVKYPLLLKEILRHTPKDHTDIKPLEEALLVIQGVLSDINLKKGESECQYYIDKLEYLDDKQKDPRIEASKVLLCHGELKNKNGH
KLYIFLFQDILVLTRPVIRNERHSYQVYRQPIPVKELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFRDPSPGQSHTLQANDVFHKQQWFNCIRTAIAPFHQTTSP
TEFKGLSELNKGSEKNNPLASHIKSQRKSSTLSGLIPLEVDENSPECIPSIAINENSTDIKAHRIQPGSPKAQEKAQLNDKRKETLV*
217 >lcl|XP_001368220.2|Plus1complement(5884083..>5886671) NW_001587047 SLIT and NTRK-like protein 4-like LOC100013865 __SEG__ ChrX {Monodelphis domestica} CFLFFFLDSLSLFRSIKLFAECKKMLLWLFLVLSTPISASTNAESDPSVEICNVCSCVSVENVLYVNCEKVSVFRPNQLKPPWSNFYHLNFQNNLLIVLYPNTFLNFSHA
VSLQLGNNKLQNIEGGAFLGLSALKQLHLNNNELKVLRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPY
IGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCSMGTGSDFDVRVLPPSQLENGYTTPNGHTTQTSLQRLVTKPPK
TTNPSKISSIVAGKALSNRNLSQIVSYQTRVPPLTPCPIPCFCKTHPSDLGLSVNCQEKNIQSMAELMPKPLNAKKLHVNGNQIKDVDTSDFTEFEGLDLLHLGSNQITA
IKGEVFRNLTNLRRLYLNGNQLERLYPEMFAGLYNLQYLYLEYNWIIEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFAGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQ
IDLEGNPWDCTCDLVALKLWLEKLKDDIVMKELKCETPVQFASIELKSLKNEILCPKLLNKPSSPFTSPIPAITLTTPMGPIRSPPGGPVPLSILILSILVVLILTVFVA
FCLLVFVLRRNKKPIVKHEGLGNPECSSMQLQLRKHEHKTNKKDGLAAEAFIPQTIEQMSKSHTCGLKESEASFMFSEPPGQKVILRNAPEKDKDLVHVDTRKRLSTIDE
LDELFPGRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQQDKKNKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI*
218 >lcl|XP_001368227.1|Plus11173341..1174282 NW_001581878 olfactory receptor 10C1-like isoform 1 LOC100021817 __SEG__ Chr2 {Monodelphis domestica} MPANTSGVVTDFILVGFSRLVGFQGLLFTLFLTIYLLTVVGNLLIVTLVSVDAKLQSPMYFFLRLLSALEIGYTSVTVPLVLHHLRTGQRRIPRVGCAVQMFFFLFFGAT
ECCFLAAMAYDRYAAICTPLRYPILLNRRVCLQLAAGAWTSGALVGLGHTSFIFSLNFCGPNAIPHFFCEIQPVLQLVCGDTYLNELQIILAAALIILCPFGLILVSYAK
ILATIIRIPSATGRRKAFSTCSSHLVVVSLFYSTAIFIYIRPKDSYDSATDPLLSLFYSVVTPILNPVIYSLRNADVKAALKRTLQKMSSKEI*
219 >lcl|XP_001368287.2|Plus12132052..2132993 NW_001581911 olfactory receptor 1F1-like LOC100013934 __SEG__ Chr3 {Monodelphis domestica} MVAGNQSEISEFILLGLSDQPEQQSLLFFLFLLIYMITGVGNLLIIVVIRTNSCFHTPMYFFLSNLSLVDICFTTTTIPKMLVNHISGNKAISYAGCLTQVFFFIWFAGI
DSVLLTVMAYDRYVAICAPLHYSMIMTPKVCLLLVVVSWFWAYITALIHTVLVTRLSFCGQNEIPHFFCDLSPLLKLACSDTFINDLMVNTVGALIIIIPFIGILISYTR
IFVTVMRIPSTVGKWRAFSTCGSHLTVVCLFYGTVIGVYFSPISNHTAQQDTVAAVMYTVVTPMLNPFIYSLRNKDIKRALKMLLTGKPVLSL*
220 >lcl|XP_001368289.2|Plus1complement(462335..463267) NW_001581947 olfactory receptor 13H1-like LOC100013937 __SEG__ Chr4 {Monodelphis domestica} MDRRNGTDVTYFILIGLSEYPRAQLIFFCILLVAYIVTLLGNSLILLLIHYDPQLHTPMYFFLSNLSFLDICYTSSTVPQMLINCLVRTPIISLTECLAQMCVLLYLGVV
ECLFLAIMAYDRFVAISNPLHYAVKMGPQLCLQLAVVPWFVSFIIAVVPILTMPLDFCGHYIINHFSCELLAIIKLACNDLKFFELLIMATCSLTLLLPFTFILVSYGHI
LVAVLKMRSADGRKKAFSTCSSHLTVVVIFYGTAISMYMMPQDKVSRDKDKIISMMYCIVTPMLNPIIYSLRNKDVKGALRKLIGKKSDS*
221 >lcl|XP_001368318.1|Plus1complement(3468216..3469220) NW_001581837 probable G-protein coupled receptor 132-like LOC100013967 __SEG__ Chr1 {Monodelphis domestica} MASSNFSENICNVSYEESKLFLSVMYSSVCALGIPTNCFTAWLSLLQVLQGNVLAVYLFCLAICELLYVTTLPFWIIYIRNDHKWTMGFQTCKIIAYAFFCNIYVSILFL
CCISCDRFIAVTYALESRRYRSLKTARSISIAIFFIVGLVHYPVFKIEEDQTCFETLPVNKEIAGYYYSRFVVGFAIPLSIIIFTNYKVFRSIKMSPSLNASQKAKVKYL
ALSIVIIFLVCFAPYHVVLLVKAIAFSFYKGEKKKMCAFEAKMYTTSVIFLCLSTFHSIADPFIYVLASENCRKELYRIQKGWKRRSTKTDSTNRKHSKSMEELTPKPEN
SSAF*
222 >lcl|XP_001368323.2|Plus12169549..2170490 NW_001581911 olfactory receptor 1F1-like LOC100013975 __SEG__ Chr3 {Monodelphis domestica} MVAGNQSEVSEFILLGLSNQPEQQSFLFFLFLLIYMITGVGNLLIIVVIRTNSCFHTPMYFFLSNLSLVDICFTTTTIPKMLVNHISGNKTISYAGCLTQVFFFIWFAGI
DSVLLTVMAYDRYVAICAPLHYSMVMTPKVCLLLVVVSWFWSYINALIHTVLVTRLSFCGQNEIPHFFCDLSPLLKLACSDTFINDLMVNTVGALTIIIPFIGILISYTR
IFVTVMRIPSTVGKWRAFSTCGSHLTVVCLFYGTVIGVYFSPISNHTDQQDTIAAVMYTVVTPMLNPFIYSLRNKDMKGTLKMLLTRKPVRSL*
223 >lcl|XP_001368326.2|Plus1complement(476526..477458) NW_001581947 olfactory receptor 13H1-like LOC100013978 __SEG__ Chr4 {Monodelphis domestica} MDGGNETDVTYFILVGFSEHPKAQVIFFCFLLMSYLIILIGNSLILFLIHYDSRLHTPMYFFLSNLSFLDICYTSSSVPQILINCLVKIPSISLGQCLAQMCAGLYLGVA
ECLLLAVMAYDRCIAIGDPLRYSVRMSFQLCIKLAVASWVTAFLLTVVPTLTMPLEFCGHHMINLFSCELLAILKRACNDLKFYEWLMMATSSLTLLAPFTFILSSYGRI
LGAVLKMHSAEGRKKAFSTCSSHITVVVIFYGTAISAYMIPQGKASQDQDKIISMLYGILPPMLNPLIYSLRNKDVKEALKKLMGEKNVS*
224 >lcl|XP_001368361.2|Plus13075398..3075745 NW_001581875 hypothetical protein LOC100014006 LOC100014006 __SEG__ Chr2 {Monodelphis domestica} MGCCPTDCFNCCGCQQEQSGECCEMCCCQPSCCGCCGSSCCGSSCCGSGCGGSGCGGCGGGCGSCGGCGGGCGGCGGCGGGCGGSCCGCGGCGSGCCGCCCGPVCCQPTP
VCDTK*
225 >lcl|XP_001368365.2|Plus12184743..2185684 NW_001581911 olfactory receptor 1F1-like LOC100014013 __SEG__ Chr3 {Monodelphis domestica} MEGGNQSGVSEFILLGLSDQPEKQRLLFFLFLVMYLITGLGNLLIILAISTNSRLHTPMYFFLSNLSLVDICFTSTTIPKMLTNHVSGKKAIPYVECITQLFFFVLFGEI
DSVLLTVMAYDRYVAICAPLQYTMLMTPKICALLVAMSWFWAYINALTQTVLLTRLSFCGHNEIPHFFCDISSVLKLACSDTFINDVVLLAVGGLTVIIPFIGILISYTR
IFVTVMRIPSASGKWKAFSTCGSHLTVVCLFYGTIIGVYFSPTSTHTAQQDTTAAIMYTVVTSMLNPFIYSLRNKDMKGALRVLFTRKPGLSL*
226 >lcl|XP_001368399.2|Plus11235913..1236911 NW_001581881 olfactory receptor 5V1-like LOC100014061 __SEG__ Chr2 {Monodelphis domestica} MKDIKEKGNQTLVTEFIFLGFSNHPKLQGLFFMIFLLVYLVTLLGNLLILTAIRINPALHTPMYYFLINLSFLDICYTSTTVPIMLVNFFREKKTITYEGCLSQLFFLVT
FAGSECVLLAAMAYDRFIAICHPLRYPVLMSKKVCSYLAAGSWLCGLVNSMTHTGLTATVTLCGPNQISHFLCDIPLILKLSCSDTSVNEFTLYVASATIGLSPCLFTAV
SYMLIISAILKIQSTQGRHKAFSTCASHLTVVVIFYGTANFNYDRPSSGYSLDMDILVSVLFCIVTPMLNPIIYSLRNKEVTVALKKLCELYILPGLVGGPMDRVRGQES
SS*
227 >lcl|XP_001368401.2|Plus12202501..2203442 NW_001581911 olfactory receptor 24-like LOC100014063 __SEG__ Chr3 {Monodelphis domestica} MEGGNWSEVSEFILLGLSYDPEQEKLLFFMFLVMYLITVLWNLLIILAIKSDSRLHTPMYFFLSNLSLVDMCFTSTTVPQMLLSHISGNKAIPYFACLTQTFFFSWFAGV
DSILLASMAYDRYVAICAPLHYSMIMTPRTCALLVSVSWFWPCINALIHTISAAQLSFCGHTEIPHFFCDLNALIKLACSDIFINGLMVYTVGTLTTIIPFIGILISYIH
IFWAVVRIPSARGKQKAFSTCGSHLTVVSLFYGTLIGVYFSPKSTHTAQQDTASAVMYTVVTPMLNPFIYSLRNNDMKGGLKVLLTRTPELSL*
228 >lcl|XP_001368403.2|Plus1complement(502436..503371) NW_001581947 olfactory receptor 5-like LOC100014066 __SEG__ Chr4 {Monodelphis domestica} MTRVQEFILLGLSPRPGLRGVLFAVFLTLYLLTLLENTIIILLIRSHTELHKPMYFFLGNLSCLEMCYVSVTMPTLLLGLWSGSCHVPFTSCMTQLFFFITLICAECTLL
ASMAYDRYVAICRPLHYPVLMRPQVCLLLAAASWMGSLSVSVIKTACIAGLSYCGPNVLNHFFCDVSPLLNLSCTHVALTELVDFISAIVILWGSLLVALASYIAIGASV
IRMPSAAARLKAFSTCASHLIVVGIFYSATIFIYARPSRIEAMDLNKVLSVIYTVLTPMCNPIIYCLRNKEVQGALRKTLHKVGFSQNSDS*
229 >lcl|XP_001368434.1|Plus13100248..3100655 NW_001581875 regulator of G-protein signaling 4-like LOC100014101 __SEG__ Chr2 {Monodelphis domestica} MGLRDGKQAWFTEVIDFWVSCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTPEETSWNMLEPTITCFDEAQKKIFNLMEKDSYRCFLKFQFYLDLVNQADTS
CCGSENQKGAKAPTLDCPSLVSQCA*
230 >lcl|XP_001368435.2|Plus11250533..1251507 NW_001581881 olfactory receptor 5V1-like LOC100014102 __SEG__ Chr2 {Monodelphis domestica} MKDIKERGNQTLVTEFIFLGFSNHPELRGLFFLIFLLIYLVTLLGNLLILTAIRINPALHTPMYYFLSNLSFLDICYTSTTVPIMLVNFFREKKTIAYEGCLSQLFFLVT
FAGSECVLLAAMAYDRFIAICHPLRYPVLMSKKVCAYLAAGSLLCGLVNSMTHTGLTAILTFCGPNQISHFLCDIPLLLKLSCSDTSVNELALYVASATIGLSPCLFTAV
SYMLIISAILKIQSAQGRHKAFSTCASHLTVVIIYYGTGNFNYDQPSSGYSLDVDILVSVLFCIVTPMLNPLIYSLRNKEVKVALRKLCEGYILSRDSFVQISL*
231 >lcl|XP_001368440.2|Plus12225610..2226551 NW_001581911 olfactory receptor 24-like LOC100014107 __SEG__ Chr3 {Monodelphis domestica} MKRENHSRVSEFILLGLSDQPEQDRLLFLIFLLMYLITGLGNLLIILVIRIDPRLHTPMYFFLSNLSLVDICFTTTTIPKMLVNYISGNKEILYISCLAQVFFFVWFAGL
DSILLASMAYDRYMAICAPLHYTMIMTPRLCVLLVAVCWFGACANALTHTVLLTQLSFCGHKEIPHFFCDLGVVIRLACSDTFINDLVIYTMGGLIAIIPFMGILISYFH
IFVAILKIPSAYGKRKAFSTCGSHLTVVCLFYGTMIGVYFNPTSTHTAQQDITSTVMYTAVTPMLNPFIYSLRNNDMKGALRMLLLRKSGFSL*
232 >lcl|XP_001368443.2|Plus1525935..526918 NW_001581947 olfactory receptor 10A7-like LOC100014110 __SEG__ Chr4 {Monodelphis domestica} MSGPWAQIHPTDPAESLIGSNQSSVVEFVLLGFSHVPRLKLVLFVLFLGMFLITILGNGLIVLLSLVDTALHTPMYFFLRNLALVEICFSLDIVPRMLESLVAGRGISLS
GCALQLFLLLSCVTSECFLLTVMAYDRYVAICHPLHYGVLMSQQLCHLLAGACWVAGIPVSLLFTIWLFRFPFCGPRGVRHFLCDVAPLLRLVCADTSVFEAYIRVATVL
VLMVPFSLITVSYGRVLAAVVRMPSATGRHKALSTCASHFLVVALFYGTACVIHLQPKSTYSPESKQVVSLSYTLVTPMLNPIIYSLRNKEVKAALWRILGRKKGSV*
233 >lcl|XP_001368477.2|Plus12273026..2273967 NW_001581911 olfactory receptor 24-like LOC100014148 __SEG__ Chr3 {Monodelphis domestica} MKRENHSRVSEFILLGLSDQPEQDRLLFLIFLLMYLITGLGNLLIILAIRIDPRLHTPMYFFLSNLSLVDICFTTTTIPKMLVNYISGNKEILYISCVTQAFFFLWFAGL
DSILLGSMAYDRYMAICAPLHYTMIMTPRVYVLLVAVCWFWACANALTHTVLLTQLSFCGHNEIPHFFCDLGVVIRLACSDTFINDLVIYTMGGLTALIPFIGILISYFH
IFVAVLKIPSAYGKRKAFSTCGSHLTVVCLFYGTIIGVYFNPTSTHTAQQDIASTVMYTAVTPMLNPFIYSLRNNDMKGALRMLLLRKPGFSL*
234 >lcl|XP_001368490.1|Plus139859248..39860204 NW_001581861 olfactory receptor 4F21-like LOC100020915 __SEG__ Chr1 {Monodelphis domestica} MIMTGEMDGENHSVVTEFVMLELSASWEMNILLFLFFFSFYVGIVLGNLFIVFTVTFDNNLHSPMYFLLANLSLTDFGLSTTTVPRMIIDIFSEHKVISFLECMIQMFFI
HVMGGTELVLLIAMAYDRYTAICKPLHYLIIMNRKACIRFAVVAWVIGILHSISQFVFVIDLPFCGPNKLESFYCDFPQVAKLACRDTSRVVFTMTLNNGLVTMGTFFLL
IISYIIILITVRHHSSVGLSKAFSTLSAHISVVFLFFAPCFFVYVWQVPTLSLDKFLLIFIFLITPLLNPAIYTLRNKDMKMAVKRLINKIAGSRELS*
235 >lcl|XP_001368507.2|Plus12304024..2304965 NW_001581911 olfactory receptor 24-like LOC100014181 __SEG__ Chr3 {Monodelphis domestica} MEQKNQSEVSEFILLGLSSKPEQERLLFFLFMLMYLTTVLGNLLIILAIRIDSRLHTPMYFFLSNLSLGDICFTTTTIPKMLVNYISGNKEILYISCLAQAFFFSWFAGL
DSILLGSMAYDRYMAICAPLHYTMIMTPRLCVLLVAVCWYWACANALTHTVLLTQLSFCGHKEIPHFFCDLGVVIRIACSDTFINDLVIYTMGGLIAIIPFMGILISYFH
IFVAVLKIPSAYGKWKAFSTCGSHLTVVCLFYGTIITVYFNPTSTHTVQQDIASAVMYTAVTPMLNPFIYSLRNNDIKGALKMLLLRKPGFSL*
236 >lcl|XP_001368519.2|Plus141349100..41350032 NW_001581861 olfactory receptor 11H4-like isoform 1 LOC100022595 __SEG__ Chr1 {Monodelphis domestica} MNKSGAHTVIEFVLLGFPGDWEIQILLFSLFLIVYILTLIGNGAIICAVKWDQRLHTPMYILLGNFAFLEIWYITSTVPRMLENFLSETKAISFAGCFLQFYFFTSLAAN
EIYFLCIMAYDRYLAICHPLHYPIKMTLQLCYSLISVCWVLGFLSYSLTTVQLSQLTFCGPNIIDHFVCDIDPLMALSCAPAPTTENLFYIISSLILFLSIIYLLGSYIL
LLRAVLQVPSAAGRRKAFSTCGSHLAVVCLFFGSLMIMYVSPTSENSGEVQKIITLFYSIVTPFLNPLIYSLRNKEMKAALRKFIGISSE*
237 >lcl|XP_001368592.1|Plus189613982..89615061 NW_001581879 G-protein coupled receptor 6-like LOC100022066 __SEG__ Chr2 {Monodelphis domestica} MNVSAISLNDTRSVDATTVAAEGAATAAASDPTRWLPPGSAALGSGTNGSLELSSQLPAGSPGLLLSAINPWDVMLCVSGTVIAGENALVVAIISSTPALRTPMFVLVGS
LATADLLAGCGLILNFVFQYVIPSETVSLLTVGFLVSSFTASVSSLLAITVDRYLSLYNALTYYSERTLLCVHLMLAVTWGVSLCLGLLPVLGWNCLADRASCSVVRPLT
RSHVALLSTSFFVVFAIMLHLYARICKVVCRHAHQIALQQHFLAPPHYVATRKGVSTLAIVLGTFGASWLPFAIYCVVGSHEYPSVYTYATLLPATYNSMINPIIYAYRN
QEIQRSMWLLFCGCFQSKVHFRSRSPSDV*
238 >lcl|XP_001368607.2|Plus12423001..2423942 NW_001581911 olfactory receptor 24-like LOC100014300 __SEG__ Chr3 {Monodelphis domestica} MEGGNQSRISEFILLGLSDQPEEERLLFLAFLFMYLITGLGNLLIILAIRTDSHLHTPMYFFLSNLSLVDICFTSTTIPKMLANHVSGNKMIPYSGCLTQVFFFIWFAGI
DSFLLTAMAYDRYVAICAPLHYSTIMTPRICALLLAVSWFSAYVNALTHTVLLTRLSFCGHNEIPHFFCDLSPLLKLACSDTFINDLMVYTVGALPIITPFIGILISYTQ
IFMAVLRIPSAGGKRKAFSTCGSHLAVVSLFYGTLIGVYFSPTSTHTVQQDTAAAVMYTVVTPMLNPFIYSLRNKDMKQALKMLLTRKPGLTL*
239 >lcl|XP_001368609.2|Plus1602049..602972 NW_001581947 olfactory receptor 9G4-like LOC100014303 __SEG__ Chr4 {Monodelphis domestica} MTNCTTLPGFILQGFSVIPEVQTFSATIFLFIYVFSVLGNISIIIAVNLDSHLHTPMYFFLKHLSLIDMCSTSTTLPRALFAALAGSEVISLPGCAAQLFVFVFCGATEC
FIITIMAYDRCLAIYQPLTYGATMTQQLCCTLVCVAWVCGLLFSSFHTANTFTLSFCDPTVEHFFCDIPPLLRLACTDPQNHETAGFLVSGCVIMSCFALTILSYIRILV
TVAHIRSAQGRQKALSTCSSHLITVVLFYGTGSSAYMRPANGFSPLQGRLAAIFYSILTPTLNPIIYSMRNRDMKAALRKLFCIHGP*
240 >lcl|XP_001368709.1|Plus1complement(4398706..4399689) NW_001581928 p2Y purinoceptor 6-like LOC100014399 __SEG__ Chr4 {Monodelphis domestica} MEPGNETTLGSAGSLPSCVFRENFKHVLLPLVYSVVLILGLPLNSFVIMQIWLSRKALTRTAIYMLNLALADLLYTCSLPLLIYNYAQGDHWPFGDIACRLVRFQFYTNL
HGSILFLACISFQRYLGICHPLSTWHKRWGRGSAWLVCGAVWLAVSAQCLPTIAFAQTGTQRNRTVCYDLSPPSLSASYLPYGMALTFTGFVLPFSAVLACYVRLVRRLC
QQGGPEGPAAAEKRGKAARMVVVVLAAFAISFLPFHVTKTAYLAVRSMPGVSCPVLQAFAAAYKATRPFASANSVLDPILFYFTQKKFRQSPKQILSKLSAKWQRGH*
241 >lcl|XP_001368788.1|Plus140937145..40939553 NW_001581837 protocadherin alpha-8-like LOC100021450 __SEG__ Chr1 {Monodelphis domestica} MVFFWRCILGAQQLLILLLLPIAWEVGSGQVHYSVLEEAKHGTFVGRIAQDLGLEVGELVTKMFRVVSKGRRDYLEVNVQNGILFVNSRIDREELCGRSLVCSIHLEVIV
DKPLQVFHVEVDIKDINDNPPVFPVKEQKLFIPESRLPDSRFPLEGASDPDIGSNALLTYRLSTNDYFILEVKSKNDQSKLVELVLKNPLDREEVPEYHLILTATDGGKP
ELSGTMQMLITVLDVNDNAPTFDRSEYEVKILENAASGTLVIQLNASDADEGINREILYSFNSLAPPAIKDTFRIHPDTGEISIQGYLDFEEVNLYEIRVDATDKGTPSL
VGHCTVLVEVLDANDNIPNVSVTSLSLPVMEDAPSGTVIALISVSDRDSGANGLVTCSLSPPGPFTLVSTFKNYYSIILESSVDRESVPAYELVVTARDGGTPALWATAS
VSVVIGDVNDNAPAFEQSLYTVFVKENNPPGSHIFTVSASDPDAQENALISYSLVERRVGERPLSSYVSVHSESGKVYALQPLDHEELELLHFQVNARDAGFPALGSNVS
LQVFVLDENDNSPVVLAPHSSGVPVTELVSQSVAAGHVVAKIRAVDADSGYNAWLSYELQPELGVGRSPFRVGLYTGEISLTRALEESDGPRQTLLVLVKDHGEPVLSTT
ATVCVSVVESGQKSNIFSGESRISGKSGVGKETALVDVNIYLIIAICSVSSLLVLSVLLYVALRCSAPPQASYGPGKPTLVCSNEMGSWSYSQQRRQICSGEGAGKNDLM
AFSPNLPPCPISGERGQKQEALLDSSGKVGDY*
242 >lcl|XP_001368871.1|Plus1complement(4565321..4566391) NW_001581928 p2Y purinoceptor 2-like LOC100014593 __SEG__ Chr4 {Monodelphis domestica} MESESTLWNQSFNDSLDINPLGYKCKFNEGFKYVLLPVSYGVVCVLGLCLNALALYIFLCRIKTWNSTTTFMFNLAISDTLYVVSLPLLIYYYSHGDDWPFSIALCKVVR
FLFYTNLYGSILFLLCISIHRFLGICYPLQSLRWGQVRYARQVAAVVWIVVIGCQLPVLYFVTTSDRADRVTCHDTSSPDLFDSFVAYSSAILVLLFALPFLIILVCYTL
MVRQLLRPTTGQARLPRSKRKSLRMIALVLVVFALCFLPFHVTRTLYYTFRYLDVGCTSLNAINIAYKVTRPLASANSCLDPVLYFLAGQRFVRFARHSLPPVAGHKMVL
RNPSTLDSEQTGNSPGLSEDSKDARL*
243 >lcl|XP_001368884.1|Plus1complement(42500743..42501645) NW_001581837 protein sprouty homolog 4 Spry4 __SEG__ Chr1 {Monodelphis domestica} MEPPIPHSIPVSPSAVMVQPLLDSRLPYGRLQHPLTILPIDQMKTTHVENDYIDNPGLPPATGAKRTRGGYPEPAPGLSRCDQDVTHPWISFSGRPSSISSSSSTSSDQR
LLDHMAPPPVADQTSPRAVRIQPKAIHCKPLDLKGMPPQELDKHFLLCEACGKCKCKECASPRTLPSCWICNQECLCSAQSLVNYSTCMCLVKGVFYHCTNEDDEGSCAD
HPCSCSHSNCCARWSFMGALSLVLPCLLCYLPATGCVKLAQRGYDRLSRPGCRCKHTNSVICKAATAVDSGKTNRSEKPF*
244 >lcl|XP_001369036.1|Plus1complement(3209164..3210219) NW_001581931 membrane progestin receptor alpha-like LOC100014796 __SEG__ Chr4 {Monodelphis domestica} MATAIAQKLSRFFPSVRQLGQMPRILGELAAPLPDSTVGRAEVPRLFWKPYIYSGYRPLHRTWRFYFLSLFQKHNEAVNVWTHLVAAMVLLLRLAYFAGSVDFVGDPHAR
PLFLIVLASITYLFFSAVAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHARMAAFFLPAAAFLAWLSCAGSCYTKYRQLPGMLGRICQEMPSGLAYA
LDISPVVHRIYVAQVLGQEDPAVLYHKCQVAFFLLAAAFFSACSPERWFPGKCHTFGQGHQLFHVFLVLCTLAQLEAVALDYEARRSIYEGLHRHALHNFSALFLLTVVC
SVLTALFLSHRVRQELRCKED*
245 >lcl|XP_001369334.1|Plus167044507..67045589 NW_001582021 c-C chemokine receptor type 5-like LOC100023438 __SEG__ Chr8 {Monodelphis domestica} MSFSSIGQIKMEEDAITTTFYYDFKVPCQNFDVKQTASLILPPLYSLVFIFGFVGNALVFLILIRCKKLKSMTDIYLLNLAISDLLFIVTLPFWAHYAADQWIFGDALCK
VLTGFYHMGFFGGVFFIILLTMDRYLAIVHAVFALKARTVTFGILTSVITWVVAGFASLPAIIFTKSQKEGIQHTCSPHFPSEQSTLWKNFQTLKMNLLGLVVPLLVMIV
CYSGIIKTLLRCRNEKKKHKAVRLIFVIMVVYFLFWAPYNLALLLNTFQDFFGLDNCESSKRLGRAIQLTETLGMTHCCINPVIYAFVGEKFRRYLSTFFRKYIVRHFCK
RCPFFHGEALDRVSSTYTPSTGEQEVSAGL*
246 >lcl|XP_001369397.2|Plus1complement(11774033..11774965) NW_001581842 olfactory receptor 1E1-like LOC100015283 __SEG__ Chr1 {Monodelphis domestica} MERENQSSISEFLLLGLSSQPEEQQIIFWLFLFVYLVTVIGNLLIILAIGLDARLHSPMYFFLANLSFADICFSSVTIPKMLVNHIIGRNSISYVECMMQMYFFISFGNM
DGFLLMVMAYDRYMAICHPLHYTMVMHPGLCILLVAISWVITNLHALLHTLLMAQLSFCADNTIPHFFCDPYPVRKLSCSDTYISDLVVFTEGGVVLVTPFTCIAISYVF
IFSNVMKIPSTQGIQKALSTCGSHLTVVFLFYGAIMGVYLRPSSTYSGVDTVASVIFTVMTPMFNPFIYSLRNQDMKVALWRLILSKAIL*
247 >lcl|XP_001369528.1|Plus1complement(15042690..15043802) NW_001582018 lysophosphatidic acid receptor 5-like LOC100015472 __SEG__ Chr8 {Monodelphis domestica} MEEMWTNTTNETIRMCPDYRFYHRLHLVGYSLVLAAGLPLNALALWVFLRALHVHSVVSVYMCNLAASDLLFTLSLPLRLSYYALHYWPFPDLLCQAAGAAFQMNMYGSC
IFLALINVDRYVAIVHPLRLRHLRRPMVARLLCLGVWALILVFAVPTAWVHAPSPCQFTNITVNLCFESFSDNLWQGKLLPLVLLAEGLGFMLPLIAMVYSSSRVFWTLA
RPRATRSQRRRKTVRLLLANLVIFLFCFVPYNATLAVYGLLRGKLVDASSNAQSRVREVLVVMVLLASANCVLDPLVYYFSAEGFRNTLRGLGTARWVKSRATSRPPGLA
GHPESGAASAAPEDAPHRELLSPPLSLEKPFNHTIKDSAI*
248 >lcl|XP_001369529.1|Plus168096012..68098153 NW_001581835 zinc finger and BTB domain-containing protein 1 ZBTB1 __SEG__ Chr1 {Monodelphis domestica} MARPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHTTAQLNLSNMKISAECFDLILQFMYLGKIMTAPANFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSNHNNKMIFGVRMYDDTIARNGSDANRWCVEPSSTVNTSQNKEPDEESLQLGSFPEQLFDVCKKSSVSKLSNPKDRVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRAYHRIIDVRDGKDNNTKTDSCEKDSSKPFSAQIDKYRGDTTQTTSDSSSATGNRKSSTIESEIAGEEKSRAAERKRIIIKME
PEDHPKDEFKDFNVIKVSDKDCNESTDNDELEDEPEEPFYRYYIEEEVNMKKNARKLLKPRMSVNTDERNSLENARHPNKDSPVQGDTEGASCELCGQTITEEDLSSHYL
SKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTVNGLGNSEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSLPQKQLYKHSACPFRCPNCGQRFENENLVV
EHMSSCLDQDMFKNAIIEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSSG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
249 >lcl|XP_001369552.2|Plus1complement(4063129..4064082) NW_001581965 protein sprouty homolog 1-like LOC100015506 __SEG__ Chr5 {Monodelphis domestica} MDLPNPRGSGGGSFVVIQQPCPDRESPSSATILSLDQIKAIRGNNEYTEGPSAALKKPGPRLAPRPEKPERTHEIIPLSMSNSAPAPAASEQRPPGHSRAPVLSRSTSTG
SAASSGSNSSVSSEQGLLGRSPPSRPADRAIRAQPKRASSAGGGGGTDDLKGPAKGEPDVAAAQHKFICERCGKCKCGECTAPRALPSCLACDRQCLCSAESMVEYGTCM
CLVKGLFYHCSNDDEGDSCADHPCSCSQAHCCSRYLCMGTLALCLPCLLCYPPAHGCLKLGRGCYDRATRPGCRCKNSNTVYRKLESGPSRGQGKPS*
250 >lcl|XP_001369770.2|Plus11549084..1550064 NW_001581940 free fatty acid receptor 3-like LOC100015775 __SEG__ Chr4 {Monodelphis domestica} MDKLAVEGYFPGSHWLYFSAYLFIFLIGLPLNMVALIVFVGKLKRHPLAVDVLLLNLTLSDLLLLAFLPFRMVEAANSMSWPLPFILCPLSGFLFFTTINLSSLILTAVS
VERFLGVAYPLWYKTQPRLGQAILGSVVCWLLAGAHCSVVYVAEYLGDTYQLQYTNGSCYLEFREDQLDFLLPVRFEMSVVFFGIPLVLISCCYGRMVWILSKGARWKRR
KRVAGLTVATMLNFLLCFGPYHSSHIVGYVQSKSPTWRGYVLLLSTLNSCVDPLVFYFSSSGFQRDFHRLFTRLMELAGLGGGNARSGLETQKRTGQEKELSNSSK*
251 >lcl|XP_001369791.1|Plus1complement(126739160..126739480) NW_001581902 28S ribosomal protein S33, mitochondrial-like LOC100024874 __SEG__ Chr3 {Monodelphis domestica} MSSLSEYAIRMARLSARIFGEVAVPTDSKSMKVVKLFSEQPLAKRKETYDWYPPHNTYFALMRKLRFFGLYRDEHQDFKEEQRRLKKLRGKGKPKKGEGKRSAAKK*
252 >lcl|XP_001369806.1|Plus11556924..1557910 NW_001581940 free fatty acid receptor 2-like LOC100015816 __SEG__ Chr4 {Monodelphis domestica} MTERYLLLILYAMTLLIGLPTNLLALRAFVRRVRQPHPAPIHILLLSLTLADLLLLLMLPFKILEVASNFLWPLGKVVCALTGFSFYSSIYCSTWLLAGISIERYLGVAF
PVQYKLSRRPVYGLAAALVSWILSFGHCSIVIIVEYLGPRNTTEKNQTTFECYDDFSQDQLDVVLPVRLELCLVLFCLPMAVTVFCYWRFVCLMLSQPQVGVQRQRRAVG
LAIVTLLNFLLCFAPYNVSHVVGFFEGKSPSWRKYAVLFSSFNAGLDPLLFYFSSSAVRRTFGDGLMALKNQGASLLGRWGRGTLETDTGDNGLSQGDGVASSDFTTD*
253 >lcl|XP_001369810.1|Plus1complement(324308..325303) NW_001581973 mas-related G-protein coupled receptor member E-like LOC100015822 __SEG__ Chr5 {Monodelphis domestica} MEPAGPGHQAPAFSAWPYGDGNRTEGLRYVMDRDQEDEEGVAFNIFILALTELAGLGGLAGNGLVLWLLSSHIHRNNFSIYLLDLASADFLFLCCHLVIAIPETLQNHFS
FPHYVYDSLLALRFFFFTVGLSLLGAISAEQCAATLWPGCYQRRRPPHTSAVVCALLWALCLLLHFLSYGTCGELSGGDAGTLCGRIGLARVALLLLLLALMCVSGLVLL
VRMECGSPRQRPHKFYAIVLFTVLTFLFCGLPFGIYRLSLNWLRIPHYYYYLSVLMAAVNSSAKPPIYFCVGSLRRGRFREPFKTVLLRALGDEAELAERGEMLDAGPVE
M*
254 >lcl|XP_001369885.1|Plus1complement(121083102..121084133) NW_001581879 trace amine-associated receptor 3-like isoform 1 LOC100025177 __SEG__ Chr2 {Monodelphis domestica} MDLTYIPSDLSSCPKFGNKSCPPTSRPLSIRLIMYSFMTGAMFITIFGNLVIMISISHFKQLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWHFGDGFCKFHASF
DMMLSLTSIFHLCCIAIDRFYAVCYPLHYTTKMTTSTIKRLLAFCWSAPAIFSFGLVLSEANVSGMQTYEILVACFKFCALTFNKFWGTILFTTCFFTPGSIMIGIYGKI
FIVSKRHARVISNMPKNAREDSRKNISKKKDRKAAKTLGIVMGVFLACWLPCFIAVLVDPYLGYSTPMVVLDLLVWLGYFNSTCNPLIHGFFYPWFRNALKYILSGKIFS
SHSGTANLFPEAH*
255 >lcl|XP_001369917.1|Plus182455083..82455862 NW_001582021 leucine-rich repeat-containing protein 3B-like LOC100024760 __SEG__ Chr8 {Monodelphis domestica} MHLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLKSMASNHETANNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEADDISTVV*
256 >lcl|XP_001369958.2|Plus19327808..9328740 NW_001581963 olfactory receptor 145-like LOC100015999 __SEG__ Chr4 {Monodelphis domestica} MTVGNHSIVTEFILMGLTDKPELQLPLFLLFFGVYAVSMVGNLGLVLLIKISSQLHTPMYYFLSNLSFIDLCYSSVIIPKMMVNFVSEENIISFPGCLTQFFFFGYFAVS
ECYMLAAMAYDRYVAICHPLLYHITMSRRVCFLLVAGVHIIGIFGALIHTSFLVGLTFCGGKVINHYFCDILPLLKISCSNTHINEFLLVFNTGINVLVTTLAIFVSYAF
ILSNIFQIHSAEGRAKAFKTCGSHIVAVAIFYGSIIFMYFKPSSSDNNAQGKVASVFYTIVNPMLNPLIYSFRNKDVKDSLRKVMKDNRF*
257 >lcl|XP_001369985.2|Plus19341404..9342342 NW_001581963 olfactory receptor 8D4-like LOC100016034 __SEG__ Chr4 {Monodelphis domestica} MASENKSTVSEFYLEGLTDQPELQFPLFLLFLWVYVVTMLGNMAMIFLIAVSSQLKSPMYYFLSNLSFIDICYSSVVTPKLLVNFIENQNIISYPGCMTQLFFFCFFAID
ECYMLTAMASDRYVAICNPLLYNVVMNPRVCSLLATGVYMMGIVGALAHTTCMARLSFCGPNLINHYLCDILPLLKLSCSSTYINELLVMFVLGFNVLATSLTILISYAF
ILSSIFCIHSAQGRYKAFSTCGSHLAAVAIFYGSIMFMYFKPASSSNMTQEKVASVFYTTVIPMLNPLIYSLRNKDVKEALKKVIERRFCCI*
258 >lcl|XP_001370071.2|Plus1complement(9412764..9413708) NW_001581963 olfactory receptor 8D4-like LOC100016154 __SEG__ Chr4 {Monodelphis domestica} MASLNHSTVTLFILEGLTDQPELQVFLFVLFLGIYVVTVVGNLGMILLIGIGPQLKSPMYYFLSNLSFVDLCYSSAITPKLLVNFIEDKNIISYNECMTQLFFFCFFIVS
EFYMLTAMAYDRYVAICSPLLYNVIMSQRVCCFLATAVYTMGTFAALVHTSSMVRLSFCGPNVIKHYFCDIIPLLKLSCSSTYLDELLLVIVGTFNVFSTTIAIFISYAF
ILSSILSIQSAEGRSKAFSTCSSHLAAVAILYGTVIFMYLKPPSSSNMTQEKVASIFYTTVIPMLNPLIYSLRNKDVKDVLKKIMRCTMHNRSM*
259 >lcl|XP_001370100.2|Plus1complement(9422650..9423594) NW_001581963 olfactory receptor 8D4-like LOC100016193 __SEG__ Chr4 {Monodelphis domestica} MASLNHSTVTLFILEGLTDQPELQVFLFILFLGIYVVTVVGNLGMILLIGIGPQLKSPMYYFLSNLSFVDLCYSSAITPKLLVNFIEDKNIICYNECMTQLFFFCFFIVS
ECFMLTAMAYDRYVAICNPLLYNVIMSPRVCSFLATGVYSMGAFTTLVHTSCMVRLSFCGPNVIKHYFCDIIPLLKLSCSSTYLNELLLLVIGTFNVFSTTIAIFISYAF
ILSSILSIQSAEGRSKAFSTCSSHLAAVAIFYGTIIFMYLKPPSSSNMTQEKIASVFYTTVIPMLNPLIYSLRNKDVKDVLKKIMRCTMHNTSM*
260 >lcl|XP_001370103.1|Plus115183908..15185686 NW_001581994 frizzled-5-like LOC100016198 __SEG__ Chr7 {Monodelphis domestica} MARPDLDSPSGLPGPPPRPLLLLLLLLLAQLAGRGKASSKALVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYP
KPLPPCRSVCERAKAGCSPLMRQYGFAWPERMNCDRLPVLGDAETLCMDYNRSESTTAPPRAFPGKPTLAAPRASASSGGECGTCECREPFVRIQKETHPLFNKVRTGRV
LNCAVPCYQPSFSPDERTFATFWISLWSVLCFVSTSTTVATFLIDMERFRYPERPIIFLSACYLFVSLGFLVRLVVGHASVACNREHNHIHYETTGPALCTVVFLLVYFF
GMASSIWWVILSLTWFLAAGMKWGNEAIASYSQYFHLAAWLIPSVKSIAVLALSAVDGDPVAGICYVGNQNLDYLRGFVLAPLVVYLLTGTLFLLAGFVSLFRIRSVIKQ
GGTKTDKLEKLMIRIGLFTVLYTVPASIVVACYLYEQHSRESWERALTCQCPAGEPGQPRAKPEYWVLMLKYLMCLLVGITSGVWIWSGKTVESWRRFTSRCCCRGRRGH
KSGGATAARDYAEASAALTGCRTGAPCPSAAAYHKQVSLSHV*
261 >lcl|XP_001370115.2|Plus1complement(112118107..112119048) NW_001581961 olfactory receptor 10G7-like isoform 2 LOC100023460 __SEG__ Chr4 {Monodelphis domestica} MERDNQSFVTTFILMGIPHPSELSTVLFGIFLVIYALTLVGNLFIVLVIKVDSHLHTPMYYFLANLSFIDMWFSTVTVPKILMGLFSPDGGIISFQSCVAQLYSFHILGS
TECFLYTVMSYDRYLAITYPLSYATMMSGKMCAILAGGTWLSGAIHSAAQTALTFRLSYCGPNQIQHYFCDAPPILKLACANTSVNEMVIFVNIGIVASGCCFLIFLSYM
SIVRAILKIRTAEGRHKAFQTCASHCIVVLCFFGPGLIIYLRPGSMHAVDRIVAIFQTMITPLLNPIVYTLRNKEVKTALLRLKYHRNSIQIN*
262 >lcl|XP_001370129.2|Plus1complement(9439377..9440321) NW_001581963 olfactory receptor 8D4-like LOC100016235 __SEG__ Chr4 {Monodelphis domestica} MASLNHSTVTMFILEGLTDQPGLQVFLFILFLGIYVVTVVGNLGMILLIAIGPQLKSPMYYFLSNLSFVDLCYSSAITPKLLVNFIEDKNIISYMGCMTQLFFFCFFIVS
ECFMLTAMAYDRYVAICNPLLYNVIMSPRVCSFLATGVYSMGSVTTLVHASCMVRLSFCGPNIIKHYFCDIVPILKLSCSSTYLNELLLVVIGISNVFSTAIAIFISYAF
ILSSILSIQSAEGRSKAFSTCSSHLAAVAIFYGTIIFMYLKPPSSSNMTQEKVASVFYTTVIPMLNPLIYSLRNKDVKDVLKKIMRCTMHNRSM*
263 >lcl|XP_001370148.1|Plus1112361928..112362878 NW_001581961 olfactory receptor 6T1-like LOC100023657 __SEG__ Chr4 {Monodelphis domestica} MYSENWTQVTEFVLIGFPGSWGLQLILFLGLLVTYVVTIMGNVLIIVLSWSDHRLQTQMYFFLRNLSLLELAWVSVVVPKMMASLLTRDYSISFAACIMQSYLYFLFGTT
DFFLLAVMSLDRYLAICRPLHYETLMNGPICVRLVIASWISGFLWVLSPTILMASLPFCGPNVIDHFFCDSWPLMRLSCANTQLLELVAFILSTTVLLGSLALTSVSYGC
IFLTVFRAPTAAERRKAFSTCASHLAVVIIAYGSSIFLYIRISETQSLFLKKGASALACIITPLLNPFIFSLRNDKVKQALRDALRCHRNIGIRRL*
264 >lcl|XP_001370159.2|Plus1complement(9451077..9452009) NW_001581963 olfactory receptor 8D1-like LOC100016274 __SEG__ Chr4 {Monodelphis domestica} MTAGNFSTEIEFVLVGLTNRPELQLPLFFLFLCIYIVTMVGNVGMILLIIASPPLHTPMYYFLSSLSFVDFCYSSAITPKMLVNFLGKRNTIPYFKCMAQLFFFVVFVVA
EGYLLTVMAYDRYVAICNPLLYNTIMSYQVCSLMVAAAFTLGFISAMAHMSFMMKLSFCKSHIISHYFCDVLPLLNLSCSSTKINELLLHVIAGFNTLVPTLAVLISYAF
ILASILRIHSTEGRSKAFGTCSSHLMAVVIFFGSITFMYFKPPSSKSMEQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKALRNSFREREF*
265 >lcl|XP_001370186.2|Plus19469668..9470603 NW_001581963 olfactory receptor 8G1-like LOC100016313 __SEG__ Chr4 {Monodelphis domestica} MDTGNNSAMTEFILAGLTYWPGLQIPLFLLFLSIYVVTMVGNLSMITLIGVSSHLHTPMYYLLSSLSFIDLCHSTVIIPKMLVNFVSEKNIISYKGCMTQLYFFLIFVIA
ECHMLAAMAYDRYVAICRPLLYNVIMSNQVCIWLVIGVYIMAFVGATAHTGCMLRVFFCKDNVINHYFCDLNPLLELSCSSIYINEMMVVCLSAFNILTPIVTILSSYIF
IIASILRIRSTEGRFKAFSTCSSHMAAVGVFFGSGSFMYLQPSSVSSMEQGKVSSLFYSIIVPMLNPLIYSLRNKDVKVAMKKFIERRIFW*
266 >lcl|XP_001370212.2|Plus19478757..9479689 NW_001581963 olfactory receptor 8G5-like LOC100016349 __SEG__ Chr4 {Monodelphis domestica} MDKENNSAVTNFILEGLTDRPELQIPLLLLFLSIYVVTIMGNLGMVTLIGVSSHLHTPMYYLLSSLSFIDVCHSTVITPKMLVNFVSEKNIISYNGCMTQLYFFLIFVIA
ECHMLAAMAYDRYVAICSPLLYNVIMSHQVCIWLVAGVYIMAFIGATAHTGCMLRVFFCKDLVNHYFCDLNPLLEISCSSTYVNEVLVLCFSAFNILTPTLTILSSYVFI
ITSILRIRSTDGRSKAFSTCSSHMTAVGIFFGSAAFMYLQPSSVSSMEQAKVSSVFYTILVPMLNPLIYSLRNKDVKVAMKKFVERRWFQ*
267 >lcl|XP_001370433.1|Plus1complement(60241046..60242644) NW_001581861 muscarinic acetylcholine receptor M5-like LOC100026723 __SEG__ Chr1 {Monodelphis domestica} MEKDPYPNETIANGTPIQHQPLSKHSLWEVITIAIVTAIVSLGTIVGNILVMLSFKVNSQLKTVNNYYLLSLAFADLIIGVFSMNLYTTYILMGHWALGSLACDLWLALD
YVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERKVPPGECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRET
EKRTKDLAELQGSVSVAEFEMNKSTRKTLLKSCFSCQQPTQAKRERCQASWSSSSRSTSATVKPSQPTDANNDWVKEEQLTTCSSYASSEDEDKPTTDPAFRKTYKSKAK
ESPKKEFNAADSKETFVKEHSVNDNYETQKYFLSPTTIHGPKSQKCVAYKFRLVVKADGTQDTNNGCHKLKIIPCSVPVSKEPSTKGMDSNLSNQMTKRKRMVLVKERKA
AQTLSAILLAFIITWTPYNIMVLVSTFCSKCIPVTLWHLGYWLCYVNSTVNPICYALCNKTFRKTFKMLLLCRWKKKKVDEKLYWQGNSKMP*
268 >lcl|XP_001370447.2|Plus19629147..9630082 NW_001581963 olfactory receptor 8G5-like LOC100016661 __SEG__ Chr4 {Monodelphis domestica} MAMRNNSPVTEFMLSGLTDWPEIQLPLFFLFLGIYVITVVGNLGMIILIVLSSHLHTPMYYFLSSLSFIDLCHSTIITPKMLVKFVSEYNIISYPECITQLYFFLIFAIA
ECHMLAVMAYDRYVAVCSPLLYNVIMPHKVCFCLVGGVGIIAVFGATVHTGCVLRVYFCKDNIVNNFFCDLLPLLKLACSSTYINELVILAFTLFNFFIPTLTIFSSYAV
ILFRIFRIQSIEGRSKAFGTCSSHIMGVALFFGSAGIMYLQPSASNSMEQGKVSSVFYTVVMPMLNPLIYSLRNKDVKVALKKMLERRKFS*
269 >lcl|XP_001370450.2|Plus1complement(658567..659502) NW_001581973 mas-related G-protein coupled receptor member X1-like LOC100016665 __SEG__ Chr5 {Monodelphis domestica} MADRTAERTNGSFPCGGPGGDGFGDWKQILTMGIAVVGLLGNGLVLWLLGFRIPRSPFSVYILNLAAADALFLCGLFAFYLKQFIGSFNDVVTDHVMITFTFLFYHVGLS
LLVAISTERCLSALFPLWYRCHRPKHTSAAVCALLWALAGLCCGIYCGLCIYTCDAPFCLAFPIALFVWFLLLTPLLCASSLALVLRVQCGSRRRQPPRFYLLVVLTVLV
FLLCGVPAGIVDFLYVFSGLEPRHHLSSLLLACVNSSANPFIYFFLGSRRRRRGREPLRVVLQRALGGPQEPESGRRDSLHTNTTEASARG*
270 >lcl|XP_001370472.2|Plus19648260..9649192 NW_001581963 olfactory receptor 8G1-like LOC100016691 __SEG__ Chr4 {Monodelphis domestica} MTMRNNSPVTEFILSGLTDWPEIQLPLFFLFLGIYVITVVGNLGMIILIVLSSHLHTPMYYFLSSLSFIDLCHSTIITPKMLVKFVSEYNIISYPECITQLYFFLIFAIA
ECHMLAVMAYDRYVAVCNPLLYTVTMSHQVCLWLVGGVYLLGLVGATAHTGCILRVFFCKNHISHYFCEILSLFKISCSSTYINEVVLLSFGAFNILIPSIIIVSSYICI
INSILHIQSLEGRSKAFSTCSSHMAAVALFYGSAAFIYLQPSSENSTDQEKVSSVFYTIFVPMLNPLIYSLRNKDVKVAMRKIMEKRNLV*
271 >lcl|XP_001370494.2|Plus19665817..9666752 NW_001581963 olfactory receptor 8G2-like LOC100016722 __SEG__ Chr4 {Monodelphis domestica} MDTNNHSTVTQFFLKGLTDEPGFQLPLFILFLLVYSASVLGNVGMIILIVLNPHLHTPMYYFISNLSFIDLCHTTIITPKMLVNFVSEKNIISYSECMSQLYFFLIFVTA
ESHALAVMAYDRYVAICSPLLYNVLMNYQVCSWLMGGVYFLGIVDSTIHIGFMQRLLFCKANVIDHYFCDLHPLLSLSCSSTYVNELLVLYLSAFNIFTPVLTIFSSYIF
IIASILRIRSTEGRFKAFTTCSSHIAAVTLAFGSGMVVYLQPLSAHSMTQGKVSSVFYTIILPMLNPLIYSLRNKDVKIALKKTLEKIRFS*
272 >lcl|XP_001370504.1|Plus177792270..77793580 NW_001581835 suppressor of cytokine signaling 4-like LOC100024207 __SEG__ Chr1 {Monodelphis domestica} MAENNTKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKNEHSSDTDAPGATEKADGPLGSPERKHSCSSIELDLDRSCGHRFLGRSLKQKLQDAMGQCFPIKNCSSRHS
SVLPSKRKILISELMLDKCPFPPQSDLAFRWHLIKQHTAPITPKSDNRRSTDLSDSDMRDVQLKERGNREENINSFSHNQVQPCDMATEHHSHKCDPKTDSVMNLASNNS
IEDSDMDSDDEILTLCTSSRKRNKPKWETDDEMLQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLH
ARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSSCMFFEPLLSTPLNRTFPFSLQHICRTVICNCTTYDGIDTLPIPSSMKLYLKEYHYKSKVRVLRIDVPEQ*
273 >lcl|XP_001370605.2|Plus19803485..9804417 NW_001581963 olfactory receptor 8G5-like LOC100016866 __SEG__ Chr4 {Monodelphis domestica} MAKGNYSLVTEFILKGLTDQPELQLPLFLLFLGIYMVTVVGNLGMIILIRLSSYLHNPMYYFLSSLSFIDLCQSNIIIPKMLMNFLSKKNTISYPECLTQFYFFVFFGIS
ECQMLAVMAYDRYVAICNPLVYSLVMSYQVCLWLVGGVYALGLAGATTNTGCLFRVLFCKKNVIEHYFCDLLPLLKLSCSSTFINEVVALAFSAFNIIFPTLIIICSYIL
IIASILKIQSSEGRYKAFSTCSSHIAAVGIFFGSLAFMYLQPSSVSSMDQVKVSSVFYSIIVPMLNPLIYSLRNKDVKIALKKVIERIFK*
274 >lcl|XP_001370627.2|Plus115765671..15766597 NW_001581838 olfactory receptor 1L1-like LOC100016896 __SEG__ Chr1 {Monodelphis domestica} METYNYTSVTEFVLLGLTSQLDIQPVIFGVIFAMYLITIVGNSMIITVTWIDPKLKTPMYFLLSQLSIIDICFTTITVPQLLIHTFSRSKTISFTQCMTQVFFFVAVGNM
EGYLLATMAYDRYVAICNPLRYGAIVTQKFCVSIVLVSWLLMFLNSLLHTILVSRLNFCSNHILHFFCDLPPLMQLSCSRPFINEIIILTEGVAATLSPFVFILASYVCI
AVTVLGLRSTAGLRKAVSTCGSHIVVVTLFYGTIIRLYFQPVSSYTLDRDRQVAVFYTVVTPMLNPIIYSLRNQEVKGALQRTLRKIF*
275 >lcl|XP_001370655.2|Plus19846128..9847057 NW_001581963 olfactory receptor 8G5-like LOC100016943 __SEG__ Chr4 {Monodelphis domestica} MEKENSSLVTEFILIGLTDLPELQLPLLFLFLGIYLVTVVGNLSMVTLIGQSSHLHNPMYYFLCNLSFIDLCQSTVIIPKMLMNFSSEKSIISYPECMTQFYIFAFLTIS
ECHMLAAMAYDRYVAICNPLLYNVLMSNQLCSWLVVGVYALGLVEATAHTGCLLRVFFCEENAINHYFCDLLPLLKLSCSSTYVNEVMALSLSAFNILFPILTIICSYIF
IIASILKIQSTEGRSKAFSTCSSHIAAVGVFFGSLAFMYLQPSSVSSMDQGKVSSVFYTIIVPMLNPLIYSLRNKDVKIALRKVIERTL*
276 >lcl|XP_001370668.2|Plus115786602..15787555 NW_001581838 olfactory receptor 1B1-like LOC100016966 __SEG__ Chr1 {Monodelphis domestica} MACASNASHTPIFLLVGLWKGGPPNSLLFLLFLTAYMGAMVGNLTLVLLISWDSRLSTPMYYLLRGLSVIDTGLATVTLPQVLAHLASAQPAIPAIRCLLQFFFFYVFGV
TDTLVVAVMAVDRYVAICNPLHYPAVMNQQVCGRLLASCWTVSFIHSLLHVGLLFPLQWTGDNEGVVYLPHFFCDHRPLLKASCSDTKPNELAIFLEGGLLMMGPCILIL
LSYARIAITISRLPSAAGRKKAFSTCGSHLTMVTFLYGTIIWVYFQPPSQNSQQQDMAAAVMYTAITPLANPFVYSLRNKDVKGAFQRLLVPNRVTS*
277 >lcl|XP_001370680.1|Plus1818660..819619 NW_001581973 mas-related G-protein coupled receptor member X2-like LOC100016982 __SEG__ Chr5 {Monodelphis domestica} MTQDSVDGNLFERNESLFIYYGDCEETSFAVTIKSLILAFSVCGLVTNGLVLWLLGFRIKRNSFSVYILNLAAADFFYLCCQIAQCFEVVCPTFCDTVPDFITTLMFFFY
TLGLSLLVAISTERSLAVLFPIWYRCHRPKHTSAIVCSLFWVLYLLGNFLESCACGLFGPLSCHLMSCPVWDFLFVTLILLLVSVLCISSLTLILKVQCHPKHRRPSRLY
LLILLTVLMFLLCGLPMGFHWFLLIWFMDLKCIVFVFQLLSCVNSSSNPLIYFFLGSLRQKKRREPLRVLLQRALRDEAETEGAKEISHTEIMEMSVCS*
278 >lcl|XP_001370695.2|Plus115842909..15843877 NW_001581838 olfactory receptor 1B1-like LOC100017002 __SEG__ Chr1 {Monodelphis domestica} MGCASNASHTPIFLLVGLWRGGPPNHLLFPLFLIAYVAAVVGNLMLVLLISRDSQLGTPMYYLLRGLSVVDAGQATVTLPQLLVHLVSLQPAIPAAHCLAQFFFFYLFAV
TDTLVVAVMALDRYVAICDPLHYSALMNRHVCDCFMASCLFLSLLHSLLHLGLLLPLQWNGNSGDAVYIPHFFCDHWPLVRASCSNIQLNVLAIFLEGSLFVAGPCALIL
FSYAHIAVAILRLPSAAGRWKAVSTCSSHLTMVSFLYGTVILVYFQPPSHNSPEQDMAAAVMYTAITPVANPFVYSFRNKNVKNALHRLLSPNRVASQLEWS*
279 >lcl|XP_001370707.1|Plus14744933..4745646 NW_001581931 TMF-regulated nuclear protein 1-like LOC100017018 __SEG__ Chr4 {Monodelphis domestica} MPGCRISACGTAPRPGEPPPPPFSPPLPPHSSPAPSDPGDEQGSPPPSPPPQPPPHPQSAASGTTTATTTTPAPPAEKGTGRGLELQRWRPGGHGAAGAAAAGSRALELA
EARRRLLEVEGRRRVVSELESRVQHLHRVFLAAELRLAHRAESLSRLGGSVSQAELYLAAHGQRAKKGLRRGKRPRPPALLASALGLGGCVPWAAGRLRRAGAAAASPEP
DSPFRRSPPRGPASPQH*
280 >lcl|XP_001370710.2|Plus19882210..9883142 NW_001581963 olfactory receptor 8G5-like LOC100017021 __SEG__ Chr4 {Monodelphis domestica} MEKGNYSVVIEFILIGLTDQPEIQLPFFFLFLGIFMISVWGNLGMIILIGLSSHLHKPMYYFLFNLSFIDLCQSTVITPKMLLNFVSEKNTISYPDCMTQFYFFAFFGIS
ECQILAVMAYDRYVAICHPLLYNVIMSYQKCSWLVGGVYAFGLMGATAHTGCLLRVLFCKENAINHYFCDLLPLLKLSCSSTYVNEMVSLAFSTFNILFPTLAIICSYVF
IIASILKIQSTEGRSKAFSTCSSHIAAVGVFYGSVAFMYLQPSSVRSMDQGKVSSVFYTIIVPMLNPLIYSMRNKDVKIALRKVIVGRTS*
281 >lcl|XP_001370720.1|Plus1complement(85000943..85002283) NW_001581837 D(1A) dopamine receptor-like LOC100026854 __SEG__ Chr1 {Monodelphis domestica} MPLNDTTMDRGGLVVERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASI
LNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLNWHKASPLSSPDGNVSLQDETMDNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIA
QKQIRRISALERAAVHAKNCQNTTGNGTNVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCESDLPSGETKPFCIDSITFDVFVWFGWANSSLN
PIIYAFNADFRKAFSTLLGCYRLCPTANNAIETVSINNNGAVFSSHHEPRGSISKDCNLVYLIPQAVTSRDTKKEEGGGSKPLEKTSPALSVILDYEVDLSLEKINPITQ
NGQHKT*
282 >lcl|XP_001370752.2|Plus1complement(15906902..15907840) NW_001581838 olfactory receptor 1G1-like LOC100017083 __SEG__ Chr1 {Monodelphis domestica} MDRGNQMRVSEFLLLGLSHPLEQQLILSGLFLIIYLVTAVGNLLIMLAICSDSHLHTPMYFFLANFSFTDVCVSSTTVLKMFNIQTHSQTICYGGCLTQIFFFLSFIGLD
VFLLGIMAYDQLVAICHPLHYTILMSPQHCYLLVAVSLVMAHLFSLTHTNLLAQLPFCAANTIPHFFCELLPLMKLSCSEPYTNQHVLIYWGGALTILIPLMILISYVPI
MNPILCIPSVKGKCKAFSTYGSHLSAVCLFYVAAIGVYFIPFEADSAGKDRLAAVMYAVVTPMLNPFIYTLRNTDMKAALGRILNRRSLLFL*
283 >lcl|XP_001370770.2|Plus117221267..17222331 NW_001581994 probable G-protein coupled receptor 1-like LOC100017108 __SEG__ Chr7 {Monodelphis domestica} MEEIEYVFDEFENYTYASEYFQQELELEERSRLGPAQWISLVLYSLAFVLGVPGNAIVIWFTGFKWEKTVATLWFLNLAVADFVFLLFLPLYISYVAMNFHWPFGTWLCK
ANSFIALLNMFASVFFLTVISLDRYVHLIHPVFSQRHRTLRNALCAIGIIWLVAGLIAGPALYFRETLEHNNHTICYNNFHQSDDSIVLMRHHALTWIKFVLGYLLPLLT
MIICYSLLALQVKRRAALTSSRHFWTILAVVLAFIICWTPFHLFSIWELSIHHSSAYHHVLQAGLPISTGLAFFNSCLNPLLYVLISKKFQARFQASVAELLKHTLREVS
WSGTVSEQYKHSETKNLCLLEIMQ*
284 >lcl|XP_001370782.2|Plus1complement(15930770..15931714) NW_001581838 olfactory receptor 1N2-like LOC100017128 __SEG__ Chr1 {Monodelphis domestica} MGQENRTSISEFILLGLSEQPDQQRLLFGLFLTMYLITVVGNLLIILAIGSDSHLQSPMYFFLANLSFADICFTSASIPKMLVNIETQHQTISYVGCITQLYFLLALGGL
DNLLLAAMAYDRYVAICRPLHYATTMSPQNCVLIMSMCWALTNIPALTHSILLAHLFFCTQHAIPHFYCDISALLKLACSDTHLNELMVIILGAIFLTVPLALIILSYAC
ITSAVLGFSSPEGRWKAFSTCGSHLTVVLLFYGSLMGVYLFPSSSDSVRRDSATSVLYIVVTPMLNPFIYSLRNRDMKGALRRLLGNGKTLSSS*
285 >lcl|XP_001370797.1|Plus1861263..862264 NW_001581973 mas-related G-protein coupled receptor member X1-like LOC100017147 __SEG__ Chr5 {Monodelphis domestica} MSSNLIMELSTMIPTHSEMLQNHSDQPSGNSTSHNSTNDAFDEFVRCLTLFTCICGVIGNGIVLWLLSFHIKRTPFSFYVLSLAASDFTYLFLEVIWVINYLLYRPMFQN
IVNLLTNMGLHVTFTVGLGLLASISSQRCLSILFPIWYRNHHPKRGPMVVCGILWLMSLLLNPPKVYYCVVRMEELPPSGCDLMSKLSGTLMLSMLILMTLSSLILFIRV
LWSAKRYKPKKLVILILLTVSVFLLCAVPHGINHSVFNWRAMYNHTFHEISYFLSCVNSSANPLIYFFIGSLKHQRLKEPLRVVLQRALRDDSDLTEDRGTSSRTDTTLD
APS*
286 >lcl|XP_001370810.2|Plus1complement(15944400..15945359) NW_001581838 olfactory receptor 1J2-like LOC100017167 __SEG__ Chr1 {Monodelphis domestica} MGTDNNKTSVSEFLLLGLPIRPQQQVLFYILFLSMYLTTVLGNLLIIFLIRLDSHLHTPMYFFLSHLAFTDVCFSSVTTPKMLMDMQTGSQTIPYGGCISQMYFFILFTD
LDSFLLTAMAYDRYIAICHPLHYTTIMSQSLCSLLVVGSWILSCASSLTHTLLLARLSFCEEHTIAHYFCDLAALLKLSCSDTFLNELVIFTVGVAIITLPLICILVSYI
HIIATILKIPSTKGICKALSTCGSHLSVVSLYYGTIIGQYFFPSSSNSNFKDIISAMMYTVVTPMLNPFIYSLRNRDIHGALKKVFHKRMFFFSSQSDP*
287 >lcl|XP_001370872.2|Plus116020838..16021782 NW_001581838 olfactory receptor 1Q1-like LOC100017257 __SEG__ Chr1 {Monodelphis domestica} MERTNWTSVSYFILLGISTQSEEQIPLFVLFLFMYIINVSGNLVIILLTISTTRLHTPMYFLLSSLSLADIGFTSTIVPNMLFNIFSDMKTISYIGCLTQVYFFISFAAM
ENFLLAVMAYDRYVAICHPFHYPVVLTRRLCAQMVVSCFMLSHVHSLLHTLLMTRLSFCSDNKIHHFFCDLYPLMKISCSSAYINTLVIQTEGVVIINGALTFIIISYAY
IISAILKVPSAIGKRKAFSTCGSHLTVVAIFYGTLTWVYFRPLSSYSVAMGRIMTVMYTVLTPMLNPFIYSLRNGDMKAAFRKCLTRIWYSSLK*
288 >lcl|XP_001370884.2|Plus1complement(6226054..6226992) NW_001581980 olfactory receptor 1F1-like LOC100017270 __SEG__ Chr6 {Monodelphis domestica} MEKGNQSTIMEFLLLGLSSHPEHQQLLFVLFLHMYLITVLGNFLIILAIAGDSQLHVPMYFFLSNLAFVDICFTSTTVPKMLVNHIIGSKVIPFGGCLTQMYFVFVFADM
DNFLLAVMAYDRFVAICHPLHYATKMTHHLCALLATGSWIIANLNALLHTLLMARLTFCTNNVIPHFFCDVSPLMKLSCSDPSLNEMVIFTEGGLVMITPFICILASYIH
IASAVLRIPSMKGKWKAFSTCGSHLAVVSLFYGTIIAVYFSPSSTHSIKKDTAATVMYTVVTPMLNPFIYSLRNQDMKRALIKMVSRKRFPA*
289 >lcl|XP_001370895.2|Plus116076673..16077665 NW_001581838 olfactory receptor 1361-like LOC100017292 __SEG__ Chr1 {Monodelphis domestica} MDTRNWTEVTEFLLLGLSDRPEMQPVIFGVILSMYLVAVTGNIMLIVVASTDSKLQTPMYFLLRQLSFIDVLLTTVVVPQMLVHTVTGFKTIPFENCIVQLFFFMAIGSM
EGHLLAAMAYDRYVAICKPLQYYAIVTRSLCLRITLSSWVVVSLNSLLYSVLAARLTFCGNRVTHFFCDITPLLKLSCTRPLLNEMLIFTEGAAIVISPFFFILASYVRI
GVAIGRLHSAAALKKALSTCSSHILVVLLLYGSVIRMYLRPSSSYDLDQDRQVAVFYTVVTPMLNPLIYSLRNQEVKNALWRLLKKIQNVYASGDFQPNSPSRGTQDHIS
*
290 >lcl|XP_001370910.1|Plus1964531..965499 NW_001581973 mas-related G-protein coupled receptor member X3-like LOC100017312 __SEG__ Chr5 {Monodelphis domestica} MAVSSIAQQGVYMPDNATESSVNGSLVPGTPAESEAFAWMSLLTQFIVVVGLVGNTIVLWLLGFRMPRNPFSVYILNLAGADALFLCGQTARFILRCAGYSNLASAMGVI
YVINSSYTAGLSLLAAISTERCLSVLFPFWYRSHRPKHTSPGVCAVLWALASLLGVADLIFCVHAHNHHFCPTFFIVRAVWFFLLTAVLCVSSLTLVLRVQCNSQRRRPP
RLYLLILLTVLLFLLCGLAPGIKISIRSLYLAFRNHWLPTLLACVNSSLNPLIYFFLGSHSHRKERESLKVVLQRALGDKQELEGEGRNTSHTITPETSSWD*
291 >lcl|XP_001370911.1|Plus114177296..14179068 NW_001581976 calicin-like LOC100017313 __SEG__ Chr6 {Monodelphis domestica} MKLEFTEKNYNNFVLQNLNKQRKRKEYWDMAVNVDDHVFFAHRNVLAAVSPLVKSLISNNDMKNTDELFITIDSNYLSPSSVEQLMDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCTDFLLKSIKRNNSLRYLFLAELFELKEVSDCAYAGIRDNFYYWVSHEGSSHFMQCPPVIFGRLLRDENLHVQNEDQALTALLHWVLFKKEDREKYFKKFF
SYINLNGVSNKTLIFASNKVGGMENSNALTLIENVLLDRKQEKPSRLLNFQRKGALLDAVVILGGQKAQGKFNDAVFAYIIEEDIWLKLTEMPYKAAALSATSMGKYIYI
SGGTTEQISGLKTSWRYDMDENSWTKLPDLPMGLVFHTMVTCGGVVYSVGGSVAPRRYISNIYKYDERKELWSLVGKMSIPMDGTAVITKGNRHMYIVTGRCLVKGFISR
VGVVDCFDTCTGEVVQCITFPIEFNHRPLLSFQQDNILKVHSHRQSVEINLQKIKASKTASCVPLLPNNCALDVSHAVCPIGDNKVFVCGGVMSGNDTHNKDYTINKNAY
LLDQKTGEWKIITPPPEALDCPACCMVKLPCKVLRRIDNI*
292 >lcl|XP_001370925.2|Plus116124595..16125587 NW_001581838 olfactory receptor 1361-like LOC100017340 __SEG__ Chr1 {Monodelphis domestica} MATKNWTEVTEFLLLGLSDRPEMQPVIFGVILSMYLVAVTGNTMLIVVASTDSKLQTPMYFLLRQLSFIDVLLTTIVVPQMLVHTGTGFKTIPFENCIVQLFFFMAIGSM
EGHLLAAMAYDRYVAICKPLQYYAIVTRSLCLRITLSSWVVVSLNSLLYSVLAARLTFCGNRVTHFFCDITPLLKLSCTRPLLNEMLIFTEGAAIILSPFFFILASYVRI
GVAIGRLHSAAALKKALSTCSSHILVVLLLYGSVIRMYQRPSSSYDLDQDRQVAVFYTVVTPMLNPLIYSLRNQEVKDALWRLLNKIQNVYASGDFQTDHPSRRPQHHIS
*
293 >lcl|XP_001370985.1|Plus1complement(1133477..1134493) NW_001581973 mas-related G-protein coupled receptor member X2-like LOC100017422 __SEG__ Chr5 {Monodelphis domestica} MDQTSTPLYRGLEETERNDTLLPPSQGNGTDTKALPISIPYLTVLISLVGLLGNGTVLWLLGFSIKRNPFSVYILNLAGADFIFLSCQAFYTVVDIWKDSYNTSSTDHFY
VTWFLYSSFPALRVLAPVTFSAYTMGLSLLAAISTERCLSVLFPVWYRGQRPKHTSTAVCALLWIQAVLVSVLTGESCGFFYRPYNEQGCYDFTMASAVLVFFLFSLMSG
CSLTVFLKVRSSFWARRSPKIYVVILLTVLMFLLLGSPFSLYWFLLAWWKDTLLKGWHVPYFIIDILSCVNSSINPFIYFFVGSFRQQKQRESLRVVLQRALKDEPESSR
TETTEMSA*
294 >lcl|XP_001371055.2|Plus116197347..16198288 NW_001581838 olfactory receptor 24-like LOC100017520 __SEG__ Chr1 {Monodelphis domestica} MQKGNTTGISEFLLLGLSEQPNHQLILFGIFLTMYLVTILGNLLIILAIASNSHLHSPMYFFLANLSLVDTCFTSTTVPKMLLNIWTHRQNISYAGCLTQMYFFMAFALL
DDFLLAAMAYDRYVAICLPLHYTTVMSPTRCVLLVTISWLCSHLIALSLTLFMAQFSFCGSYVIPHFFCDLLPLLKLSCSDTSIFQVVMFIDASLAGFIPFACILFSYVH
IILTIFRVPSDDGKHKVFSTCGSHLSMVILFYGTLILVYLQPSSSYSAETGIIASVMYTVVTPMMNPFIYSLRNKDMKRALRKLLSKGMTPSW*
295 >lcl|XP_001371065.2|Plus1complement(10135198..10136208) NW_001581963 olfactory receptor 145-like LOC100017532 __SEG__ Chr4 {Monodelphis domestica} MGGEICFHFLHSSFFPILTDTSQRRMATGNDSSVTEFFLAGLTDQPELQLFLFFLFLGIYVVTVLGNLGLIILIRLNSHLHTPMYYFLFNLSFIDLCYSSVITPKMLMNF
VSEKNVISYSGCMAQLYFFCFFGLSESLLLSAMAYDRYIAICNPLLYTITMSSKVCFLLVTGVYVLGFAGAMAHTGCMLRLSFCDNNIINHYMCDILPILELSCTSTYVN
ELVAFIVASIDIGMISSTIFTSYAFIFSNILRISSSGGRSKAFSTCSSHIVTVSLFFGSGAFMYLKPSSVGSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVKLAMRKTM
RPRMIF*
296 >lcl|XP_001371073.1|Plus1complement(10663662..10664555) NW_001582021 GTPase IMAP family member 7-like LOC100017544 __SEG__ Chr8 {Monodelphis domestica} MDVDEANVPRIVLVGKTGHGKSATGNTLLGKELFASGVSANSTTKTCQKEVASWKGKGFLVVDTPGLFDTKKSLETTCNEISRCVIYSCPGPHAIILVLQLGRYTKEEKH
SVSLIKALFGKLAMNYMIILFTRKDDLKNEKLDNFLKESEDLQSLIHECGGRYYAFNNKAEGNEREVQVKELLDLIEKMMQNNKGKHFSDKIYEKTNEALKRRRRALKEI
YTQERDDEIQIIEQEYANESSLTEEQIREKQERIKKVEREYEEKMKNINAEAERTVFEQVVQFVKDLICKISGWFKK*
297 >lcl|XP_001371081.2|Plus116227373..16228314 NW_001581838 olfactory receptor 1G1-like LOC100017559 __SEG__ Chr1 {Monodelphis domestica} MGRGNTTSISEFLLLGLSEQPDYQLILFGLFLIMYLVTMLGNLFIILAIASNSHLHSPMYFFLANLSFIDNCFTSTTVPKMLMNIWTHHQSISYAGCLTQMYFFMTFALL
DDFLLAAMAYDRYVAICLPLHYTTVMSPTRCVLLVTISWLCSHLIALSLTLFMTQFSFCGSHVIPHFFCDLLPLLKLSCSDTDTFQVVMFIDAALAGLVPFTCILFSYVH
IISTIFRVPSADGKRKVFSTCGSHLSVVILFYGTVILVYLRPSSSYSAETGTIASVMYTVVTPMLNPFIYSLRNRDIKGTLRRLLSKGMISFW*
298 >lcl|XP_001371087.2|Plus1complement(10181841..10182773) NW_001581963 olfactory receptor 145-like LOC100017567 __SEG__ Chr4 {Monodelphis domestica} MGRENDSFVSEFILFGLTDQPELQIPLFFLFLGIYVITVVGNLGLIVLIGLNSHLHTPMYYFLFNLSFIDLCYSSSIIPKMLVNFVSAKNTISYSGCMAQLYFFCFFVVS
ESFLLSAMAYDRYVAICKPLLYNITMSYQVCCLLAVCAYVMGFSGAMPHTGSMLRLSFCNNNIINHYMCDILPLLELSCTSTYVNELVVFIVVGIDIGVPTITIFISYAL
ILSSILHINSTEGRYKAFSTCSSHMMAVSLFFGSGAFMYLKPSSLLSMSQGKVSSVFYTIVVPMLNPLIYSLRNKDVKLAMKKIVSKIIF*
299 >lcl|XP_001371099.2|Plus11814079..1815017 NW_001587053 olfactory receptor 1P1-like LOC100017583 __SEG__ ChrX {Monodelphis domestica} MAEGNQTHLVQFILQGLPEQSSHGWTLFGLFSWLYLVSLTGNLLISVAILLDAHLHKPMYFFLAHLSLADACFVSTTVPNLLVSLGTQDRSISYCRCLTQLYFFLTFGDL
DIFLLAVMAYDRYVAICYPLHYATTLGPTRCVFLVATCWLLTSLVALTHTLLMAQLSFCTDKTIPGFFCDLGPLMQASCSNPQTNMLVLLTLGGAVILAPFALVLLSYVH
IALAILRTPSAQGRRKAFSTCGSHLTMVFLFFGTVIRAYLCPTDPGSAAAGDTVAIVMYTVITPTVNPFIYSLRNGDMQAALARLVRGQRTT*
300 >lcl|XP_001371106.2|Plus116257864..16258826 NW_001581838 olfactory receptor 5C1-like LOC100017590 __SEG__ Chr1 {Monodelphis domestica} MTLKNITWIDGAPDEFILLGITDRWDLRVALFLVFLPIYLLSLLGNMGMVLLINVDTRLHTPMYFFLANLSLLDACYSSAIGPKMLIDLLLSHATIPYAACAIQMFVFAG
LADAECCLLAAMAYDRYVAIGNPLLYTTAMSRRLCLLLLAASGLGGALSAFVHTTFTFRLHFCHSREVNSFFCDIPPLLAISCDDTSLNELLLFAVCGFIQTATVLAIAV
SYAFILVAVIRMNSAEGRRRAASTCGSHLTAVAMLYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKEVKEALQRTWNRFCFPHQRHQ*
301 >lcl|XP_001371134.2|Plus1complement(10243873..10244805) NW_001581963 olfactory receptor 145-like LOC100017637 __SEG__ Chr4 {Monodelphis domestica} MGRENDSFVSEFILFGLTDQPELQIPLFFLFLGIYVITVVGNLGLIVLIGLNSHLHTPMYYFLFNLSFVDLCYSSSIIPKMLVNFVSVKNTISYSGCMAQLYFFCFFVIY
ESFLLSAMAYDRYVAICKPLLYNITMSYQVCCLLAVCAYVMGFSGAMPHTGSMLRLSFCNNNIINHYMCDILPLLELSCTSTYVNELVVFILVGIDIGVPTITIFISYAL
ILSSILHINSTEGRYKAFSTCSSHMMAVSLFFGSGAFMYLKPSSLLSMSQGKVSSVFYTIVVPMLNPLIYSLRNKDVKLAMKKILSRKIF*
302 >lcl|XP_001371144.1|Plus146866471..46867178 NW_001581875 suppressor of cytokine signaling 3-like LOC100026656 __SEG__ Chr2 {Monodelphis domestica} MVTHSKFPATGMNRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRS
TQPVPRFDCVLKLVHHYMPPSSSSSSSSSSSSSSSSSTSSAASPSSLQDQMLPQPLPGAPPKRTYYIYSGGEKIPLVLSRPLSSNVASLQHLCRKTVNGHLDSYEKVTQL
PGPIREFLDQYDAPL*
303 >lcl|XP_001371147.2|Plus116279492..16280442 NW_001581838 olfactory receptor 1K1-like LOC100017656 __SEG__ Chr1 {Monodelphis domestica} MERTNRSSEGAPFILLGLSTSPGQLRPLFALFLVLYILGVMGNGLIVTAIRASPALHAPMYFLLAHLSFADLCFTSVTVPKMLANLLAQDRSISRAGCLTQMYFFFALGV
TDSCLLAAMAYDRYVAIRHPLHYAARMSRAVCTGLVGAAWAVSHSHSLLHILLMARLSFCASRSVPHFFCDHQPLLRLACSDTRHIQLLIFTEGAAVVVTPFLLILASYG
AIAVAVLRLPSASGRLRAVSTCGSHLAVVGLFYGTVIAVYFQPTARYEAERGRVATVMYTVVTPMLNPVIYSLRNRDVQGALRALFTGRRISTEPI*
304 >lcl|XP_001371183.2|Plus113971447..13972358 NW_001581971 olfactory receptor 4B1-like LOC100017713 __SEG__ Chr5 {Monodelphis domestica} MAIINNVTQLIFTGLFQDQEAQKGCFVVFLPMYIATMLGNGLIILTVNTSKSLNSPMYFFLSHLSLIEICYSSTVVPKLISGLIAENNTISLNGCITQIFFFHFFGVAEI
LLLTVMAYDRYVAICKPLHYMTIMSRPVCRVLVFSCWMAGIFHSVIQILITIQLPFCGPNVIDHYFCDLHPLFKLACTDTFVEGIIVFANSGLITLFFFLLLIFSYVVIL
VHLRNQSAEGRRKALSTCGSHITVVLLFFVPATFLYLRPSSTYAEDKLLSVFYTVLTPMLNPVIYTLRNTEVKNAMRRLWRKK*
305 >lcl|XP_001371227.1|Plus1complement(5905343..5907484) NW_001581871 leucine-rich repeat neuronal protein 2-like LOC100017780 __SEG__ Chr2 {Monodelphis domestica} MWLLLVHLVLAWIAEAAAPVPVVPWRVPCPPQCTCQIRPWYTPRSVYREATTVDCNDLFLSSVPPGLPSGTQTLLLQSNNIARVEQNELDYLANLTELDLSQNGFSDARD
FGLRALPQLLSLHLEENQLTQLEDDSFAGLANLQELYLNHNQLRRISPGAFTGLGNLLRLHLNSNLLQAVDSRWFQVLPSLEVLMIGGNKVDAILDMNFRPLANLRSLVL
AGMNLQEISDYALEGLRSLESLSFYDNKLARVPKRALEHVPGLKFLDLNKNPLQRVGPGDFTNMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFVHPRA
FRHLPQMETLMLNNNALSALHQQTVESLPNLQEIGLHGNPIRCDCVIRWANTTGTHVRFIEPQSTLCAEPPDLQHCPVRDVPFREMTNHCLPLISPRSFPPSLQVARGGN
LALHCRALAEPEPEIYWVTPAGMRLTATQAGGRYRIYPEGTLEIREVTEEEAGLYTCVAQNLVGADTKSVSLAIGGSLPGSSGLERELELRVQEVHPYHILLRWEPLPNT
ISTNLTWSSSSSLRGPGTTALARLPGGTHSYNITRLLQATEYWVCLQVAFADAHTQVACIWARTKEASPQHGALGGHLGLLAALGLSALLLAAGLAVHWGPYPTRPSGRV
GGKPLLPSWAPWGRSTPSVRVVSPPFVKHWNPGREPTKLAEGEMVLPVILHDS*
306 >lcl|XP_001371277.1|Plus1complement(31281714..31283150) NW_001581970 D(1B) dopamine receptor DRD5 __SEG__ Chr5 {Monodelphis domestica} MLLPPRKNRTLYPPLLLLQLQLPPAGAWGSEGADGSSRELLGPAQIVTASLLSLLILWTLLGNVLVCVAIIRYRHLRSKMTNIFIVSLAISDLFVALLVMPWKAVAEVAG
YWPFGAFCNVWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTQRVALIMISAAWALSILISFIPVQLNWHKDQEGFPRNQSPPSSFINGTPWGEDSEELVAEGA
ENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRGNRMDCQHHNSLKTSIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCN
NPGDPKAGFPCVSETTFDIFVWFGWANSSLNPIIYAFNADFRKVFANLLGCSHFCAGTPVETVNISNELISYNQDTVFHKEIATAYVNMIPNVVDSVSGNDDGPFDRMSQ
ISQTSPNHDPATDSMCELDCEGEISLGKITPFTPNGLH*
307 >lcl|XP_001371278.2|Plus114029671..14030600 NW_001581971 olfactory receptor 4B1-like LOC100017853 __SEG__ Chr5 {Monodelphis domestica} MAITNNVTQLIFMGLFQDREAQRVSFIVFLPMYMATMLGNGLIILTVNTSKSLSSPMYFFLSHLSLVEICYSSTIVPKFISGLLTENKTISLDGCMTQIFFFHFFGVAEI
LLLTVMAYDRYVAICKPLHYMTIMNRPVCHMLVFSSWVGGMFHSVIQILSTVQLPFCGPHVIDHYFCDLHPLFKLACTDTFVEGIIVLANSGLFSVISFLFLISSYVVIL
VHLRNQSAEGRRKALSTCASHITVVLLFFGPAIFLYLRPSSTFTEDKLVSVFYTVVTPMLNPIIYTLRNAEVKNAMRRLWVKNVNLGGD*
308 >lcl|XP_001371283.1|Plus1complement(15324265..15325344) NW_001581995 type-1 angiotensin II receptor-like LOC100017858 __SEG__ Chr7 {Monodelphis domestica} MNLNSSTEETIKRIQDDCPKSGRHSYIFIMVPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASIFLLNLALADLCFLMTLPLWAAYTAMEYRWPFGNCLCKIASAGISF
NLYASVFLLTSLSIDRYLAIVHPMKSRLRRTMLMAKVTCIGIWLLAGLASLPVVIHRNVFFIENTNITVCAFYYKSHNSTLLVGLGLSKNILGFLIPFLVILTSYTLIWK
TLKKAYEIQRNRPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIKDCKIIDIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKFSSHSSL
TTKMSSLSYRTSDNLSLSAKKSVACFEVE*
309 >lcl|XP_001371419.1|Plus1156361622..156362599 NW_001581879 proto-oncogene Mas-like LOC100027937 __SEG__ Chr2 {Monodelphis domestica} MDEANLTSFVPEIPGNISINRNTSLGDVDRKIPIVHWVIMSISPLGFVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSVDYALDYELSSGYYYTIVTLSV
TFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKHQSACVCGLLWALSCLVTTMEHVMCIDIGRKGHSQSDCRAVIIFISILSFLVFTPLMVVSSVILVVKIRRNTWT
SHSSKLYIVIMVTIIIFLIFAMPMRLLYLLYYEYWSTFGNIHHISLLFSTINSSANPFIYFFVGSSKKKPFKESLKVVLNRAFKDEMQLRRQEDNPNAIAVETVV*
310 >lcl|XP_001371422.1|Plus1complement(6390948..6391916) NW_001581875 COP9 signalosome complex subunit 6-like LOC100018050 __SEG__ Chr2 {Monodelphis domestica} MASTAANGASGSSGMEVDAAVLPSVMASGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQV
FKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQH
SAIKMLHSRVKLILEYVKASEAGEVPFNHEILHEAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF*
311 >lcl|XP_001371429.2|Plus1complement(14141464..14142402) NW_001581971 olfactory receptor 4X2-like LOC100018060 __SEG__ Chr5 {Monodelphis domestica} MRPINNVTEFIFLGLSPKQEVQRVCFVVFLLMYVMIVLGNALIVLTIKASKSLGSPMYFFLSHLSFVEICYSSTTSPKLIVDLLSERKVISFEGCMTQLFFIHFFGGIEI
FLLTVMAYDRYVAICKPLHYMTIMSQQMCGLLLGIAWMGGFLHSIAQILLMFHLPFCGPNVIDHYFCDLLPLLELACTDTLFIGQLIVVNGGSLSVISFGVLMASYVIIL
LHLRGHSKEGCQKALSTCASHITVVVLFFGPCIFIYMRPSITLSMDKLVAVFYTVITPLLNPVIYSLRNAEVKTAMKKLWVRALKQSEKLSG*
312 >lcl|XP_001371448.2|Plus114168249..14169184 NW_001581971 olfactory receptor 4S2-like LOC100018093 __SEG__ Chr5 {Monodelphis domestica} MENNVTEFILTGLSQIEEVEQVCFYLFLLFYTIIIFGNFLIIMTIRVSPNLNSPMYFFLSFLSFVDICYSSVTAPKLIVDFQVKVKTISFVGCMTQLFVGHFFGCTEIFI
LTVMAYDRYVAICKPLHYATIMDQRVCTILMVSSWVGAFTHSIIQTLLTVRLPFCGPNMIDHFCCDVHPLLKLACTDTYVVGVIVMANTGMISLTCFIILVGSYAVILLY
LRTHSAEGRRKALSTCASHVIVVILFLVPCIFIYMRPSTTFTEDKMVAVFYTIITPMLNPLIYTLRNAEVKNSLKKLWSKKLMGEARKDLK*
313 >lcl|XP_001371472.2|Plus114182239..14183162 NW_001581971 olfactory receptor 4X2-like LOC100018133 __SEG__ Chr5 {Monodelphis domestica} MMQSGNVTEFIFLGLSPNPEIQRVCFVIFLFLYVAIILGNSLIVLTVSFSKSLGSPMYFFLSHLSFVEICYSSTTSPKLIVDLLSERKSISLEGCITQTFFFHVFGAIEM
FLLTIMAYDRYLAIYRPLHYVTIMNRRICAILVGMAWLGGFLHSIAQIVFVFHLPFCGPNVIDHYFCDVLPLLELACTDTFFIGLLIVANGGSLSMVSFIILLISYSVIL
FHLRGHSKLGRRKALSTCASHIIVVILFFGPCAIIYLRPSTTNSMDKMVAIFYTVMTPLLNPFIYSLRNVEMKDSMRKLWFRAMNQE*
314 >lcl|XP_001371476.1|Plus1complement(2745778..2746605) NW_001587048 progestin and adipoQ receptor family member 4-like LOC100018138 __SEG__ ChrX {Monodelphis domestica} MARRSGPRLLDWINTPSHLQFNPFILTGYRPASSVSGCVRSLFYLHNELGNIYIHVLALLTFLVMLPLTIPWDQLGWGHWLGCTHFLACLAPPAGSILYHLFMCHRGGNR
VYSHLLALDMCGVWLANSLGAIPMIQCTLLCWPCLRLFALVMYAFLSVMAGWWALTALSTTARLQAFGWQAIARLLVFGIRWLGLGTGAPRSLLCYLRMDALALLGGLVN
VARLPERWGPGIFDYWCNSHQIMHFLSVISILQMHAGVIPDLVWAASHDYACPDD*
315 >lcl|XP_001371516.2|Plus1complement(7945800..7946762) NW_001581928 olfactory receptor 52I1-like LOC100018200 __SEG__ Chr4 {Monodelphis domestica} MLELTSNYTSPSITFFLIGIPGLEVTHLWLLVPLSTMYIVALVGNSLILTVIWVDSALHEPMYYFLCILALVDIVMATSVVPKMLNIFWSGDGIIGFAACFTQMYVVHAA
TAVETGLLLAMAFDRYVAICKPLHYQTILTQQTMLGISVAIILRATTFMTPLSWMVSHLPFCGSLMVPHSYCEHMAVAKLGCADHMPSDLYSLIGSSIIVGIDVIFIATC
YSRILQAVFRLSCRDAQLKALSTCGSHVGVMALYYLPGMVSIYVAWFGQDLVPLPVQVLLADFYLVIPPTLNPLIYGLRTKQIRGRGWSILKSCLPDQAN*
316 >lcl|XP_001371522.2|Plus114212109..14213047 NW_001581971 olfactory receptor 4X2-like LOC100018206 __SEG__ Chr5 {Monodelphis domestica} MVQSGNVTEFIFLGLSPNPEIQRVCFVLFLFLYMAIILGNSLIVLTVSFSKSLGSPMYFFLSHLSFVEICYSSTTSPKLIVDLLSERKSISLEGCITQTFFFHVFGAIEM
FLLTIMAYDRYLAIYRPLHYVTIMNRRICAILVGMAWLGGFLHSIAQIVFVFHLPFCGPNVIDHYFCDVLPLLELACTDTFFIGLLIVANGGSLSMVSFIILLISYSVIL
FHLRGHSKEERRKALSTCASHVIVVILFFGPCAIIYLRPSTTNSMDKMVAIFYTVITPLLNPFIYSLRNAEVKNSMRKLWFRAMNQGETGRG*
317 >lcl|XP_001371542.2|Plus17981873..7982907 NW_001581928 olfactory receptor 52I1-like LOC100018240 __SEG__ Chr4 {Monodelphis domestica} MLDLLSNHTSLLPATFFLMGVPGLEEAHLWLAALLSTMYTVILMGNSLIMTVVCVDPVLHEPMYYFLCVLAGVDIIMATSVAPKMLSVFWSGNGTIGFTACFTQMYIVHT
ATAMESGLLLAMAFDRYVAICKPLHYNTILTPQKILGINAAIVLRAAIALIPLSWMVSSLPYCGSHMIPHSYCEHMAVAKLACADYMPSSLYSLIGSSVVVGIDVTFITA
SYILILQAVFSLSSQKARHKALSTCGSHVGVMALYYLPGLISVYVDWIGKDMVPMHTQVLLADLYLVIPPTLNPIIYGLRTKRIWDRLRNPLVTSFPGHHFVNPQKDSRS
KQVFVMGNRSTEGV*
318 >lcl|XP_001371566.2|Plus18015160..8016197 NW_001581928 olfactory receptor 52I1-like LOC100018273 __SEG__ Chr4 {Monodelphis domestica} MVQLHSNHTSLPPATFFLMGIPGLEETHLWLAFLLSTMYTMVLVGNGLIMTVIWVDPALHEPMYYFLCVLAGVDIIMATSVTPKMLSVFWSGNGNIGFSACFTQMYIVHT
ATALESGLLLAMAFDRYVAICKPLHYNTILTPQKILVINVAIVVRATIALTPLSWMVSRLPYCGSLAVPHSYCEHNAVANLACADHTPSNLYALIGSSVVVGIDVTFITA
SYSLILRAVFHLSSKNARNKALSTCGSHVGVMALFYLPGLISVYVDWWGQNMVPVHVQVLLADLYLVIPPTLNPLIYGLRSKKIWQGVWNTMTTNLPCHHYVNSKKERGP
KQVFVMGDIRSACEV*
319 >lcl|XP_001371613.2|Plus1complement(8044335..8045300) NW_001581928 olfactory receptor 51G2-like LOC100018351 __SEG__ Chr4 {Monodelphis domestica} MDSSIFSCNASSHDHPTFLLTGFPGLEASHHWVSIPINLICLISILGNSTILFLIRTDPSLHEPMFIFLSMLVASDLGLCASTFPTMVQLFWLGARELPIDLCAAQMFFI
HAFTYVESGVLLAMAFDRFVAIKDPLHYSSVLTHSTMAKIGAGVLVRAVMLNVPGPVLLRRLDFPPVSVLSHCYCLHCDLVGLACSDTKINSFFGLVSILLSLGIDSTLI
VVSYVLILRTVLGIASPEERFKALNTCVSHLCIVLIFYMPKLGLSILHRVEKHTYPALAVLMANLHFLVPPFMNPIIYCIKSKQIRQGLLRRFWQKRVETS*
320 >lcl|XP_001371639.2|Plus18064391..8065440 NW_001581928 olfactory receptor 52I1-like LOC100018390 __SEG__ Chr4 {Monodelphis domestica} MLGSLSNDTLLNTATFILLGVPGLEVAHLWLAVPLSAMYCIALLGNIIIVTVIWTDNALHEPMYYFLCILAAVDIVMSTSVMPKMLNIFWSDNGIIGFAACFIQMYIVHA
TTAIETGLLLAMAFDRYVAICKPLPYQTILTSRTMIGMGMGIIARAITAMTPMTWMVVHLPYCASHKIPHSYCEHMAVAKLACADHMPSSLYSLIISFLIVGTDVTFIAT
SYSLILWTVFSLPSRDARVKALSTCGSHVSVMVLFYLPGILSIYMAWLGQDMVPLHTQVLLADFYLVIPPMLNPLIYGLKTKRIRERVWNAVATSLPGHACQNSSKEKRP
IRVFVMEHSESTWEAQTQK*
321 >lcl|XP_001371780.2|Plus117834425..17835549 NW_001581859 neuropeptide Y receptor type 4-like LOC100018646 __SEG__ Chr1 {Monodelphis domestica} MNSTNFFNLLPILPQGQNRSWRKGLLLNFSDHCQNSIDLNSFLVTAYSLETFIGILGNLCLVGVVVRQREKANVTNILIANLAFSDFIMSLFCQPFTLIYTIMDYWIFGD
AMCKLSAFIQCMSVTVSVLSLVLIALERHHMITNPLGYMPNMIQAYLGIVITWLIACFLAMPFMANSILRNVFQKNQSEAMNFLADKAVCTESWPTTQHKSIYTILLLFL
QYVAPLTFIIVCYLRIHRQLKRRRDLFKKNEFSLGVTQMKRINSVLLSMVAAFAICWLPLHVFNALEDWYHEAIPICYGNLIFLVCHLIAMASTCINPIIYGFLNSNFKK
EMKSLFLVCQNKPSKEIYEQLPLSTVQSEISKESLKLSSEPNSL*
322 >lcl|XP_001371801.1|Plus1complement(2086511..2086927) NW_001581873 cornifin-A-like LOC100018686 __SEG__ Chr2 {Monodelphis domestica} MSSHQQKQPNIIPPQLQQHQVKQPCQPPPQEPCDPKGPQPGTTKLPQPNYPKVPEPGTTKLPEPCHPIVPEPGTTKLPEPCQPTVPGQHPTKKPEPYYPVVSVPTQPKIP
EPGTTKVPGSYPPPAQEKYPQVPNTKQK*
323 >lcl|XP_001371805.2|Plus18231644..8232588 NW_001581928 olfactory receptor 51D1-like LOC100018690 __SEG__ Chr4 {Monodelphis domestica} MMKLNDTLIHPAAFLLVGIPGLGSNTHFWMAFPLCFMYAMATLGNLIIVLIIRADQTLHEPMYLFLAMLSTIDMILSSVTMPKMASLFFTGNQEIEFNLCLTQMFLIHAL
SAMESAVLLAMAFDRFVAICHPLRHASVLTAPVVGKIGLAALARGFVFFFPLPFILKRLSYCHSNTVTHSFCLHQDIMKLSCTDTTVNVVYGLFIILSVMGVDSLFIGFS
YILILQAVLGLSSRGAAFKAFNTCISHLCAVLVFYVPLIGLSVVHRLGGPTSLLHVVMANVYLLLPPVVNPIVYGAKTKQIRVRILHMFQHEAG*
324 >lcl|XP_001371823.2|Plus18247740..8248690 NW_001581928 olfactory receptor 51E1-like LOC100018719 __SEG__ Chr4 {Monodelphis domestica} MLPKGNHSSATYFILIGIPGMEAAQFWLAFPLCFLYLIAVLGNLTIIYIIRTERSLHEPMYFFLGMLSTIDILISTSSMPKMLAIFWFNATTIQFDACLVQMFAIHSLSG
MESTVLLAMAFDRYVAICHPLRHAAVFTSPRIAKIGLAAVIRGAALMAPLPIFIKQHPFCRSNILSHSYCLHQDVMKLACADIRVNVIYGLIVIISAIGLDSVLISLSYL
FILKTVLGLTQEAQTKAFSTCVSHVCAVFIFFVPFIGLSMVHRFGKRPGSNLHIIMANVYLIVPPVLNPIVYGVKTKQIRQRIVQLFRSVSGTSDL*
325 >lcl|XP_001371846.2|Plus1complement(8255553..8256515) NW_001581928 olfactory receptor 51I2-like LOC100018754 __SEG__ Chr4 {Monodelphis domestica} MSLLHSHDNNSFFQPSAFLLIGVPGLEAVHGWVSIPFSSMYTVALTGNCLILLAVRRTPSLHQPMYYFLSMLALTDLGLTMSTLPTTLAVLWFDYRRIAFDACLTQMFFL
HSFSVVESSVLLAMSFDRFVAISNPLRYASVLTNSVIVRIGMAIVARATVSLFPVPFLLKRLNFCPRKILLSHSFCFHADVMKRACADITVNILYGLYVVLSTVGIDSLL
IVLSYGLILHTVMGLASPRERIRALNTCVSHILAVLVFYIPVIGVSMIHRFGRHAPPIVHALVAYVYLVVPPVLNPIIYSVKSKHIREALFKILRRKDQG*
326 >lcl|XP_001371874.2|Plus115136312..15137265 NW_001581971 olfactory receptor 4C46-like LOC100018795 __SEG__ Chr5 {Monodelphis domestica} MIILTTNKYMENKRNVTEFILFGLTQDPSLEKIVFVMFFAIYIITLVGNMLIVITIICSQTLGSPMYFFLAFLSFIDACYSSVTAPKIIINSVSMRKTISYEGCMTQLFS
EHLFGGSEIILLTVMAYDRYVAICKPLHYMTIMSRRMCILLVMVAWAGGFLHALIQLLFTFKLPFCGPNVVDHFMCDLYPLLKLACTDTRVLALLVAANSGVICMLNFLM
LLVSYVVILLSLKSHSAEGRRKALSTCGSHITVVILFFVPCIFMYMRPLTFFPIDKTVAVFYTLITPMLNPLIYTLRNKEVKNAMRKLWKRKVTSDS*
327 >lcl|XP_001371913.1|Plus129429474..29430451 NW_001581902 melanocortin receptor 5-like LOC100018855 __SEG__ Chr3 {Monodelphis domestica} MNSSIFLHTLDLNLSSLGGNMSGPMIKSKSSPCEQVGIAVEVFLTLGIVSLLENILVIGAIVKNKNLHSPMYFFVCNLAVADMLVSVSNAWETITIYLINNKHLVMEDAF
VRHIDNVFDSMICISVVASMCSLLAIAVDRYVTIFYALRYHNIMTVKRSGIIIACIWTFCTGCGIIFILYYESTYVIICLITMFFTMLFLMVSLYIHMFLLARTHVKRIA
ALSGYSSVRQRISMKGAITLTMLLGVFIVCWAPFFLHLILMISCPQNLYCICFMSHFNMYLILIMCNSVIDPLIYAFRSQEMRKTFKEIICCYGLRMTCGFPIKY*
328 >lcl|XP_001371936.1|Plus1complement(29537815..29538768) NW_001581902 adrenocorticotropic hormone receptor-like LOC100018891 __SEG__ Chr3 {Monodelphis domestica} MRTERASELIKILGHNGNPPENITDNATNNTDCIQVVVPEEVFFAISIIGVLENLLVLLAVIKNRNLHSPMYFFICSLAVSDMLGSLYKILENILIIFRNTGYLKPRGDF
ETTADDVVDSLFILSLLGSIFSLSVIAADRYITIFHALQYHNIMTMRRAISILAIIWAFCTGSGITMVIFSHDVPTVISFTSLFPLMLIFILCLYVHMFLLARSHAKKII
SLPSSRVQPRANMKGAITLTILLGVFLCCWAPFVLHILLVTFCPNNPYCACYLSIFQVNGMLIMCNAIIDPMIYAFRSPELRSTFKKMFCCSGYKWN*
329 >lcl|XP_001371937.2|Plus1complement(8341891..8343000) NW_001581928 olfactory receptor 51G2-like LOC100018892 __SEG__ Chr4 {Monodelphis domestica} MTSNHTTSQLPAFLLLGIPWREDIHKWLSIPFFFLYLAAALGNGAILVAVARNPSLREPMHCFLSMLAVTDLALSGTTLPTTLGLLWFGISQVAFDVCLAQMFFIHVASV
AESSVLLAMAVDRWAAIACPLRYSALLTHRVVAKVGLAVLVRSALTLLPLPFLLLRLTYNEQRRLTHSFCFHPDIMKLARNETEVNVHYGLFVILSTAGIDSILIILSYM
PIAKVILGLGSWEERVRAARTCVSHVAAVLVFFVPMIGLSVMHRFGSHGPLPLALVAYTYLLVPPALNPVIYSIKFQCIWKTLLRLCFYQPRAPRWAASPPPTHAGHKSL
PIACSKRYSVQIIQMESSQLENSQSDERGIRLVFGDDQV*
330 >lcl|XP_001371940.2|Plus1complement(15179074..15180003) NW_001581971 olfactory receptor 4C12-like LOC100018896 __SEG__ Chr5 {Monodelphis domestica} MKSINNVTEFILLGLTQKPEMQKIIFVVFLFIYLATLGGNLLIIITITCSQALGSPMYYFLSYLSFLDGCCSSSLAPKMIIDSLFEKKTISFNGCMTQLFAEHFFGGAVI
ILLTVMAYDRYVAICKPLHYTLIMSQKLCSLLVGIAWAGGFLHATIQLIITIWLPFCGPNIIDHFMCDLFPLLNLACMDTYALGFFVAANSGLICLLNFLLLIASYVVIL
TSLKSHSQKGRLKALSTCVSHITVVLLFFIPCIFVYLRPMVIFPIDKAIAVFYSMITPMLNPLIYTLRNKEVKVAMRNLWSHRIVSCKK*
331 >lcl|XP_001371958.2|Plus115203626..15204555 NW_001581971 olfactory receptor 4C12-like LOC100018929 __SEG__ Chr5 {Monodelphis domestica} MENGRNVTEFILLGLTQNLKMQKIIFALFLVLYMITMAGNLLIVVTITNSEALSSPMYFFLAHLSFIDTIYSSSSAPKLIMDSLQEKKTISFNWCMTQVYAEHIFGATEI
ILLTVMAYDRYVAICKPLHYTTIMNRKLCGILVGVAWTGGFLHATIQILFTIWLPFCGPNIIDHFMCDLYPLLNLVCMDTHKLGLFVAANSGFICLLNFLLLMVSYVVIL
RSLKNHSLEGRRKALSTCVSHITVVILFFLPCIFVYLRPVTTLPIDKAVAVFYTMVAPMLNPLIYTLRNTEVKNAMRKLWKKKVNLGDK*
332 >lcl|XP_001371975.2|Plus1complement(15210691..15211620) NW_001581971 olfactory receptor 4C46-like LOC100018962 __SEG__ Chr5 {Monodelphis domestica} MDNGKNVTEFILLGLTENPKMQKIVFVVFFIIYVITMVGNILIVITINLSPTLGSPMYFFLAYLSFIDACYSSVNTPKLIIDSLYEKKTIFFNGCMTQVFGEHFFGGAEG
ILLTVMAYDRYVAICKPLHYMTIMNWRVRGILVGVVWIGGLLHATIQMLFLSQLPFCGPNVIDHFMCDLNPLLTLACTDTHTLGLFVAANSGFICLLNFLMLMVSYVVIL
CSLKTHSVEGRRKALSTCGSHITVVVLFFVPCIFVYMRPAATFPIDKAIAVFYTIITPMLNPLIYTLRNAQMKNAIRKLCSQNDAVVSY*
333 >lcl|XP_001372003.1|Plus1complement(5112850..5114694) NW_001581881 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4-like LOC100019018 __SEG__ Chr2 {Monodelphis domestica} MRGLESPSKRKRITYSRSKEGMVIDIISRWASASWPPLFFLLLLAGRSGRGCPAACDCDSQPQAVICASRLLEAVPGGIPPDTELLDLSRNRLWGLQRGMLSRLGPLLEL
DLSHNQLSTLEPGAFQGLRNLLTLRLRGNRLRIVAPGVFSGLTSLTLLDLSLNQIVLFLDGAFGGLSSLQQLEVGDNHLVFVAPGAFVGLAKLSILTLERCNLSTVPGPA
LARLPGLIGLRLRELDIGRLPTGALRGLGQLRELEIHQWPSLRALEPGSLAGLNLSSLAITYCNLSSVPFQALSHLSFLRVLDLSQNPISNIPARKLSFLVRLQELHLAG
AHLASIAAHAFHGLAAFCLLDVANNALQTLEEAAFPSPSSLVTLRLAGNPLICDCRLLWLLRLRHHLDFGKSPPACASPLHVRGKNLRDFSDILPPGHFTCRAALIQRSG
PRRVSAEEGQQAVFSCSGDGDPAPTVSWQGPQGTWLGRTGRVRVLEDGTLEIRAIQLGDGGAYVCVLSNVAGNDSLSTWLEVIRIEPPNGTLTDTNGTTLGTPGPFFLDS
RGLVVVLAVGFLPFLTSVTLCFGLIALWSKSKGRVKHHTTFDFVLPRSSGEGGAGGNRVTAKLF*
334 >lcl|XP_001372006.2|Plus1complement(8439962..8440924) NW_001581928 olfactory receptor 51E2-like LOC100019021 __SEG__ Chr4 {Monodelphis domestica} MNPCNFTHTTFILIGLPGLEAAQFWIAFPLLSMYVIAVLGNCTVVFIVRTEHSLHAPMYLFLCMLAAIDLALSTFTMPKILALFWFNSQEIAFDLCLTQMFFIHALSAIE
STILLAMAFDRYVAICHPLRHGAVLTNTFTARIGMVAVVRGSLFFLPLPLLIKRLHFCGSNTLTHSYCVHQDMMKLAYADTMPNVVYGLTAILLVMGVDVVLISLSYFLI
IRTVLRLPSRAERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLNPIVHVLMGNVYLMLPPVINPLIYAAKTKQIRSRVLAMFKIICGKEVQVVSNS*
335 >lcl|XP_001372010.2|Plus1complement(15238260..15239189) NW_001581971 olfactory receptor 4C46-like LOC100019025 __SEG__ Chr5 {Monodelphis domestica} MDNRNNVTEFILLGLTDNPKMQKIVFVVFLIMYAITMVGNTLIVITIIIDPSMDSPMYFFLAYLSFIDACYSSVNTPKLIIDSFYEKKTIFFNGCMAQVFGEHFFGGAEV
ILLTVMAYDRYVEICKPLHYMTIMNWKVRAILMVVVWLGGLLHATIQILFLIQLPFCGPNVIDHFMCDLNPLLNLACTDTHILGLFVAANSGFICLLNFLLLMGSYVVIL
SSLKTHSVEGRRKALSTCGSHITVVVLFFVPCIFVYMRPATTFPFDKAVVVFYTMITPMLNPLIYTLRNAQMKNAIRKLFSKKETLLNQ*
336 >lcl|XP_001372026.2|Plus1complement(8486038..8486991) NW_001581928 olfactory receptor 51F2-like LOC100019050 __SEG__ Chr4 {Monodelphis domestica} MSAFLKNTSSPSLTFFLTGVPGLEAAHAWISIPFCCLYITALSGNGMILFVIITEPSLHEPMYYFLSMLSSTDLGLCTSTLFTVLGIFWFNAREISFNACLAQMFFIHLF
TFMESSVLLAMAFDRFVAISNPLRYATILTHSRITQIGVAIVTRGVVILIPLVLLLKRLSFCHSHVLHHSYCFHPDVMKLSCSDTKVNSAFGLIAIISSAGIDSVFILLS
YILIIRSILSIASPEERKKAFSTCISHVTAVAIFYIPLISLSFVHRFGKKAPPYVPTLIANIYLLIPPVMNPIIYSVKTKQIRKAVLKVLRPKGALI*
337 >lcl|XP_001372029.2|Plus1complement(239462..240652) NW_001581974 mas-related G-protein coupled receptor member D-like LOC100019055 __SEG__ Chr5 {Monodelphis domestica} MGITTRERAPRDGNHSSCPATLPQLPRVGRPDAPNKGGLEDGMAEREKPGGVRASPRAHNLFISVSFSGPETSLGSTVIPEATTMATAIATNSSGDREASHESLVILTLA
ISLFGLLGNGVLVWLLCFCVKSSPFSVYSCNLAVANFLLLFSMALLFILERPELALRPKSVSRVFQSVRYLAYMLGLSLLTAVSAQRCLALVFPAWYRRHQPKRLSARVC
AGLWALATLQTVLATSFCVQSATQASCRRVFWLSLLSVFGVFTPVMCVSSVTLFIKVQRACPPHQPLTPYIIPVVTQVLVYVACALPLGLSWFFLHPSLQDGEEKRVFYD
VVRLFSCVSSTINPFLYFLGGSQEAETLPAASGTASKGPGERGETLGPGGESGAQRTVGQLSGGAA*
338 >lcl|XP_001372052.2|Plus1complement(8494456..8495352) NW_001581928 olfactory receptor 51F2-like LOC100019084 __SEG__ Chr4 {Monodelphis domestica} MVVPRLEASHTWISIPFFCLYITALSRNGMILFVIITEPSLHEPMYYFLSMLSTTDLGLCISTLVTMLRIFWFNAREISFNACMVQMFFIHLFTIMESSVLLAMAFDRFV
AISNPLRYTTILTNARITQIVVAIVSIAIVILIPLILLLRCLSFYHSHVLQHSYCFHPNVMKLLCSDTKINSAFGLTATILVAGVDSTLILLSYVLIIRSILNIASPEEC
KKAFSSCISHMTAVAIFYIPLTSLSFVHRFKKKSPTYLPTLISNISLFIPPVMNPNIYSVETKEICKALLKNFCPKRF*
339 >lcl|XP_001372067.2|Plus1complement(5168555..5169580) NW_001581881 c2 calcium-dependent domain-containing protein 4D-like LOC100019107 __SEG__ Chr2 {Monodelphis domestica} MWLLEKAGYKGGSEEPGTPWRPHILFSKRKPPRTSPSACPNVLTPDRIPQFFIPPRLPGMGCPEPGTERETGWTRGQELQAACSLPHLTGREGWAFLLESPHTRRRESLF
HMAPTASGSEGPPLKPRKHLSSPDLRLCLALESDMAPSPDSSPFSSPQPGSPRSHLGLPSMHLSSPGSLSPEEESSTDASPHHLGPPTPPLFHLDFLCCQLQVTKESLVS
LGPRGGQLRLSAEYQAGLGQLRLRLISAEELPRGRGGAKGSSGCCVVFRLRPGSWPQAHRSRLVKCSSNPIFNEDFFFEGLKPSDLTTHTLKAKVLDKGTGLRRDVLLGE
CEAPLVTLLPT*
340 >lcl|XP_001372073.1|Plus1complement(276502..277404) NW_001581974 mas-related G-protein coupled receptor member H-like LOC100019115 __SEG__ Chr5 {Monodelphis domestica} MAFFNLTICLCGLLGNGIVLWFLAFHIKRSHFTIYILNLTIADFSFLLGRVVWNVTKILYGYSSTLLTKCEMFYICHGTLVFNIFVYNTGLGFLTAISVERCLCMLYPLW
YRYHHLKKKSPSICAFLWLLSVFMAVLEFFFEVYMGDEHPRGRSIISVFSCLLNFLVFTPLMVLSCLVLFLKSWRRSQHHHPAKLHVTILVTILVFLLFGLPQKVWFVVH
FGFQVDTSLTVSSIFELLSSINSSANPGIYVFVGNLWRKNKRSLKLTLSRAFKEDFQGREDGVTLPTTSSETMRRQDQQK*
341 >lcl|XP_001372096.2|Plus1complement(8527475..8528422) NW_001581928 olfactory receptor 51F2-like LOC100019150 __SEG__ Chr4 {Monodelphis domestica} MSTFHNSTSLSSLTFILTGVPGLEASHTWISIPFFCLYITALSGNGMILFVIITEPSLHEPMYYFLSMLSTTDLGLCISTLVTMLRIFWFNAREISFNACMAQMFFIHLF
TIMESSVLLAMAFDRFVAISNPLRYTTILTNARITQIVVAIVSIAIVILIPLILLLRRLSFCHSHVLQHSYCFHPDVMKLSCSDTKINSAFGLTATILVAGVDSTLILLS
YVLIIRSILNIASPEERKKTFSTCISHMTAVAIFYIPLTSLSFVHRFGKKAPTYLPTLISNISLLIPPVMNPIVYSVKTKEIRKALLKNFCPKIF*
342 >lcl|XP_001372118.2|Plus1complement(8567834..8568772) NW_001581928 olfactory receptor 51F1-like LOC100019182 __SEG__ Chr4 {Monodelphis domestica} METPSNLTSPFSTFHLTGIPGIEEAHAWISIPFCCLYTIALLGNSMILFVIITEQSLHEPMYFFLSMLSATDLGLTVSTMSTTLSVLWFDARDITIDGCIVQMFFLHGFT
FMESGVLVAMAFDRFVAICDPLRYTTILTNARITQLGVTMVIRMIVLMLPLLLLFKKLSFCGPNGLSHSYCYHPDVIKLSCSDTKVNSICGLAALILSTGIDTPCIVLSY
ILIIRSVLSIASPTEQKKAFSTCGSHIGAVAIFYIPMISLSLTHRYGQMAPKIVHTMMANIYLMLPPVLNPIIYSVKTTQLRKVMGKLLLAK*
343 >lcl|XP_001372132.1|Plus126007862..26009466 NW_001581842 Pyruvate dehydrogenase [acetyl-transferring]-phosphatase 2-like LOC100019207 __SEG__ Chr1 {Monodelphis domestica} MSSTMSCRILNSARNSISALRGKRHLYSRLVQNENKLKWKDFSKRLFRPVAVDCRPHNHGFFQQKAFRHTSTEEDDFHLQLTPDQISVLLRAGELSHKVLEFEGKFLNPV
LKFESNQLAANSPVEDRRSIASCLQTKGMMFGVFDGHGGHACAQAVSERLFYYVAVSLMSHKTLEMMEDAMECMKPLLPILQWYKHPGDSIYKEVTSLHFDHLRVYWQEM
LDLHMEMGLSIKEALTHSFQRLDSDISLEIQAPLEDEILRNLSLQVAFSGTTACMAHVDGIHLHVANAGDCRAILGIQEENGTWSCLPLTQDHNAWNKAEILRIKKEHPK
SEERTIIVEDRLLGVLMPCRAFGDVQLKWSKELQQSVLQRGFDTEALNIYRFTPPNYYTPPYLTAKPEITYHKLRPQDKFLVIATDGLWDLLGNEDVVRLVVEHLEEASR
QKPELDKKPANLGLMQNLLRQRKAKGIHAPDQNAATHLIRHAIGCNEYGEMEQEKLAAMLTLPDDLARMYRDDITVTVVYFNSDSIDMFYKESQ*
344 >lcl|XP_001372138.2|Plus1complement(8582683..8583621) NW_001581928 olfactory receptor 51F1-like LOC100019213 __SEG__ Chr4 {Monodelphis domestica} METPSNLTSPFSTFHLTGIPGIEEAHAWISIPFCCLYTIALLGNSMILFVIITEQSLHEPMYFFLSMLSATDLGLTVSTMSTTLSVLWFDARDITIDGCIVQMFFLHGFT
FMESGVLVAMAFDRFVAICDPLRYTTILTNARITQLGVTMVIRMIVLMLPLLLLFKKLSFCGPNGLSHSYCYHPDVIKLSCSDTKVNSICGLAALILSTGIDTPCIVLSY
ILIIRSVLSIASPTEQKKAFSTCGSHIGAVAIFYIPSISLSLTHRYGQMAPKIVHTMMANIYLMLPPVLNPIIYSVKTTQLRKVMGKLLLAK*
345 >lcl|XP_001372170.1|Plus1181396338..181397501 NW_001581879 probable G-protein coupled receptor 88-like LOC100029612 __SEG__ Chr2 {Monodelphis domestica} MTNSSSTSTTTSSAEGSLLLLCEEEGSWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPNASPEPPGGWDGAG
GSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPVTYQVLYQRRHTAGMLALSWALALGLVLLLPPWAAPPGRVPPEVHYPALLAALALLVQTALLLHCYLGIVRRV
RVSVKRVSVLNFHLLHQLPGCAAAAAAFPSAPGPPHPHPVPQAAAAAAQPLPPTLHPRRAQRRLNGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGLQAASWLLCCS
LSALNPLLYTWKNEEFRRSVRSVLPGIGDAAAAAAAATAVPAVSQAQLGTRAAGQHW*
346 >lcl|XP_001372177.2|Plus18635108..8636064 NW_001581928 olfactory receptor 51F1-like LOC100019272 __SEG__ Chr4 {Monodelphis domestica} MVTLNNLTSPFPTFYLIGIPGLEGSHVWISIPFCCLYAIGLSGNSMILFVIFTEQSLHEPMYYFLSMLSATDLGLIISTMSTTLTVLWFDLREISLDGCIVQMFFLHGFT
VIETGVLVAMAFDRFVAICDPLRYNTILTNAKILQIGLVIFMRMIVLLVPTLLLLKRLSFCKMNVLSHSYCYHPDVLKLACSNTKPNSFWGLTGLVLTSGIDTPCIIISY
ILIIHSVLSIASPTEQYKTFSTCVSHIGAVAIFYIPLISLSLVHRFGQSAPKIVPTMMANIYLILPPVLNPVIYSLKTAQLRGALIKLLLAKRIPMLG*
347 >lcl|XP_001372182.2|Plus1complement(15372175..15373098) NW_001581971 olfactory receptor 4C11-like LOC100019278 __SEG__ Chr5 {Monodelphis domestica} MRNNVTEFILLGLTQDPEKQKIVFFIFLVFYTATVLGNLLIVVTIKTSSTLGSPMYFFLSYLSIADSCFSTTTAPKLILDNLSHKNTISFDECMTQIFAFHFFGCMEILV
LVLMAYDRYVAICKPLHYSVIMNRRVCGILILLAWVGSFLHSIAQIILIFNVPFCGPNVIDNFFCDVQPLLRLGCMDTHVLNLLVVSNSGVICSVGFVLLMISYTIILYS
LKNHSAEGKWKALSTCSSHIIVVIIFFGPCIFIYTRPQTSFPLDKLVSVFYTIITPFLNPLIYTLRNAEVKNSMKKLWNKNVPSHHK*
348 >lcl|XP_001372184.1|Plus1complement(22335464..22337179) NW_001581994 frizzled-7 FZD7 __SEG__ Chr7 {Monodelphis domestica} MLGLGTAVPSASLGLCALVGAALLGLLPAGSGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPV
CTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDSAGGAGGGPTAYPTAPYLPDLPFTAHPQVPGRLSFPFSCPRQLKVPPYLGYR
FLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDEGYRTVAQGTKK
EGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAG
FVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKT
LQSWRRFYHRLSHSSKGETAV*
349 >lcl|XP_001372197.2|Plus1complement(8644454..8645398) NW_001581928 olfactory receptor 51F2-like LOC100019301 __SEG__ Chr4 {Monodelphis domestica} MPSLSNITSPIFLLTGIPGLEVFHIWFSIPYFCLCSVALLGNFMIMYVVITEQSLHEPMYYFLSMLSATDVGITVSSLPTTLGVLWFNIREISLDGCIVQLFFLHGFTLM
ESSVLLAMAFDRFVAICEPLRYTTILTNSRIVKAALGIFIRMLINLMPLLLLVKRLSFCGTNSLSHSYCYHPDVIKQSCSSTKINSIVGLLALILTSGIDIPCIILSYVL
IIKSLLSIASPEERHKAFSTCISHIGAVAIFYIPWIILALMHRFGHNAPPYIHVLLSNIHFLLPPVLNPIIYSVKTKQIYRVILKVFQANASRV*
350 >lcl|XP_001372202.1|Plus11221766..1222722 NW_001582000 p2Y purinoceptor 2-like LOC100019307 __SEG__ Chr7 {Monodelphis domestica} MADGAGLEANESLGEERCNIAEDYKRVYLPVTYSVVFVLGLPLNALVLWLSWCRTKRWTCSTIYLSNLMVADLLYIASLPFLIINYSLADQWPFGELLCRLVRFLFYTNL
YGSVLLLTCISVHRFLGVCYPIRSLAYRTRRLARIGSAATWALVVLQVLPTLVFSETGSSDGQTVCYDLSSPENFGRFFVYGMVLTFSGFAVPSLVILLCYSLMVKSLAR
REEAGAGVGTAARAKSIRTILLVCGLFTLCFGPFHVTRSVYFFIRLQAVQNCPLLTAVSAAYKVWRPLVSLNSCLNPVLFFLSGGSNRLRLVQELRPN*
351 >lcl|XP_001372258.1|Plus1complement(29395330..29396316) NW_001581835 psychosine receptor-like LOC100019392 __SEG__ Chr1 {Monodelphis domestica} MNETECIEEQHYVDHYLFPIIYIFVMVISIPANVGSLCVSFLQVKKKNELGVYLFGLSLSDLLYSSMLPLWIHYTWNEDNWKFSPNLCKVSAFLMYVNFYSSSAFLSCIS
FDRYLAVVYPLKFPYLRTRRIALSISLSIWVLETVFNATIIWKDETFVEHCNTNKSYILCFDKYPLETWKIHFNIFRTCTGYMIPLVIIIFCNQKVYQAVKHNQATENRE
KKRIIRLLLSITLTFFFCFTPFHALLMILSLGKHSSYIGKQIFKLYRITVALTSLNCVADPILYCFVSETGRSDIWSMLKLCHLSSKSQRKMTASMSTKYSMNLDIVE*
352 >lcl|XP_001372267.2|Plus1complement(8698638..8699582) NW_001581928 olfactory receptor 51F2-like LOC100019401 __SEG__ Chr4 {Monodelphis domestica} MSTLNSSTLQPLTFLLTGIPGMSATQVWISIPFCILYAIALTGNSMILFVVIHERSLHEPMYYFLSMLSATDLGLSLCTLSTTLGVLWFDAREITLDACMAQMFFLHSFT
FMESGVLLAMAFDRFIAICDPLRYATILTKTRIIQIGLAVGVRVIAVITPMVLLVKRLSFCQRKVLSHSYCYHIDFIKLSCTDNRINSIMGLFVLFSTSGIDCPCILISY
VLIIHSVLSIASPEERKKAFNTCISHISAVAIFFIPLISLSLVHRYSHNAPPFVHTMMANIFLLVPPVLNPIIYSVKTKQIRRAIIKVVHRLAA*
353 >lcl|XP_001372276.1|Plus122150365..22151495 NW_001581995 progestin and adipoQ receptor family member 9-like LOC100019416 __SEG__ Chr7 {Monodelphis domestica} MPLRLQPRGAGTKNPSAASSSSSAPALTAASPSPTLPGPKPLLRWDEVPDDFVECFILSGYRRLPCTAQECVASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGRDD
LPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRATFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDASVMTPYVQQRLGWHVDCTRLIAAYRALVLPVAFVLA
VACTVACCKSRSDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQMHYVEE
GLRQFLEAPPASPTFSGTVGYMILLVLCLGLVIRKFLNVADLCKED*
354 >lcl|XP_001372288.2|Plus1complement(8127484..8128428) NW_001581876 olfactory receptor 1F12-like LOC100019436 __SEG__ Chr2 {Monodelphis domestica} MEKRNYTTVTEFILLGLSSQPEKQELIFALFLVMYLIGAAGNLLIVLAISLDSHLHTPMYFFLSNLSLVDFCFTSATVPKMLLNIHTQTKSISREGCLTQIYFCILLANM
DNFLLTTMAYDRYVAICYPLQYTTMMSLQLCFLMLAGSWLIANFHSLLHTLLMARLDFCAKNVIPYFFCDLVPLLQLSCSDTQINQLMILLVGGLIVLIPFLCILVSYIH
IVSAVLKVPSARGKQKAFSTCGSHLTVVILFYGTITGVYLNPSSSHSTEKESVASVMYMVVTPMLNPFIYCLRNNEIKRALKKMFSRQNSSHSP*
355 >lcl|XP_001372291.2|Plus18744101..8745045 NW_001581928 olfactory receptor 52R1-like isoform 1 LOC100019439 __SEG__ Chr4 {Monodelphis domestica} MPTSGNRSLHPTSFILLGIPGMEKSQFWIAFPFCAMYILALMGNIIIIHMVRTDHTLHEPMYIFLAMLAFTDLVLSSSTLPKMLGIFWFGSCEIEYHACLTQVFFIHAFS
SVESGVLMAMALDRYVAICFPLRHSAILSTSVVAKLGMAVMVRGVLWVSPFCFMVTWKPFCHNRIIPQSYCEHMAVLKLVCADTRANRKYGLFVAFSVVGFDIIIIAVSY
IMILQAVLHLPSGEARIKAFGTCASHICVILAFYIPALFTFLTHRFGHHVPRVVHIMLGNLYLLVPPMLNPIIYGVKTKQIRERVIYAFCQKIT*
356 >lcl|XP_001372298.2|Plus115500891..15501820 NW_001581971 olfactory receptor 4A15-like LOC100019446 __SEG__ Chr5 {Monodelphis domestica} MEPRNNVTEFVLLGLTQNPEIQKILFVVFLPIYILTMGGNLLIVVTVVSSHSLRSPMYFFLAYLSVMDAVYSTAVSPKMIIDLLYEKKTISFRACMSQLFIEHLFGGAEV
FLLVIMAYDRYVAICKPLYYLVIMRRRTCILLLVVAWVGGFLHSVVQLLLVFRLPFCGPNVIDHFICDMYPLLELACTNTYIIGLSVVANGGAICVVIFTLLLISYGVIL
SSLKSHSMESRLKALSTCISHITVVVLFFVPCIFMYVRPVCTFSIDKTITVFFTIITPMLNPLIYTLRNKEMKNAMRQLWRRKDGPAKH*
357 >lcl|XP_001372320.2|Plus115528277..15529206 NW_001581971 olfactory receptor 4A15-like LOC100019481 __SEG__ Chr5 {Monodelphis domestica} MEPRNNVTEFVLLGLTQNPEIQKILFVLFLPIYILTLGGNLLIVLTVVSSHSLRSPMYFFLAFLSLMDAVYSTAISPKMIIDLLYEKKTISFRACMIQLFIAHLFGGAEV
FLLMVMAYDRYVAICKPLYYLIIMRRNTCVLLLVVAWVGGFLHSLVQLLLIFRLPFCGPNVIDHFICDMYPLLELACTNTYIIGLSVVANGGAICVVIFTLLLISYGVIL
SSLKSHSMESRLKALSICISHITVVVLFFVPCIFMYVRPVCTFSIDKTITVFFTIVTPMLNPLIYTLRNKEMKNAMRQLWRRKDDPDKH*
358 >lcl|XP_001372369.2|Plus115577914..15578843 NW_001581971 olfactory receptor 4C12-like LOC100019556 __SEG__ Chr5 {Monodelphis domestica} MENRINVTEFILLGLIKNPEMQTVLFFIFLITYIITVMGNVLIVITITSSHTLDSPMYFFLSFLSLIDACYSSSIVPKMLADLLCERKTISFNGCMTQIFVEHVLGASEI
VLLIIMAFDRYVAICKPLHYTTIMNHRLCCLLVGLAWTVGFLHSTGQILITLWLPFCGPNVIDHFLCDIVPVIQLACTDTFIVGLLVAANGGLISMISFIMLMCSYVIIL
RSLKSYSSAGRRKALSTCSSHITVVVLFFVPCIFMYLRPVTTFPMDKAVTIFFTLITPMLNPLIYTVRNAEVKNAMRKLWSRKVVSDYK*
359 >lcl|XP_001372389.2|Plus18809528..8810478 NW_001581928 putative olfactory receptor 51H1-like LOC100019585 __SEG__ Chr4 {Monodelphis domestica} MLTLNVSHINHHSFILTGIPGMPEKNPWMAFPLGLLYTLTLLGNCTILSIIKMDRSLHEPMYYFLSILALSDVGLSMSTLPSMLSIFWFNAPEIPFDACITQMFFIHGFG
VVESGVLVSMAFDRFVAIRDPLRYASVLTSGVIGKIGLGVIARTVCVVFPVPFLIKRLPFCSSNVLSHSYCLHQDAMRLACASIRVNILYGLITVICTLGLDALIILFSY
MLILKTVLGIASWAERLKAFNTCLSHICAALLFYVPLIGVTMAHRFGKHLSPIVHTLMANVYLLLPPVLNPIIYSIKTKQIRKRIVQLFIRRKGRT*
360 >lcl|XP_001372393.2|Plus115589103..15590038 NW_001581971 olfactory receptor 140-like LOC100019591 __SEG__ Chr5 {Monodelphis domestica} MERSHSSNNVTEFILLGLTQNPRLQKIFFVAFLFIFLFTALANLLIAITIALSPTLSAPMYFFLTYLSFIDACYTSVTTPKMIIDLLYQRRTISFSGCLTQLFVEHFLGG
SEIILLIVMAYDRYVAICKPLHYMTIMRPRICRLLVVVVWVGGLVHATAQILFMIHLPFCGPNVIDHFMCDLFPLLKLACTDTYMLGMVVAANSGVMCMLIFSMLLVSYI
VILHSLKSHSSEGRRKALSTCGSHFLVVVLFFVPCIFTYTRPVCTYSIDKLVTVFFAILTPMLNPIIYTVRNTEVKNAMKNLFQKRVTSTS*
361 >lcl|XP_001372407.2|Plus1complement(8348707..8349666) NW_001581876 olfactory receptor 2T33-like LOC100019610 __SEG__ Chr2 {Monodelphis domestica} MNLGNQTSKTDFFLLGLFNTSELHYFLFSLAFISFLLTLLSNGLMVFLIYVEVQLHTPMYFFLGQLSFMDMLLACTTVPKMATNFLSGRKSISFVGCGFQIFFFLTLGGG
ECFLLAFMAYDRYVAITKPLRYPTIMTNCVCWLMAATSWLLGVLDGLIQGLVTLTFPFCGLRVIDHFFCEVPAVLALACADTTTFETVMYVCCVGMLLIPFLIILASYAQ
ILVAVLQMTSTKGKKKAFSTCSSHLAVVILFYGTVISIYMVPHSHRSPGVDKTVAAFYTFFIPTLNPFIYSLRNKDVMGALGKLLGKIRLCRNETVQVV*
362 >lcl|XP_001372427.2|Plus1complement(8829576..8830532) NW_001581928 putative olfactory receptor 51H1-like LOC100019646 __SEG__ Chr4 {Monodelphis domestica} MAATNHSFFQHLHFVLTGIPGLERGYYWMALPLGFIYAIAILGNGIIISTIKSETSLHIPMYYFLCMLALADLGLALCTLPTMLGIFWFDYKLIAFDACLVQMYFIHTFS
AIESGVLVAMAFDRVVAIRNPLRYGTILTSGVVCRIGAAILTRAVCVVFPVPFLIKRLPFYRSNVLSHSFCLHQDVMRLACASTRVNSLYGLIAVIFTKGSDSLSILLSY
IFILRTVLAIASGEGRLKALNTCVSHICAVLIFYVPLIGVSVIHRFGKHLSPLTHALMANAYLLVPPVLNPIVYTVKTKEIRRKIIQIFSQTKVTVES*
363 >lcl|XP_001372439.1|Plus1877373..880237 NW_001587049 toll-like receptor 13-like LOC100019659 __SEG__ ChrX {Monodelphis domestica} MGPKARGMPLKWLWFIVLEFSLLSLVEMYGFRHCTQYKFNIHHVLCVRKNITNLKESIHDLPEYVTHLNLTHNQIQTVPSRSFVNLSNLVDLRLEWNFIWDLGPEAFQGL
KNLTLLNLVENKLQSINSSFEGLSSLKTLLLSHNQISWIQENAFVPLINLQYLNLSRNAITTFSNVLAAVQHLPCLEVLDLTYNTIASLDCNPTTLVSLTKLILMKNKLV
DLDFSTLSLPNLTTLDVSQNALQNVHLDTLPQVKRLNLSQTCLEVEKLDAKHLQNLIELDLSGITPLPNTKHVNLSAVCHLLQNLPRIETLFFQKNGIDSENIKHLANCT
MLVSLDLSHNKDLVHLCNSEFSDMPSLERLDLNSCMLSLVSNMTWDSLQNLTVLDLSRNRLKTFPDFAFAPLRRLQSLSLSRNPITELNNLSFYRLHELKELNLAGCWIV
AIDSYSFSQFLSLENLNLRENNLRTLKKNTFLFLKNLQVLTLSYNRLATIEKSAFSGLPKLYKLDLAYNILSDFHPGMFLGLEGLEVLDLSFNKITYETLKSLQPPPFKD
LQTLKRLNLEGQINGIQVVPINFFQGLGSLQELLLGKNSKVFLDHLQLDQLPNLTRLDISGTKAGNRGLYLNISLFQKLKQLKSLQLENNNLDSLAPEMFFGLEGLQIFS
LRFNNLKIINQNLLQNLKSLMYFDVYGNKLECTCDNGWFKNWSVSTPTVHIPYLGSFQCQQPNTQSLLVGFDTSICNFDTGKICFFCSFSLVLATMVCSWFGTKMISSMR
YGIYMFKSLYLAKWHRTEREFVYDAFVSFNAADEEWVYKELVPALEKVGQPTFKLCLHHRDFELGVDIFENIQNAINTSRKTLCIVSNNYLQSEWCRLEVQLASLQMFYD
YQDVIILIFLEEIPNYRLSSYHRLRKLVKRQTFITWPEDFQERPLFWARIRNALGNKTVREENARLILTDPLGD*
364 >lcl|XP_001372458.2|Plus115677013..15677945 NW_001581971 olfactory receptor 4C15-like LOC100019687 __SEG__ Chr5 {Monodelphis domestica} MENQSHVTEFILLGLSQNSDMQTIIFVIFLFFYLTTLGGNLFIVVTIICTPSLLNSPMYFFLSFLSFLDACFSSVITPKVIVDALYERKTISFRGCMMQLFAEHFLAGVE
VIILSAMAYDRYVAICKPLHYVTIMNQRLCLLLVGVAWAGGFLHSTIQVSFIIPLPFCGPNVIDHFMCDLYPLLKLACTDTHAHGFMVVANSGLFCIIIFSLLLVSYGVI
LHSLRTYGTEARRKALSTCGSHITVVVMFFAPCIFVYARPPSTFSFDKNVAIFYTILTPMLNPLIYTFRNTEVKNAMRRMWSRTSVSVEK*
365 >lcl|XP_001372485.1|Plus12414257..2415399 NW_001587053 probable G-protein coupled receptor 173-like LOC100019724 __SEG__ ChrX {Monodelphis domestica} MPNATGPDDLSGSGATLPPAAASTSIKLVLLGAIICISLVGNALLSLLVLRERALHKAPYYFLLDLCLADGVRAAVCFPFVLASIRHGSAWTYSALSCKVVAFMAVLFCF
HAAFMLFCISVTRYMAVAHHRFYAKRMTLWTSAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAALMAATHAVYGKLLLFEYRHRKMR
PVQTVPAVSQNWTFHGPGATGQAAANWIAGFGRGPLPPTLLGIRQATGGGGGHAASRRLLGMEEFRGEKELGRMFYAITLLFLLLWSPYIVACYWRVFVKACAVPHRYLA
TAVWMSFTQAGVNPIVCFLLNKDLKKCLRTHAPCWGAGGPPAPPEPYCIM*
366 >lcl|XP_001372501.2|Plus1complement(8910075..8911040) NW_001581928 olfactory receptor 51F2-like LOC100019745 __SEG__ Chr4 {Monodelphis domestica} MMPPQSILLLLPNTTIISLTFLLTGIPGLEASHLWVSIPFCFLYAIAISGNSMILFVILTNQSLHEPMYYLLSMLSVTDMCLSLSTMPTTLGVLCFNIQEIGWNACISQM
FFIHFLTVMESSVLLAMAFDRYIAICNPLRYTTILTPTRIIQIGLIIMGRGILVVIPLLLLLNRLSFCRDNILSHSYCYHPDVIKCSCSNIRVNSIYGLFALLSTSGLDA
PLIGLSYVLILHSVLNIASPEERYKAFSTCISHIGAVAVFYIPLIGLSAVHRWGKKAPPFVHTLMSNAFLLLPPVLNPIIYSVKTKQIRRAILKVFLKKGY*
367 >lcl|XP_001372503.2|Plus115692018..15692950 NW_001581971 olfactory receptor 4C11-like LOC100019747 __SEG__ Chr5 {Monodelphis domestica} MKNNVTEFLLVGLTKDPAIEKIVFFIILIFYIATILGNMLIIVTINKSSTLRSPMYFFLTYLSFSDACLSSTTAPRLIVDSLRKRKTISYDECMIQLFTGHFFGCMEILV
LILMAYDRYAAICKPLHYLTIMSKKVCRILVELAWLGSFVHSIAQIFIALSLPFCGPNVVNHYFCDLQPLMKLACTDTYVLNLLVVFNSGAICMVSFLLLMISYTVILYS
LRNQSREGKYKALSTCSSHIIVVLIFFGPCIFIYTRPLTTFPVDKLVAVFYAIGTPLLNPLIYTLRNKEVNTAMRKLWNNRKPLHKKQCS*
368 >lcl|XP_001372513.2|Plus1complement(8929649..8930593) NW_001581928 olfactory receptor 52R1-like LOC100019772 __SEG__ Chr4 {Monodelphis domestica} MPTYGNNSFHPSFFILLGIPGLEKAQFWIAFPFCAMYAVAMVGNIIILHVIRTDHTLHEPMYLFLAMLAFNDLVLSSSTLPKMLGIFWFGSCKIEYHACLTQVFFIHTFS
SVESGILMAMALDRYVAICFPLRHSTILSPLVVAKLGMAVMARGVLLVSPFCFMVTWKPFCHNRIIPQSYCEHMAVLKLVCADTRANRGYGLFVAFSVGAFDIIIIAISY
IMILQAVLRLPSGDARLKAFGTCASHICVILALYIPALFTFLSHRFGHHVPQVVHVMLANVYLLVPPMLNPIIYGVKTKQIWDRVVNTFCQKVP*
369 >lcl|XP_001372517.2|Plus115707144..15708076 NW_001581971 olfactory receptor 4C15-like LOC100019779 __SEG__ Chr5 {Monodelphis domestica} MENQSYVTEFILLGLSQNQNIQKMAFIIFLILYLATVGGNFFIVVTIICSPSLLDSPMYFFLAFLSFLDACFSSVIAPKVIIDSLYEKKTISFQNCMGQIFAEHFLAGVE
VIVLTSMAFDRYVAICKPLHYTTIMSRQLCLLLVGIAWAGGFLHSMIQIFFMLPLPFCGPNIIDHFMCDLYPLLKLACTDTRVLGVMVVANSGFICIINFSLLLISYGVI
LHSLRTYSTAARRKALSTCGSHITVVVLFFVPCIFVYTRPPTTFSFDKMVAIFYSFLTPLLNPLIYTFRNTEMKNAMKKLWSKTMISDEK*
370 >lcl|XP_001372537.1|Plus18950613..8951557 NW_001581928 putative olfactory receptor 51H1-like LOC100019808 __SEG__ Chr4 {Monodelphis domestica} MSMLNYTRFRHQTFTLTGIPGMPEKDYWMALPLFLLYSVTLLGNITILMVIRLEQSLHEPMYYFLAMLAATDLSLSLSSLPTMLRVHWFGQYSVAFDACITQMFFIHMFG
GVESGVLVAMAFDRLATIRSPLHYASILSHGVIGKIGAAIVFRSVAAVLPVPFLIKRLPFCHSNVLSHAYCLHQDAMRLACADTRINSLYGLLAVIFIIVLDALVLLFSY
ILILHAVLGIASREEQFKVLNTCFSHICAVLLFYIPLIGMTLIHRFGKHLSPIVHTFMANVYLLLPPVLNPIVYSIRTREIRRRIVRVLSRAGF*
371 >lcl|XP_001372542.2|Plus115723607..15724530 NW_001581971 olfactory receptor 4C11-like LOC100019813 __SEG__ Chr5 {Monodelphis domestica} MRNNVTEFILLGLTQDPERQKIVFFIFLVFYTATVLGNLLIVVTIKTSSTLGSPMYFFLTYSSIADSCFSTTTAPKLILDNLSHKNTISFDECMTQLFAMHFFGCMEILV
LILMAYDRYVAICKPLHYSVIMNRRVCGILILLAWVGSFLHSIAQIILILNVPFCGPNVIDHYFCDLQPLLRLGCMDTYVLNLLVVSNSGAICSASFVLLMISYTIILCS
LKNHSAEGKRKALSTCSSHIIVVIIFFGPCIFMYTRPPTTFPLDKLVSVFYTIITPFLNPLIYTLRNAEVKNAMKKLWSKRVTSDHK*
372 >lcl|XP_001372591.2|Plus1complement(8529946..8530902) NW_001581876 olfactory receptor 2T8-like LOC100019894 __SEG__ Chr2 {Monodelphis domestica} MEWSGNQTFITHFVLLGLFSHTPLHHFLFSLIMIMFLVALTGNGLMILLINIDSRLHSPMYFFLSWLSCMDLMLISTIVPRMAVDFLSDGGYISFTGCGLQILFFLTLLG
DECFLLAFMAYDRYVAISNPLRYSLVMNQRICWLMVAFSWLFGLIDGLIQAVFTLHFPYCGSKEIDHFFCEVPAILKLACADTSLYESMIYVCCVLMLLLPFSVISASYL
RILVAVLQMRSTEGRKKAFATCSSHMTVVTLFYGAAMVTYIRPQAYHSSKQDKVVSAFYTMITPMLNPMIYSLRNKEVTGALKKLLGRCSCGQREDSQ*
373 >lcl|XP_001372593.2|Plus1complement(8987993..8988931) NW_001581928 olfactory receptor 51A7-like LOC100019899 __SEG__ Chr4 {Monodelphis domestica} MSELNTSEVKIFFLIGIPGLEHVHIWISIPVCFMYLIAILGNCTILLVIKTEASLHEPMYYFLSMLAISDLGLSLSSLPTMLRIFLFNAPGITPGACFAQEFFIHGFTVM
ESSVLLIMSFDRFIAIHNPLRYSSILTTSRISKMGLVMAIRSFFLVLPFPLTLKRLRYCHKNLLSHSYCLHQDVMKLACSDNRVNVIYGFFVALCTMMDLACIALSYLLI
LKTVLGLASFSERLKAFNTCVSHICAVLIFYVPIITLAAMHRFAKHKSPLTMILIANIFLLVPPLMNPIVYCVKTRQIREKIHGKLFTMCGR*
374 >lcl|XP_001372595.2|Plus115776554..15777486 NW_001581971 olfactory receptor 4C15-like LOC100019902 __SEG__ Chr5 {Monodelphis domestica} MENQSQVTEFILLGLTQIPGVQKIIIIIFLLVYLATLGGNLFIVLTIISSPSLFASPMYFFLAFLSFLDACFSSVIVPKVIVDSFYEKKTISYEGCMTQVFAEHFFGGAE
VIVLTAMAYDRYVAICKPLHYVTIMSRRLCLLLAGVAWAGGFLHSIIQMFFILPLPFCGPNTINHFLCDLYPLLELACTDTHDLGLMVVANSGFMCILIFSLLLVSYGVI
LYTLRTYSTEGRRKALSTCSSHITVVLMLFVPCIFEYARPPTTFSFDKMLEIFYTILTPLLNPFIYTFRNMEVKNAMRRLCCQKTFSIKK*
375 >lcl|XP_001372614.2|Plus115792871..15793791 NW_001581971 olfactory receptor 4C11-like LOC100019929 __SEG__ Chr5 {Monodelphis domestica} MNIQSNVTEFVLLGLTQDPGRRKIVFAVFLVFYIATVLGNLIIIVTIKTSPMLGSPMYYFLSYLSFADACFSTTTAPKLIVDSVSKKQTISFKHCMTQVFAAHFFGCMEI
FLLILMAYDRYVAICKPLHYSTIISPKACRILVILAWVGSCIHSTAQIFLALSLPFCGPHLIDHYFCDLQPLLKLACTDTYVINLLIISNSGVICMVSFVLLIISYIVIL
YSLRKQSSEGKRKAFSTCISHIIVVIIFFVPCIFIYTRPPTTFPVDKLVSVFYTIGTPLLNPLIYTLRNKDVKDSMRKLWRKIVGS*
376 >lcl|XP_001372633.2|Plus115808790..15809716 NW_001581971 olfactory receptor 4S2-like LOC100019962 __SEG__ Chr5 {Monodelphis domestica} MENVNNVTEFIFWGLSQNPEVEEICFVVFTFFYTIILLGNLLIIATVCIGNLFNSPMYFFLNYLSFVDICYSSVTAPKMIADLLSLRKSISYPGCMMQLFGVHFFGCTEI
FILTVMAYDRYVAICRPLHYMTIMDRSRCNKMLLGTWVGGFIHSIIQVALVVQLPFCGPNEIDHYFCDVHPVLKLACTDTYVVGAVVTANSGTIALGSFVILLISYTIIL
VSLRKQSAEGRRKALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAVFYTIVTPMLNPLIYTLRNAEVKNAMKKLWTRKIFLQN*
377 >lcl|XP_001372690.2|Plus18889897..8890832 NW_001581876 olfactory receptor 2Y1-like LOC100020043 __SEG__ Chr2 {Monodelphis domestica} MRQFNTSSQDFILLGFSDWPHLEHLLFVVILIFYLLTLVGNTAIIVVSNLFPQLHTPMYFFLCHLSFLDLCYTTSIVPQLLVNLHGFDRTITKGGCVAQLFISLALGSTE
SVLLVVMAFDRYAAVCRPLHYTTIMQPWLCLLLASISWFGGFVNSVAQTGLMMAMPLCGLRYLDHFFCEMPVFLKLACKDTKDTEAKMFVARVIILVLPASLLLVSYVYI
IQAVLNIKSAEGQRKAFETCGSHLMVVFLFYGSAIYTYLQPTHSYSTSHGKFAALFYTIITPMLNPLIYTLRNKDMKAALRKVIKRKRALG*
378 >lcl|XP_001372691.1|Plus1complement(1058920..1060008) NW_001581889 c-X-C chemokine receptor type 7-like LOC100020044 __SEG__ Chr2 {Monodelphis domestica} MDLFSFDYSEPGNFTDLNWTCPNGDCITVDTVMCPSTTSRNVLLYTLSIFYIFIFVVGMIANSVVVWVNLQAKTTGYETHLYIFNLAIADLCVVVTIPIWVVSLVQHNQW
PMGELTCKIAHLIFSINLFGSIFFLTCMSVDRYLSVTYFSNTSSHKKKVVRRLICILVWLLAICVSLPDSYYLKTVTLAANNETYCRSIYPEHSIKEWLLGMELLSVILG
FIIPFSIIAIFYFLLARAITASGDQEKHSSQKIIFSYVIVFLICWLPYHAVVLLDIFSFLHFIPFNCQLENFLYTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAF
IFKYSAKTGLTKLIDASRVSEAEYSALEQNAK*
379 >lcl|XP_001372692.2|Plus1complement(8082..9020) NW_001581929 olfactory receptor 51A7-like LOC100020045 __SEG__ Chr4 {Monodelphis domestica} MSELNTSEIKIFFLIGIPGLEHVHIWISIPICFMYLIAILGNCTILLVIKTEASLHEPMYYFLSMLAISDLGLSLSSLPTMLRIFLFNAPGITPDACFAQEFFIHGFTVM
ESSVLLIMSFDRFIAIHNPLRYSSILTTARISKMGLVMAIRSFLLVLPFPLTLKRLRYCHKNILSHSYCFHHDVMKLACSDNRVNVIYGFFAALCTMLDLVCIALSYLLI
LKTVLGLASFSERLKAFNTCVSHICAVLIFYVPIITLAAMHRFAKHKSPLTMILIANILLLVPPLMNPIVYCVKTRQIREKILGKLFTMCGR*
380 >lcl|XP_001372695.2|Plus115863687..15864631 NW_001581971 olfactory receptor 4P4-like LOC100020048 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYNQNIQIFCFFLFLLCYICLILGNLLILISIHCSHLFHQPMYYFLSHLSSMDIYYTSSVTPKLIADLLAEKKTISYGYCMFQVFSMHFFGSIEV
FILTAMALDRYFAICKPLHYMVIMSRKKCNLLVLAAWAGGAAHSLPQLSMTLKLPFCGPNEIDHYFCDIFPLLKIACTDTYKTGVLVVLNSGIIVLVIFVILFVSYAVIL
WTLRTHSAEGRRKALSTCGSHFTVVVLFFIPAIFSYLRPPTTYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWCQKIWGKGNVKHMG*
381 >lcl|XP_001372732.2|Plus1complement(35601..36536) NW_001581929 olfactory receptor 51A7-like LOC100020103 __SEG__ Chr4 {Monodelphis domestica} MSTFNNSKGEVFTFFLIGLPGLEYTHIWISIPICLIYFVTILGNCIILFIIKTESSLHKPMYYFLSMLAFSDLGLSLSSLPTMLRVFLLNAPRISADACFAQQFFIHGFS
LMESSVLMIMSFDRFLAIHNPLRYSSILTNARATKLSLVLTMTSFLFILPFPFTLKSLTYCKRNLLSHSYCLHQDVMKLACSDNKVDVIYGFFVAMVGMLDLVLIAISYI
FILKTVSGIGSQQEQLKALSTCVSHICAVLIFYIPIISLAVLYRFGKNAPLVIRILMADVLLLVPPLMNPIVYCVKTQQIRVRILKKLYLK*
382 >lcl|XP_001372735.2|Plus115884351..15885295 NW_001581971 olfactory receptor 4P4-like LOC100020107 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYDQNIQIFCFFLFLFCYISLILGNLLILISIHCSHLFHQPMYYFLSHLSSMDIYYTSIVTPKLIADLLTEKKTISYGYCMFQVFSMHFFGSIEV
FILTAMALDRYVAICKPLHYMVIMSRKKCNLLVLAAWAGGAAHSLPQLSMTLNLAFCGPNEIDHYFCDIFPLLKIACTDTSITGVLVVLSSGIISLGVFVILFVSYAIIL
WTLRTHSAEGRRKGLSTCGSHFVVVILFFIPAIFSYLRPPTTYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWRQKIWGKGNIKHMG*
383 >lcl|XP_001372752.2|Plus1complement(47937..48878) NW_001581929 olfactory receptor 51A7-like LOC100020134 __SEG__ Chr4 {Monodelphis domestica} MSAFNITEDKISAFFLTGIPRMEHVYIWMSIPICLIYIIEALGNSAILILIKTEPSLHEPMYYFLSMLAFSDLCLSFSTLPTMLRIFLFNATGISTDACIAQEFFIHTFG
AMEYSVLVIMSFDHFLAIRNPLRYSSILTNVRVMQIGLIFAILSFILLLPLPITLRKLKYCKGNHLSYSFCLLQDIMRLACSDSRIKVIYGFFVAILSLLNFLVIVMSYV
LILKTVLGIASHQEHLKPLSTCVSHFCAVLIFYMPIISLSIAHRFAKHGSPIIRILLADIFLFVPPLMNPIVYCVKTRQIWERVLGKLRLKKA*
384 >lcl|XP_001372754.2|Plus115910525..15911469 NW_001581971 olfactory receptor 4P4-like LOC100020136 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYDQNIQIIFFFLFLFCYISLILGNLLILISIRCSHLFHQPMYYFLSHLSSMDIYYTSTVTPKLIADSLTVKKTISYDYCMFQVFSMHFFGSIEV
FILPAMALDRYVAICKPLHYMVIMSRKKCNLLMLAAWAVGAAHSLPQLSMTLNLAFCGPNEIDHYFCDISPLLKIACTDTSITGVLVVLSSGIIALGVFVILFVSYAVIL
WTLRTHSAEGRRKALSTCGSHFMVVILFFVPATFSYLRPPTTYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWCQTIWGKGNVKHMD*
385 >lcl|XP_001372770.2|Plus1complement(59118..60056) NW_001581929 olfactory receptor 51A7-like LOC100020167 __SEG__ Chr4 {Monodelphis domestica} MSELNTSEIKMFFLIGIPGLEHVHIWISIPICFMYLIAILGNCTILLVIKTEASLHEPMYYFLSMLAISDLGLSLSSLPTMLRIFLFNAPGITPDACFAQEFFIHGFSVM
ESSVLLIMSFDRFIAIHNPLRYSSILTTARISKMGLVMAIRSFLLVLPLPLTLKRLRYCHKNVLSHSYCFHHDVMKLACSDNRVNVIYGFFAALCTMLDLVCIALSYLLI
LKTVLGLASFSERLKAFNTCVSHICAVLIFYVPIITLAAMHRFAKHKSPLTMILIANIFLLVPPLMNPIVYCVKTRQIREKILGKLFTMCGR*
386 >lcl|XP_001372773.2|Plus115936685..15937629 NW_001581971 olfactory receptor 4P4-like LOC100020170 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYDPNIEIFCFFLFLFCYISLILGNLLILISIHCSHLFHQPMYYFLSHLSSMDIYYTSSVTPKLIADLLTEKKTISYGYCMFQVFSMHFFGGIEV
LILTAMAFDRYVAICKPLHYMVIMSRKKCNLLVLAAWAGAAVHSFSQLSMTLKLPFCGPNEIDHYFCDIFPLLKIACTDTYNTGVLLVLNSGTFALGVFVILFVSYAIIL
WTLRTHSAEGRRKALSTCGSHFTVVILFFVPAIFSYLRPPTTYPEDKVFALFYTIIAPLFNPLIYTLRNTEMKNTMRKVWCKKKWGKGNVKHMS*
387 >lcl|XP_001372807.2|Plus1complement(9056499..9057428) NW_001581876 putative olfactory receptor 2W6-like LOC100020226 __SEG__ Chr2 {Monodelphis domestica} MEIANDSSDDFILVGFSERPELELILSLFVSLFYIITLTGNTAIILLSLLDSRLHTPMYFFLRNLSFLDLCFTTSIVPQMLVNIWGGSKKISYSGCMVQYWVALALGSTE
CVLLAVMAVDRYVAVCWPLRYAMIMHPRLCHLLGAASWSSGFANSVLQSSLAMVLPLCGNRRVDHFFCELLIIVKLSCVDTGPTESKMFIARLIILAMPVSIILTSYGCI
AWAVMKIRSAEGRKKAFGTCASHLLVVSLFYGTIMFVYLQPKNNYSQDQGKILAVLYTILAPTLNPLIYTLRNKDVKKAVKKLIGKEQA*
388 >lcl|XP_001372815.2|Plus1complement(119285..120226) NW_001581929 olfactory receptor 51A7-like LOC100020235 __SEG__ Chr4 {Monodelphis domestica} MSPFNHSEDNISTFFLIGIPGMEHMHIWISIPICLIYIIATVGNSTILLLIKTEPSLHEPMYYFLSMLAFSDLCLSFSSLPTMLRIFLLNAPGISIDACIAQEFFIHSFT
AMESSVLVIMSFDRFIAICNPLRYSSILTNVRVIQIGLFFAISSFAFIIPFPITLRRLRFCKGNLLSHSYCLHQDVMRLSCSDNRVNVIYGFFVALLGMMNLVLILLSYI
MILKTVLAIASNQERLKAFNTCISHICAVLIFYVPVVTLAIVHRFAKHGSPLIRILIADVYVLVPPLMNPIVYCVKTRQIREKVIGKLFLKKA*
389 >lcl|XP_001372818.2|Plus115993097..15994041 NW_001581971 olfactory receptor 4P4-like LOC100020240 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYDPNIQIFCFFLFLFCYISLILGNLLILISIHCSHLFHQPMYYFLSHLSSMDIYYTSSVTPKLIADLLTEKKTISYGYCMVQVFSIHFFGSIEV
FILTAMAFDRYVAICKPLHYMVIMSRKKCNLLVLAAWGGAAAHSFSQLSMTVKLPFCGPNEIDHYFCDIFPLLKIACTDTYITGVLLVLSSGIIALGVFVILFVSYAVIL
WTLRTHSAEGRRKALSTCGSHFTVVILFFVPAIFSYLRPPTTYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWCQKLFGKGNVKHMG*
390 >lcl|XP_001372828.2|Plus1complement(133740..134681) NW_001581929 olfactory receptor 51A7-like LOC100020259 __SEG__ Chr4 {Monodelphis domestica} MSAFNTSEIQISTFLLIGIPGLEHVHIWISIPICLIYIIATIGNCIILLLIKTESSLHEPMYYFLSMLAISDLGLTLSSLPTMLRIFLFNATRISIDACIAQEFFIHTFT
AMESSVLLIMSFDRFIAIRNPLRYSSILTNITIIKIGLIFAIRCLLLILPFPITLKRLRYCNRNLLSHSYCLHQDIMRLACSDNRVNVIYGFFVALIGMLDLAIISMSYI
LILKTVLGIASHQERLKALSTCISHICAVLIFYVPIVTLAIVHRFAKHGSPLIRILIADILVLIPPLMNPIVYCVKTRQIREKVLGKLCLKKA*
391 >lcl|XP_001372833.2|Plus116028092..16029036 NW_001581971 olfactory receptor 4P4-like LOC100020266 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYDPNIQIFCFFLFLFCYISLILGNLLIFISIHCSHLFYQPMYYFLSHLSSIDIYFTSTVTPKLITDLLTEKKIISYGYCMFQVFSMHFFGSIEI
FILSAMALDRYVAICKPLHYMVIMNRKKCNLLVLAAWAGGAVHSFPQLIMTLKLPFCGPNEIDHYFCDISPLLKIACTDTYITGVLVVLSSGIIALGVFVILFVSYTIIL
WTLRTHSAEGRRKALSTCGSHFTVVILFFLPAIFSYLRPPTTYPEDKVFALFYTIIAPTFNPLIYTLRNTEMKNAIRKVWCQTIWGKGNVKHMD*
392 >lcl|XP_001372840.2|Plus11432917..1433966 NW_001587049 lysophosphatidic acid receptor 4-like LOC100020275 __SEG__ ChrX {Monodelphis domestica} MGNSSTNQTCFTDDSFKYNLNGAVYSVVFILGLITNCASLFVFCCRMKMRSETAIFITNLALSDLLFVFTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTC
ISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVSNSTTTCFEGFSKRIWKTYLSKITIFIEVVGFIIPLLLNLTCSSLVLRTLRKPATLSQIG
TNKEKVLKMIIVHVAIFIVCFVPYNSILFLYALVRSQAITNCSLERFAKTMYPITLCIATLNCCFDPFIYYFTLESFQKSLYINTQIKMESLFKTETPLTAKTSLPAIQE
ELSDQAMTNGGELMLESNL*
393 >lcl|XP_001372856.2|Plus116040316..16041251 NW_001581971 olfactory receptor 4P4-like LOC100020301 __SEG__ Chr5 {Monodelphis domestica} MGNKVNITEFILFGLSYDHNIQIFCFVLFLLCYIILLLGNLLILISIYCSTLSHQPLYYFLSHLASIDICYTSSVTPKLIGDLLASKRTILYNSCMLQVFVMHFFGMIEV
FILTAMAFDRYVAICKPLHYVAIMSKKKCNLIVVAAWAGGAVHSFPQLTMALQLPFCGLNEIDHYFCDIFPLMKIACTDTYITGVLVVANSGLFALVTFVVLLASYVIIL
YTLRTYSAEGRWKALSTCGSHVTVVILFFGPIIFSYLRPPTSYPEDKVLALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWCQRVFRKGNLY*
394 >lcl|XP_001372870.1|Plus1194356..195303 NW_001581929 olfactory receptor 51L1-like LOC100020327 __SEG__ Chr4 {Monodelphis domestica} MALSNSSDVTDPIFLLKGFPGLESVHIWLSLPFCLAYLVAFGGNVTILAVIWTEPSLHQPMYYFLSILALTDLGMSLSTLPTILGVLWQNMQEIQASACYAQLFFIHTFT
FLESSVLLAMAFDRFVAICFPLQYSTILTNRVIGNIALACLLRSMGVVLPTPLLLQQYHYCRANTLSHAFCLHQDVLKLSCSDARVNSIYGLCVVIVTLGIDSVFILLSY
LLILYAVLSIASHEERLKALNTCVSHICVVLIFFVPVIGVSMVHRFGRHLSPTIHIVMADIYLLLPPVLNPVVYSVRTKQIRAGIIRKFRTRKLF*
395 >lcl|XP_001372871.1|Plus1complement(767513..768547) NW_001581933 platelet-activating factor receptor-like LOC100020328 __SEG__ Chr4 {Monodelphis domestica} MDEDNFRIDSEFRYTLFPIVYSIIFVLGFVSNAYVLWVFISLDPSKKLNEIKIFMVNLTVADLLFLFALPLWIVYYFNKGNWLLPKFLCNVAGCLFFINTYCSVCFLGVI
TYNRFQAVTDPIKAAQSTTRRRGILLSTIIWVVIVGCASYFLISDATNSVPSKMTGENVTRCFEHYEKGSIPVLLIHVFIVLCFFIVFLVILVCNVIIIRTLLAQPLQPQ
SNADVKQKALWMVCTVMAVFFICFVPHHVVQLPWTLAELQIGFQDNDQVHQLINDAHQVTLCLMSINCVLDPIIYCFLTKKFRKHLKERLQSMKGSRKCSRVTSDTGVEA
VVPLNNFPVNSKNN*
396 >lcl|XP_001372873.2|Plus1complement(16053399..16054331) NW_001581971 olfactory receptor 4P4-like LOC100020332 __SEG__ Chr5 {Monodelphis domestica} MQSNVTEFVFLGLFMNKEMKILSFALFLLCYFAILLGNFVIFITISYSHLIQQPMYYFLCHLSLMDLGYTSTIIPRLIRDLVAKRKTISYNGCMTQLFSAHLLGGVEMFI
LVSMAFDRYIAICKPLHYLIIVNRKRCNLLILLAWVVAFWHSIAQLFMILRLPFCGPNQIDHYICDVKPLLQLVCMDTRTVNSLVIANTGMVALVTFVVLVSSYIVILYN
LRTHSSEGRKKALATCGSHIMVVVLFFVPCISTYVPPPRAGNNDKEFSVFYTVIAPMLNPLIYTLRNAEMKNAMQKVWSRKRQSLFNCNI*
397 >lcl|XP_001372880.2|Plus11567752..1568741 NW_001587049 putative P2Y purinoceptor 10-like LOC100020339 __SEG__ ChrX {Monodelphis domestica} MGSNGTSNTIGNCSNTSVPFQYSLYAATYIVVFIPGLLANSVALWVLYRFISKKNKAIIFMINMSVADLAHVLSLPLRIYYYINHQWPFPKSVCLLCFYLKYLNMYASIC
FLTCISLQRCYFLLKPFKARNWKRRYDVAISATIWVVVGTVCLLFPILRNAGLANRNQNACFADLGYKQMNVAPTVAMIMMAELAGFVIPVVIIAWCTWKTVISLQHPHV
TYEGVAEKQKALRMVFLCAGVFFICFTPYHINFLFYTLVKEKVITSCPIIQSTLYFHPFSLCLASLCCCLDPILYYFTTSEFRDQLSRHGSSVIRSRLMSRESGSSMMS*
398 >lcl|XP_001372890.2|Plus1complement(198655..199707) NW_001581929 olfactory receptor 51G2-like LOC100020356 __SEG__ Chr4 {Monodelphis domestica} MSVFNNSALYPQFLLTGFQGLEAKYSLISLPICLIYIISIAGNITILFIIRTEPSLHQPMYYFLSMLALTDLGLSTVTLPTMVSVFWFHARDISFVACAVQMYFIHVFSI
IESAILLAMAFDRVVAIREPLRYSAILTNSIIIRIGLASAGRALILVFPVPFLLKRLQFHTISTLSYPFCLHQDLIKLTVSSRRISSIYGLMVVISSMGLDSVLLLLSYM
LILVTVLSVASKTERFKALNTCISHICAVLTFYTPMIGLSMIRRYGQNASPMVHVLMADVYLLVPPLMNPIVYSVKTKQIRLRILKKLKKTEGIGDSLLFLLNGDNQTSL
LHGFLIFSQRVIIYVITFLS*
399 >lcl|XP_001372896.2|Plus1complement(16067679..16068608) NW_001581971 olfactory receptor 4P4-like LOC100020363 __SEG__ Chr5 {Monodelphis domestica} MEIHNNVTEFILLGLLMKEEMKTLCFVIFMACYLAILLGNFIIFITITYSHLMQQPMYYFLWHLSYMDPCFTSTIVPRLISDLVARRNIISYNSCMTQLFTFHLLGAVEI
FILVSMAFDRYVAICKPLHYMIIVNRQRCNMLILLAWVVAFWHSIAQLFMILRLPFCGPNQIDHYVCDSKPLLKLACTDTHIASILIIANTGMVVLATFLVLVASYIIIL
YNLRKHSSEGRRKALSTCASHVMVVLLFFVPCISTYILPPRFLNSDKEFSVFYTVIAPMLNPLIYTLRNAEMKNTMWKVWSRKLAWLFK*
400 >lcl|XP_001372899.1|Plus11611061..1612107 NW_001587049 putative P2Y purinoceptor 10-like LOC100020369 __SEG__ ChrX {Monodelphis domestica} MFKMEGNGTEVKCNDLHLAFQYPLYAITYIVIFIPGLLANGAGLWVLCRFISKKNKAIIFMINLAIADFAHVLSLPLRIYYYINHQWPFPRSLCLFCFYLKYLNMYASIC
FLTCISLQRCYFLLKPFKARHWKRRYDVAISAIIWVTVGAACLPLPAMRSASLANNSSEICFADLAVQHISMTTSIAMITVAELGGFVIPIGVITFCTWKMMKSLQDYQT
PHSNNNEKDKAFRMVLICAMVFFVCFTPYHINFPIFMMLKQGLFSSCSFMKIILCFHIISLCIASINCCLDPLVYYFMTAEFRDHLSRRSFVNILSRFTPRHKNFGFNRR
QDELQTITFELLGDFKSF*
401 >lcl|XP_001372901.1|Plus122038989..22039471 NW_001581838 histidine triad nucleotide-binding protein 1-like LOC100020380 __SEG__ Chr1 {Monodelphis domestica} MTSSRTGTFSAAPVAAFFHFLFLTQPLGAGQQRLSEMEEDYTNLVSRRKDSIFVKIIRREIPANIIFEDDSCFAFHDSCPQAPTHFLVVPKKPIACMLEAEDCDESLIGH
LIIVGKKCASEVGLKKGYRMVINEGTDGGQAVLHIHVHVLGGRQMTWPPG*
402 >lcl|XP_001372912.2|Plus1complement(16082316..16083245) NW_001581971 olfactory receptor 4P4-like LOC100020394 __SEG__ Chr5 {Monodelphis domestica} MENHNNVTEFVLLGLFMNQDLKLMCFVIFLFCYFAIFLGNFIIFVTITCSHLIQQPMYYFLCHLSLMDLAYTSTIVPRLIRDLIAKEKNISFGSCMTQLFTAHFLATVEM
FILVSMAFDRYVAICKPLHYMVIVNRQRCNTMILMAWGVAFWHAIAQMLMVVRLPFCGPNQIDHYICDVKPLLKLVCADTHIANILVIANSGMVVLTTFLVLVASYIVIL
YNLRKHSSEGRRKALSTCGSHVMVVVLFFVPCISTYIRPPSASKNDKEFSMFYTVIGPMLNPLIYTLRNAEMKNAMQKVWSNKLSILFK*
403 >lcl|XP_001372921.2|Plus11696278..1697276 NW_001587049 probable G-protein coupled receptor 174-like LOC100020404 __SEG__ ChrX {Monodelphis domestica} MSSNNSCIPADIANTDFRYFIYAVMYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGEGLCMFCFYLKYVNMYASIYFLV
CISVRRFWFLMYPFRFTDCKRKCDLYVSIAGWLSICLACLLFPFLRINQEKASNRTKCFVDLPTRNVNLMQSIVMVTMGELVGFITPLIIVLYCSWKTVLSLKEKYPVSQ
DLGEKKKALKMILTCAAVFLICFAPYHFSFPLDFLVKANKIQSCRAQKVIMIFHSVALCLASLNSCLDPIIYYFTTNEFRRRLSRQDLQDSIQLHNKNYPGNHAPTVGTG
LC*
404 >lcl|XP_001372947.2|Plus1295461..296402 NW_001581929 olfactory receptor 51L1-like LOC100020450 __SEG__ Chr4 {Monodelphis domestica} MTVFNNSALYPQFLLTGFQGLEAKYSLISLPICLIYIISIAGNITILFIIRTEPSLHQPMYYFLSMLALADLGLSTVTLPTMVSVFWFHARDISFAACAVQMYFIHVFSI
TESAILLAMAFDRVVAIREPLRYSAILTNNIIIRIGLASAGRALILLFPVPVLLKRLQFQNITTLSYPFCLHQDLIKLTVSSPRISSIYGLIVVISSTGVDSVLLLLSYI
LILVTVLSVASKTERAKALNTCISHICAVLILYIPMIGLSIISRFGQNVSPVLHVLMADVYLLVPPLMNPIVYSVKTKQIRLCILKKFIKQKG*
405 >lcl|XP_001372949.2|Plus1complement(16106450..16107364) NW_001581971 olfactory receptor 4P4-like LOC100020453 __SEG__ Chr5 {Monodelphis domestica} MENQNNVTEFVLLGLFMNKEMKIICFAFFLLCYFAIFLGNFIIFVTITYSHLIQQPMYYFLCHLSLMDLAYTSTIIPRLIRDLAAKRKTISYNGCMTQLFSAHLLGGVEM
FILVSMAFDRYIAICKPLHYMVIVNRRRCNMLILVAWAVVFWHSIAQLLMVLKLPFCGSNHIDHYICDVKPLLKLVCGDTHVVSILVIANNGMVCLITFLVLVASYVVIL
YHIRMHSTEGRHKALSTCGSHIMVVVLFFVPCIYAYVPPPSANNNEKEFSVLYTVIAPMLNPLIYTLRNTEMKSAMRKVWYRKI*
406 >lcl|XP_001372977.2|Plus1363739..364671 NW_001581929 olfactory receptor 52J3-like LOC100020500 __SEG__ Chr4 {Monodelphis domestica} MSQLNATTFHPNTFILLGIPGLEDIHNWLSLPFCSFYLVAILGNVTILLVIWTEKKLRDPMFYFLALLSTIDLALSTTSVPRMLGIFWFGAHEINFGTCMAQMFFIHSLT
GMESGVLLGMAFDRYVAICTPLRYTTILTTQVLTGIGVAIVLHPILLMIPVVTLACRLPFCQARVIAHSYCEHMGIVKLACASIRVNAIYGLFAASFLLVDLVLIGVSYV
YILRAVFRLPSHDARLKALNTCGSHVGVMCVFYTPAFFSFLTHRFGHRIPPYVHILIANLYMSIPPALNPVIYGVRTKQIRERVLQYFTG*
407 >lcl|XP_001372985.1|Plus1complement(5976652..5977746) NW_001581997 p2Y purinoceptor 1-like LOC100020509 __SEG__ Chr7 {Monodelphis domestica} MTDVPLWSVLPNGTEVPPALGWAAGNASGPAPRCSLTKTGFQFYYLPAVYILVFVTGFLGNSVAIWMFVCHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTNWV
FGKTMCKLQRFIFHVNLYGSILFLACISVHRYTGVVYPLKSLGRLKKKNAVYISALVWAVVVAAISPILFYSGTDLRGNKTTCYDTTTDEYLRSYLIYSMCTTVVMFCVP
FVLILGCYGLIVRALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQGPGMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRAT
RKASRRSEANLQSKSEDMTLNILSEYKQNGDTSL*
408 >lcl|XP_001372996.2|Plus1383348..384292 NW_001581929 olfactory receptor 52E2-like LOC100020532 __SEG__ Chr4 {Monodelphis domestica} MPLSNNASSYPFSFLLLGIPGLENFHIWIGFPFCAVYLIALVGNITILTVIRLERSLHQPMFYFLAMLASIDLGLSTATIPKMMGIFWFSLRMISFGGCLTQMFFIHIFT
GMESIVLVSMAYDRYVAICNPLHYSSVLTNKIVALMGLGVLMRSFFICLPFVFLILRLTFCGHYIIPHTYCEHMGLARLACVNIRINIIYGLWAISILVLDMVAIAISYV
QILRAVFRLPSRDARLKALSTCGSHVCVILAFYSPALFSFMTHRFGKNVPRYIHILLANMYVVIPPMLNPVIYGVRTKQIREKVLRVFCTNSLG*
409 >lcl|XP_001372999.2|Plus1complement(16163523..16164452) NW_001581971 olfactory receptor 4P4-like LOC100020535 __SEG__ Chr5 {Monodelphis domestica} MEIHNNVTEFILLGLLMKEEMKTLCFVIFMACYLAIFLGNFIIFITITYSHLMQQPMYYFLWHLSFMDPCFTSTIVPRLISDLVATRNTISYNFCMTQLFTSHLLGGVEM
FILVSMAFDRYVAICKPLHYMIIVNRQRCNMLILLAWVVAFWHSIAQLFMILRLPFCGPNQIDHYMCDSKPLLKLACTDTHIASILVIANTGMVVLATFLVLVASYIIIL
YNLRKHSSEGRRKALSTCASHVMVVLLFFVPCISTYILPPRFLNSDKEFSVFYTVFAPMLNPLIYTLRNTEMKNAMWKVWSRNLSWLIK*
410 >lcl|XP_001373022.1|Plus119568863..19570065 NW_001581982 probable G-protein coupled receptor 27-like LOC100020570 __SEG__ Chr6 {Monodelphis domestica} MANASDLTGASGPTAPSNGAGGGGSGGGGGGSGPVALGLKLASLSLILCISLAGNVLFVLLILRDRHLHRAPYYLLLDLCLADGLRSLACFPAVLLSVRRGAGAAGGAPP
PGTLGCKLLAFLAVLFCFHAAFLLLGVGVTRYLAIAHHRFYAKRLTGWPCAAVVCVAWVLALAMAFPPVLDVGTYRFVREEAQCTFEHRHVGANDTLGFMLMLAAVVGAT
HLVYLRLLFFIHDRRKMKPAQLVPAVSQNWTFHGPGATGQAAANWTAGFGRGPTPPTLVGIRPAGPGPGGQARRLLVLEEFKTEKRLCKMFYMITLLFLLLWGPYIVACY
LRVFIKAGAVPQGYLTTSVWLTFAQAGVNPILCFIFNKELRVCFRAHFPCGQSPQTTQGTLLCDLKSIGI*
411 >lcl|XP_001373039.2|Plus1complement(16181671..16182600) NW_001581971 olfactory receptor 4P4-like LOC100020600 __SEG__ Chr5 {Monodelphis domestica} MEIHNNVTEFILLGLLMKEEMKTLCFVIFMACYLAILLGNFIIFITITYSPLMQQPMYYFLWHLSYMDPCFTSTTVPRLISDLVATRNTISYNSCMTQLFTFHLLGAVEI
FILVSMAFDRYVAICKPLHYMIIVNRQRCNMLILLAWVVAFWHSVAQLFMILRLPFCGPNQIDHYVCDSKPLLKLACTDTHIASILIIANTGMVVLATFLVLVASYIIIL
YNLRKHSSEGRRKALSTCASHVMVVLLFFVPCISTYILPPRFLNSDKEFSVFYAVIAPMLNPLIYTFRNAEMKNAMWKVWSRKLAWLFK*
412 >lcl|XP_001373053.2|Plus1443188..444123 NW_001581929 olfactory receptor 52E2-like LOC100020624 __SEG__ Chr4 {Monodelphis domestica} MSISNDTQFHPPYFLLLGIPGLEAIHTWIGFPFFIVYLIALVGNITILFVIQTERSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFSLREIIFGTCLTQMLFIHNFT
GMESAVLLAMAYDRHVAICNPLRYSIILTNRVVVAIAVGVLVRSFLSVIPFVFLILRLPFCGNHIIPHTYCEHMGLARLACASIRINIIYGLGAISILVFDIIAIAISYG
QILQAVFRLPSRDARLKALSTCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLENLYVVVPPMLNPVIYGVRTKQIRERVLKMFYKK*
413 >lcl|XP_001373057.2|Plus1complement(16198871..16199800) NW_001581971 olfactory receptor 4P4-like LOC100020628 __SEG__ Chr5 {Monodelphis domestica} MENQNNVTEFVLLGLFMNEEVKVICFVIFLLCYFAIFFGNIIIFITITCSHLIQQPMYYFLCHLSYMDLAYTSTVVPRLIRDLIAKQKYISYNCCMTQLFTAHFLSGVEV
FILVSMAFDRYVAICKPLHYMIIVNRQRCNIMILMAWVVAFWHAISQMLMVIRLPFCGPNQVDHYICDVKALLKLVCTDTRIPNILVIANTGMLVLATFLVLVASYIVIL
YNLRNHSSEARRKALSTCASHVMVVVLFFVPCIATYIPPPSASQNDKEFSMFYTVIAPMMNPLIYTLKNTEMKNAMKKVWSKKMFLKFK*
414 >lcl|XP_001373072.2|Plus1458550..459485 NW_001581929 olfactory receptor 52E1-like LOC100020648 __SEG__ Chr4 {Monodelphis domestica} MFNLNNTQFHPNSFLLLGIPGLEEVHIWIGFPFCVVYLTALLGNITILFVIQSDKSLHHPMFYFLAILSSIDLGLSTSTIPKMLGIFWCSLREISFIGCVTQMFFIHLFT
GMESAVLLAMAYDRYVAICNPLRYTLVLTNKVVSIIAIAIALRPLSMVIPFVLLILRLPFCGHHIIPHTYCEHMGIARLACASIKINIIYGLGAISILVFDIVAIVVSYV
YILRAVFHLPSRDARLKALSTCGSHVCVMLAFYTPAFFSFMTHRFGRNIPRYIHILLANLYVVFPPALNPVIYGVRTKQIREKVLKTFSPK*
415 >lcl|XP_001373077.2|Plus116234321..16235259 NW_001581971 olfactory receptor 4P4-like LOC100020653 __SEG__ Chr5 {Monodelphis domestica} MNNRNNVTEFIFMGFSPNIQVQILYFVIFLFCYIAILMGNFIVIISITCSQLIEQPMYFFLAYLSFMDVCYTSTVTPKLISDTLAERKSISYTNCLIQLFTVHFFGGVEV
FILTGMAYDRYVAICKPLHYMTIMSRHRCNTLIVAACGGGFVHSFAQFLLAFLLPFCGPNAIDHYFCDMYPLLKLACTDTYNLGLLVIANSGMIALVVFMVLMASYAVIL
YTLRAHSSESRQKALSTCGSHITVVVLFFGPSLFIYIRPATTFQEDKVLALFYTIIAPMFNPLIYTLKNSEMKNTMKKVWSRNLFGGRKQLL*
416 >lcl|XP_001373097.2|Plus1complement(16271794..16272723) NW_001581971 olfactory receptor 4P4-like LOC100020689 __SEG__ Chr5 {Monodelphis domestica} MEHRNNVTEFILLGLFNNQEVKEACFVFFLLCYLVILLGNLFILTTIRFSQLSEQPMYFFLSYLSFMDVCFTSTVAPKLIVDLLAQRATISYDNCMTQMFYTHFFGATEI
FILVAMAYDRYVAICKPLHYMVIMRRRVCHLFVLVSCIVAFIHSIMQILIVVQLPFCGPNKVDHYFCDVFALLKLACTDTFLIVIVIIGTSGMLALLTFVVLVISYVIIL
TTLRTQSSKGRHKAFSTCASHITVVLMFFVPLIFTYVPTGNSFSDDKVFALFYTIIAPMFNPLIYSLRNTDMKNAMRKVWLQKLFSKGK*
417 >lcl|XP_001373111.2|Plus116300094..16301029 NW_001581971 olfactory receptor 4P4-like LOC100020713 __SEG__ Chr5 {Monodelphis domestica} MKYRNNITEFVLLGLSQNNEVQILCFILFLFCYVVLLMGNLIIMISILGSKLIDQPMYYFLAYLSLVDVCYTSTVTPKLISDLLVEKKRISYNNCLIQVFTIHLFGAIEI
FVLTGMAYDRYVAICKPLHYQVIMSRKRCNIMVIVAFVWAILHSFSQSVLLMLLPFCGPNEINHYFCDVYPLLELACIDTQREGLLVVVSSGMVALVVFIVVMGSYIMIL
YSLRGHSSESHQKALSTCGSHITVVVLFFGPVLFIYIRPATTFKEDKVFALFYTIIAPMLNPFIYTLKNEDMKNAIMNIWRNNFLRRNLIF*
418 >lcl|XP_001373126.2|Plus1complement(39175461..39176870) NW_001581970 alpha-2C adrenergic receptor-like LOC100020740 __SEG__ Chr5 {Monodelphis domestica} MDLQLTTNSTDSGDRGGSSNESLERQPPSQYSPAEVAGLAAVVSFLIVFTIVGNVLVVIAVLTSRALKAPQNLFLVSLASADILVATLVMPFSLANELMNYWYFGKVWCD
IYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKGIIVTVWLISAVISFPPLISLYRDPEDDLYPQCELNDETWYILSSCIGSFFAPCIIMVLVYVRIYR
VAKLRTRTLSEKRTVPEGSSQTENGLSRPPVGAGPSTAAAAAASLRLQAGENGHYHLHHHHHHLHHHHHHHHHQLRKSAELEDIELEESSTSENRRRRRSREEAAARKGS
RGFSFSFSSTKGGQSAGAGSRLSRASNRSLEFFSSHRRRKRSSLCRRKVTQAREKRFTFVLAVVMGVFVVCWFPFFFTYSLYGICREACQVPETLFKFFFWIGYCNSSLN
PVIYTIFNQDFRRSFKHILFKKKKKTFLQ*
419 >lcl|XP_001373127.2|Plus116335465..16336409 NW_001581971 olfactory receptor 5D13-like LOC100020741 __SEG__ Chr5 {Monodelphis domestica} MRNANRNESDAIIFILLGFSDYPELQIPLFLVFLIMYMITVVGNLGMIVIIRTNPKLHIPMYFFLSHLSFLDFCYSTVVTPKLLQILIVEDRTISFAPCITQYSFAAICV
VTEAFLLAAMAYDRFVAICNPLLYIVVMSQKRCILILTGVYTWGLISSLIFIYSLLILSFSGINIINNFLCEYSAILSASISDKHVTELIFFILANFNTFSTLIVVLTSY
LFIFITVLKMQSASGRYKAFSTCASHLTGVTIFFGTILFLYCLPSSKSSWLLVRVNTIFYTVVIPMLNPLIYSLRNKDVKESIRRLMDIKIFSH*
420 >lcl|XP_001373139.2|Plus1518043..518981 NW_001581929 olfactory receptor 52M1-like LOC100020762 __SEG__ Chr4 {Monodelphis domestica} MSPTNVSHFSAFYLVGIPGLEYLHTWIGIPFCSLYVVAVVGNVTIVSVVRAERSLHEPMFLFLCMLSVTDLVLSTSTLPRMLCLFWLGSHQIAFDACLTQMFFIHSFTAM
ESGFFLAMAFDRYVAICEPLRHATILTNSRIAKIGGAVVLRGMAFFSPHPILLKQLPYCRSHRIAHTYCEFMAVVKLACVDTGSTKRYSLSVASVIGSCDGFFIAISYVL
ILRAVFRLPSREASLKALGTCGSHVCVILVFYSTAVFTFLTHRFGHNVPPQVHIFIANMYLLVPPFLNPIVYGVRTKKIRDYVLGALRVKVI*
421 >lcl|XP_001373155.2|Plus1539871..540815 NW_001581929 olfactory receptor 52B2-like LOC100020786 __SEG__ Chr4 {Monodelphis domestica} MSSCNNSIPQPEVFLLAGIPGLESYHSWFSLPFFLVFIIAFIGNITIIFIIHTEKSLHEPMFLLLAMLSVVDLSLVSATVPRMLGIFWLDAKEIRIDGCLTQMFFIPSFY
VMESGILLAMAFDRFIAICNPLRYTTILANNSLVKMGLAVIARTIVVLTPAPILAKRLTSFQTNIIPYSYCAYMAMVQIACGDISNYIVYGLMVIVTSIGVDLLFISLSY
GMILRAVFRIPSWEARHKALSTCGSHLCVIALFYSPVVFSFLAQTFGYQMPPHFQIIVDNLYFLVPPMINPLIYGARTKQIRERVLQVLGCHPK*
422 >lcl|XP_001373158.2|Plus116382855..16383799 NW_001581971 olfactory receptor 5D14-like LOC100020790 __SEG__ Chr5 {Monodelphis domestica} MMCADQNQTSEIMFILLGFSDYPDLQVFLFFVFLIIYTVTVVGNLMMILIIRISPKLHTPMYFFLSNLSFVDFCYSTTNTPKLLEILVVDDRVISFLSCITQLFLTATCV
VTEAVLLAVMAYDRFVAICNPLLYTVAMSQKLCILLVVMAYSWGIISSIIFTYSLLVLSFCRTNIINNFFCEYSAIFSSSFSDKHFTEIILFSLTNFNTFCTLLIILTSY
LFILVTIMKMPSTSGRHKAFSTCASHMTAVIIFYGAILFLYCVPSSKSSWLLIRVSTVFYSVVIPMLNPLIYSLRNKDVKETVKKLMDFKICSN*
423 >lcl|XP_001373176.2|Plus1complement(575401..576345) NW_001581929 olfactory receptor 52M1-like LOC100020819 __SEG__ Chr4 {Monodelphis domestica} MILANASQFSPSTFFLMGIPGLEHLHTWIGIPFCSMYIVAVAGNMTILAVVRAEQSLHEPMFLFLCMLSVTDLVLSTSTMPRMLCLFWFGYHEIAFDACLTQMFFIHSFT
AMESGFFLAMAFDRYVAICNPLHHTTVLTHIRIAKIGVAMVLRGVVFFSPHPILLKQLPYCRTRIIAHTYCEFMALVKLACADAGATKRYSISMAGVFGCCDASFIAISY
VLILRAVFHLPSREARLKALGTCGSHVCVILVFYSTAGFTFLTHRFGFNVPPHIHIFIANMYLLVPPFLNPIVYGIRTKKIRDRVLGALRIKVV*
424 >lcl|XP_001373179.2|Plus116400372..16401316 NW_001581971 olfactory receptor 5D13-like LOC100020822 __SEG__ Chr5 {Monodelphis domestica} MVSANRNQSATVMFILLGFSDFPDLQVLLFMVFLAIYVVTIVGNLGMIVIIRYNPKLHTPMYFFLSHLSFVDFSYSTIITPKLLEILVVEDRTISFVGCIMQFSFAVTCV
VTEMFMLAVMAYDRFVAICNPLLYTVSMSQKLCAILVTISYSWGLISCGVFTYSLLILSFCGINTINNFLCEYSAILSASFSDKHLTEVILFSLSNFNTLCTLGIILTSY
IFIFITVMKMPSTSGRRKAFSTCASHLTAVTIFFGTILCLYCVPSSKSSWLMIRVSTAFYTVVIPMLNPLIYSLRNKDVKETFRKLMDIKVFSH*
425 >lcl|XP_001373197.2|Plus1complement(590962..591906) NW_001581929 olfactory receptor 52K1-like LOC100020848 __SEG__ Chr4 {Monodelphis domestica} MSSSNWTNLHPATFILIGIPGLETVHIWISIPFCFVYMSALLGNFSLLFIIKSDLRLHEPMYLFFCMLATADLIICTTAMPKLLSLFWFKDREIYFEACLTQVFLIHSLS
SMASGFILAMAFDRYVAICKPLRHSTILTNKVIVGIGLAIVLRGALLFSPHPFLLKWLPYCRTNIISHTYCEFMALIKLACAQTRVRRTYSLIVAFLTGGLDFILIICSY
VLILYAVFCLPSKAARLKALGTCGSHVCAILVGYTPAFFSFLTHRFGRHVPPHVHIFVANIYLLVPPMLNPIIYGLMTKRIRERFLQILSPSKL*
426 >lcl|XP_001373198.2|Plus116413858..16414802 NW_001581971 olfactory receptor 5D13-like LOC100020852 __SEG__ Chr5 {Monodelphis domestica} MVSPDRNQSGAVIFILLGFSDYPDLKVPLFLLFLMIYVVTVLGNLGMIVIIRINLKLHTPMYFFLSHLSFVDFCYSTGVTPKLLENLVVEDRKISFGNCITQYFFTATSV
LTEAFLLAVMAYDRFMAICNPLLYMVNMSQKRCTLLVTGAYTWGIASSLIFTYSLIILSFCGTNIINNFVCEYSVILSASCSDRHISEMILFILANFNVLSTLLTILTSY
ILIFVTIIKMHSASGRYKAFSTCASHLTAISIFYGTLLFLYCVPNSKSSWLIIKVTSVFYTMVIPMLNPLIYSLRNNDVKEAVRKIMDSKIFSS*
427 >lcl|XP_001373233.2|Plus116438701..16439645 NW_001581971 olfactory receptor 5D13-like LOC100020907 __SEG__ Chr5 {Monodelphis domestica} MVNTDQNQSTTIMFILLGFSDYPELQVPLFLLFFTIYSITVVGNVGMIVIIRTNPKLHTPMYFFLGHLSFVDFCYSTIVTPKLLENLVVEDRTISIKGCISQFTIGVIFV
VTEMVMLAVMAYDRFVAICYPFLYSVFMSPKFCALLVTIAYTWGTISSIMLTYSLLILSFCETKIINNFACEYSVILSASCSDKHFSEVILFIFANLSAFCTLIIILISY
LFIFVTILKIHSASGRCKAFSTCASHLTAVSIFYGTILFLYCIPHSKNSWLVVKVGSVFYTVVIPMLNPIIYSLRNNDVKETFRKLKDLRIISQ*
428 >lcl|XP_001373252.2|Plus1688865..689809 NW_001581929 olfactory receptor 52K1-like LOC100020935 __SEG__ Chr4 {Monodelphis domestica} MSALNWTNLHPNKFLLLGIPGLETIQIWISIPFCAVYILAFLGNCTLLVIIKNDSSLHEPMYLFLSMLSVADLMITTTTLPKILSLFWFNDREIYLEACLTQIFLIHSLT
TMESGFFLAMAFDRYVAICNPLRHSVILTNSIIRGLGLAIVTRGVILLSPHPFMLRWLPYCKTNIIPHTYCEFMALIRLSCAQTKIHRAYSLSVAFLTAGLDFILIICSY
ILILHTVFRLPSKEARLKSLGTCGSHVWVIMTFYTPAFFSFLTHRFGHHIAPHVHILVANIYLLIPPMVNPIIYGVKTKRIRERFLKIFMNKIP*
429 >lcl|XP_001373253.2|Plus116446889..16447833 NW_001581971 olfactory receptor 5D13-like LOC100020937 __SEG__ Chr5 {Monodelphis domestica} MVTTAKNQNASVIFILLGFSDYPDLQVPLFLLFLSIYLVTVVGNVGMIVIIRISSKLHTPMYFFLRHLSFVDFCYSTGVTPKLLENLVVEDRTITIEGCITQFFFTASFV
VTETFLLAVMAYDRFVAICNPLLYTVTMSQKLSGLLVAAAYSWGLISSLIFTYSLLVLSFCGTNIIHNFLCEYSVILSASCSDKHFSEIILFIVANFNALCTLIIIFTSY
ICIFITILKIPSASGRHKAFSTCASHLTAVTIFYGTILFLYCIPNSKSSWLIVRVTSVFYTVVIPMLNPLIYSLRNKDVKETLRNLMDVKNFTD*
430 >lcl|XP_001373268.2|Plus1712333..713283 NW_001581929 olfactory receptor 52A5-like LOC100020961 __SEG__ Chr4 {Monodelphis domestica} MPSSNRTFFNPSVFTLIGIPGLESVQHLIGIPFFISFTLAVIGNSLLIVIIRAERSLHEPMYIFLAVLAATDLGLTLCITPKMLAIFWLWMREIDFNSCLVQMYFTHTFQ
CMESGILLAMAFDRYIAICNPLRHSAILTKKVLINIILAVTIRAAIIIIMCPLLIKLRLKVFKTTFISHSYCEHMAIVRLAAVNTKANKIYGLFVAFSVLGFDVIFIFTS
YSLIFRAVFKLPQKEARLKAFNTCTAHIFVFLQFYILTFFTSFIHRFGFNVAPYVHILLSNLYLLVPPLLNPIVYGVKTKQIREGMIKIFHSKGAS*
431 >lcl|XP_001373271.2|Plus116462123..16463082 NW_001581971 olfactory receptor 5D13-like LOC100020964 __SEG__ Chr5 {Monodelphis domestica} MLSTDKNQSGMVTFILLGFSDKPELQFPLFLVFLVIYIVTVVGNLGMIMIIKINPKLHTPMYFFLSHLSFVDFCYSTVVTPKLLENLAVADRMMSFRGCITQFFFACTFV
VTETFLLAVMAYDRVVAISNPLMYTVAMSQTLCTFLVTGAYAWGIVNSLVIMSSLLSLSFCRFSILNNFVCEYSVILSASCSDTYVSEMLLFTFATFNEVSTLLIILTSY
LFILVTLIQMDSAKGRRKAFSTCASHFMAISIFHGTILFLYCVPRNQNLNEEIKVASVFYMVIIPMLNPLIYSLRNKDVKETVINLRFTKILHQFICSC*
432 >lcl|XP_001373307.1|Plus1complement(739894..740826) NW_001581929 olfactory receptor 51L1-like LOC100021015 __SEG__ Chr4 {Monodelphis domestica} MDSFNNSDFRPLFLTGFPGLEASHPQISVLFCVLYLIAIIGNSLILVVVWQEQSLHEPMYYFLSMLAASDLSLCATTLPTLLKLFWLNARQIAFDSCLVQMFFIHVFSLM
ESGILLTMAFDRYVAISNPLHYATILTNATIVKIGFGLMLRATAVILPGPFLIKRLKFCKANILSHSYCLHPDIIKLSCSDHHINSIYGLIIVIITFGVDSVLILLSYLR
ILITVLGIASHQEQLKALNTCVSHICAVLLVYIPMLGVSIIHRFGKHVPPVVHIIMGYVYLLVPPVLNPVVYCIKTHQIRTRILRLWQTK*
433 >lcl|XP_001373313.2|Plus116471098..16472042 NW_001581971 olfactory receptor 5D14-like LOC100021023 __SEG__ Chr5 {Monodelphis domestica} MLNTDYNKSSVITFMLLGFTDYPELQVPLFLVFLAMYVITTVGNLGMILIIRINPKFHTPMYYFLSHLSFVDFCYSSIVTPKLLENLVMDDKRIFYSSCMLQYFLSCTAV
VTESFLLAVMAYDRFVAICNPLLYTVIMSQKLCGFLVAASYLWGMFGPFVLLCFALQLTFTGYRIINHFFCEYTALISVSSSDIHIPHLLLFGFATFNEVSTLIIILASY
AFIFVTILKMNSTSGRRKAFSTCASHLTAITIFHGTILSLYCVPNSKNSRHTVKVASVFYTVVNPMLNPLIYSLRNKDVKEAFRKLIFRNTFSQ*
434 >lcl|XP_001373332.2|Plus116482314..16483285 NW_001581971 olfactory receptor 5D18-like LOC100021052 __SEG__ Chr5 {Monodelphis domestica} MVTSKGNHSSVATFVLLGFTDYPDLQVPLFLIFLIIYSITVVGNLGMIGIIRINPKLHTPMYFFLSHLSFVDFCYSSIIAPKMLIDLLIEDRSISFSGCLVQFSFFCTFV
VTEAFLLAVMAYDRFVAICNPLLYTVVMSQKICALLVAGSYTWGTVCSLLLTCSAIHLSFYGSNTINHFFCEFSTLLTLSCSDTHFNQMLLFISATFNGMSTLLIILASY
VIIFVTVLRMNSSSGRRKAFSTCASHLMAITIFHGTILVLYCVPNSQNSKVMFKVASVFYTVIIPMLNPIIYSLRNKEVKETVIKLMDINIKIRDILHVHINT*
435 >lcl|XP_001373349.1|Plus1769764..770735 NW_001581929 olfactory receptor 51I2-like LOC100021078 __SEG__ Chr4 {Monodelphis domestica} MTQETKSHYLLNLNSSQFQPPFFLLTGIPGLESAHTWISIPLCIMYLIALLGNSIILFIIKTTPSLHEPQYIFLSMLAATDIGLSISTLPTVLNVFLLNQREIEFHCCLA
QMFFIHTFSSMESAILLAMAFDRSVAIRNPLRYTVILTYPRIVGMGLVAVVRGVALMAPLPILLKRLPFCKNIILSHCYCYHPDVMKLACGPVRVNIIYGLTLVLCSFGV
DSVFIVISYVLILKTVMSIASNEGRLKALNTCVSHIVTVFIFYVPLIILALIHRFGTFTSPLFHVTMANLFLFLTPVLNPLVYSFKTKQIRSVMQKAFMTRGS*
436 >lcl|XP_001373355.2|Plus116494741..16495685 NW_001581971 olfactory receptor 5D18-like LOC100021084 __SEG__ Chr5 {Monodelphis domestica} MVTSERNHSSIATFVLLGFTDYPDLQVPLFLVFLAIYSITVVGNLGMIGIIRINPKLHTPMYFFLSHLSFVDFCYSSIIAPKMLVDLLIEDRSISFSGCLVQFFFFCTFV
VTESFLLAVMAYDRFVAICNPLLYTVAMSQRLCALLVAGSYTWGTICSLLLTCSAVQLSFYGSNTINHFFCEFSSLLTLSYSDTYFNQMLLFISATFNEVSTLLIILASY
VFIFVTVLKMNSSSGRRKAFSTCASHLMAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKETAMKLMVIKISSP*
437 >lcl|XP_001373366.2|Plus116506866..16507837 NW_001581971 olfactory receptor 5L2-like LOC100021101 __SEG__ Chr5 {Monodelphis domestica} MEEEENCTSVTEFMLLGFSDHPELHVFLFLIFLVIYTITVWGNLGMIILIKISPRLHTPMYYFLSHLAFVDLCYSTIIVPKTLVNILTENQVISFLSCIIQFYLFSTCVI
TEVILLAVMAYDRFVAICNPLLYMIAMSQKLCVQLVCGSYICGTVCSLIHTCSALKISSYRSNIINHFFCDLPPLLSLSCSDVSINELLLFIVACFNEIGTIMIILTSYI
FILITILRIPSSEGRRKAFSTCASHFTAIVVFHGTILFIYCRPGSGNTLDSDKVATIFYTVVIPMLNPLIYSLRNKDVKDAFRKVIDSKKMSLCPKLGGIREH*
438 >lcl|XP_001373380.2|Plus1792267..793238 NW_001581929 olfactory receptor 51I2-like LOC100021121 __SEG__ Chr4 {Monodelphis domestica} MTRVTKSHYVLNLNGSQFQPPFFLLTGIPGLEAAHIWISIPLCVLYMIALLGNSSILFIIKTTPSLHEPQYIFLTMLAATDIGLSISTLPTVLKVFLLNHREIEFHCCLT
QMFFIHTFSSIDSAILLAMAFDRFVAIRNPLHYTMILTHAKIIRMGLAAVVRGVALMTAWPILLKWLPFCKNIILSHCYCYHPDVMKLACGPVRVNIIYGLAVVLCSFGL
DSLFIIISYALILKTVMSIASNEGRLKALNTCISHIVTVFIFYVPLIILALIHRFGTFTSPLIHVTMANLFLFLTPVMNPLVYSFKTKQIRSVIQKAFVTRGS*
439 >lcl|XP_001373390.2|Plus1complement(23817055..23818002) NW_001581838 olfactory receptor 10A4-like LOC100021136 __SEG__ Chr1 {Monodelphis domestica} MDWENWITVDEFFLVSFPALHPELQILLFLLFLFIYFVTFMGNVLIILVTTADSALHSPMYFFLRNLFFLEISFNMVIVPKMLSTLLPKNTTISFVGFATQMYFFFFFGA
AECCLLATMAYDHYVAICNPLRYPVIMDQQACVQLAAASWFSGFPVATVQTSWIFSFPFCGPNKVNHFFCDSPPVIALVCADTSLFELEALTATILFILFPFLLILGSYV
RILSTIFRMPSAEGKQKAFSTCSSNLVVVSLFYSTAILTYFRPRSNTSPETKKLLSLFYTVVTPMLNPIIYSLRNSEVKAALHRTLQKALGAQKL*
440 >lcl|XP_001373397.2|Plus1complement(803651..804607) NW_001581929 olfactory receptor 51I1-like LOC100021148 __SEG__ Chr4 {Monodelphis domestica} MLTYNSTTFQPAFFILTGLRELAGARLWLSPLLSLMYFITFLGNCTLLYLVKIDHSLQEPQYLFLSMLAGADLGLSVSTLYSVFLVYILGINEITFDGCLTQLFFIHTFS
SMGSGILLSMAFDHFVAISHPLHYTTILTHTRIAKMGMATFLRGVFLMTPLPILLKRLPFCKGQTLSYSYCLHPNVMKLACGRVKINIFYGLVLVLCSFGLDSVLIGLSY
VLILRAVLGIASKEGRLKALNTCISHIFIVLIYYMPHLSITLMHRIPHQSSPLTHAVLGNLYLFMPPLVNPVVYSLKTKQIRTAIQKTFKAWKKGIGT*
441 >lcl|XP_001373406.1|Plus1complement(827164..828150) NW_001581929 olfactory receptor 51G2-like LOC100021171 __SEG__ Chr4 {Monodelphis domestica} MTWNYSEQDLSHAILPTYNSTDIQPSVFILTGLRGLPGAHMWLGPLLSLMYTITLACNCTLLYLVRIDHSLWEPQYLFLSMLAGADIALSISTLCSVLQVFVFGHHEITI
DGCLSQLFFIHTFSSTGSGILLSMAFDRFVAISHPLHYTTILTHPRITKMGLAAFLRGITLMTPLPILLKRLPFCKGQTLSYSYCQHPDVMKLACGPVKINIFYGLIMVI
CSFALDFLLIVLSYTLILRSVLGIASREGQLKALNTCLSHIFIVLIFYMPLLAIALLHRINRKSSRLTYAVLGNFYLFMPPMFNPIVYSLKTKKIRDALQKSFSSWRT*
442 >lcl|XP_001373408.2|Plus116580280..16581203 NW_001581971 olfactory receptor 10AG1-like LOC100021175 __SEG__ Chr5 {Monodelphis domestica} MAEANFTVVMEFILLGFSDLPNLQGFLFGIFLIIYTSILIGNGLIIVITKVTAALQTPMYFFLGNFSFLEICYTSVTMPRMMSDLWTKKKNISLLACAVQLGFLLSLGGT
ESFFLAVMAYDRYVAICKPLYYPLIMNPQKCLQLVTGAWISGIPVQIAQTCNIFSLSFCGSNKLNHVFCDMPPLLKLACGDTSLNELFVYAGAMIFVTIPSVLILLSYIK
ILKTILKLPSAMGRRKAFSTYSSHLMVVGLFYGSAFITYFRPKSSHSSGADKILALFYTIVTPLFNPIIYSLRNKDVIMAIKQLVPK*
443 >lcl|XP_001373423.2|Plus1842678..843649 NW_001581929 olfactory receptor 51I2-like LOC100021201 __SEG__ Chr4 {Monodelphis domestica} MQILNGTRYQPIYFLLSGIPGLESMHIWISIPLSVMYVIALLGNSIILYIIQKTPSLHEPQYIFLSMLAGTDMAMSASTLPTVLNVFLFNHLEIEFHSCLAQMFFIHTFS
SMESAILLAMAFDRFVAICNPLHYTMVLTHSRIIGMGLVAVMRGVALMAPLPILLKRLPFCKSIILSHSFCFHPDVMKLACGSIRVNIIYGLALVLCSFGIDSVFIVLSY
AFILKTVLGIASQEGRLKALNTCVSHILTVLIFYVPLIALALIHRIGKYHSPLPHVTMSNIFLFLTPVLNPLVYSMKTKQIRAVLFRLFKTREDGGKGKIGSH*
444 >lcl|XP_001373429.2|Plus116591035..16591979 NW_001581971 olfactory receptor 10AG1-like LOC100021208 __SEG__ Chr5 {Monodelphis domestica} MEYAGRKMAGENLTVMMEFILLGFSDLPNLRGFLFGIFLVTYLSILIGNSLIIIITKVDAGLQTPMYFFLGNFSFLEICYTSVTLPRMLTNLWTQKRNISFLACSIQLCF
LLILGNSECFLLGVMAYDRYVAICKPLNYPLIMNQKMCFQLLVGSWITGIPVQIALTYQIFSLPFCGSNKLNHVFCDIPPLLKLACGDTSMNEFSVYADAVLFAMVPFLL
IVGSYVKIITTIFKLPSATGRHKAFSTCSSHLIVVGLFYGSGIIMYLRPKSSYSSGIDKVFSLFYTIVTPVFNPLIYSLRNKDVIAALRNLLTK*
445 >lcl|XP_001373442.2|Plus1complement(16600326..>16601294) NW_001581971 olfactory receptor 10AG1-like LOC100021227 __SEG__ Chr5 {Monodelphis domestica} FNDCHGLNTQEIMTVTNLTDMVEFILLGFSDLPNLQGVLFGIFLVIYMSILIGNGLILIITKVDPALQTPMYFFLGNFSFLEICYTSVTLPRMLMNLWSQKRHISLLACA
VQLGFLLILGGTECLLLGVMAYDRYVAICKPLNYPMIMNHRVCVQLVVASWVSGVPVQIGQTYQIFSLPFCGSKKLNHVFCDIHPLFKVACGDISLNEFSVYADAVLFAM
VPFLLIIGSYVKIISTILKLPSATGRSKAFSTCSSHLIVVALFFGSAIIMNLRPKSSQSEGIDKILALFYTIVTPMFNPLIYSLRNKDVIAAMKKIFQILVV*
446 >lcl|XP_001373456.2|Plus1871083..>872012 NW_001581929 olfactory receptor 51G2-like LOC100021252 __SEG__ Chr4 {Monodelphis domestica} MSLLNSSDFSTFLVTGILGLEDMHMWLSIPFSAIFLVTLAGNITIMLVIWTERSLHVPMYLFLAMLAASDLGLSISTFSTMLRIFWLEAREMSFPACFTQMFFIHSFQQF
ESAVILAMAFDRYVAISKPLHYASILTSGVIAKIGVAILVRTMAVQVPAPILLRRLHFCRSNVLSHSYCLHPDIIKLSCSNTRVNSVFGLFVVVSTLGLDFVLILFSYVL
ISKTVLKIASFGGRLKALNTCISHLSAVILFFTPMICLSLLHRFGPKLPSHVYVLIANMHFLIPPVMNPIVYVVKTKQIRDKVIRIFLKK
447 >lcl|XP_001373483.2|Plus1884342..885298 NW_001581929 olfactory receptor 51G2-like LOC100021286 __SEG__ Chr4 {Monodelphis domestica} MMSPLNNSDFIFSTFLVTGIPGLETMHMWLSIPFSMMFFVTLAGNITIMWIIWTERSLHAPMYLFLAMLTASDLGLSLSAFPTLIRILWLEAREMSFSACFTQMFFIHTF
QNFESAVILVMAFDRYVAISKPLHYASILTSSVIAKIGLAILLRTLTVEVPLPILLRRLHFCCSNVLSHSYCLHPDIIKLSCSDTRINSIFGLFTVLSTMIFDFLLILFS
YVLILKTVLSIASHGGRLKALNTCISHLCAVVLFFTPMVSLSMLHRFGPKLPSHVYVLLANMHFLIPPVMNPIVYVVKTKQIRERIIRILFRKGPGKP*
448 >lcl|XP_001373486.2|Plus116635152..16636111 NW_001581971 olfactory receptor 10AG1-like LOC100021289 __SEG__ Chr5 {Monodelphis domestica} MEYTEKMAEENLTIVVEFVLLGFSDYPKLQGFLFVMFLVIYLSILIGNGLIIIITKVDSALQTPMYFFLGNFSFLEICYTSVTLPRMLVNIWTQKRNISFLACAIQLGFL
LILGAPECLLLGVMAYDRYVAICKPLYYPLIMNHKVCVQLVVGSWTIGIPVQIAQTYQVFSLPFYGSNKLNHIFCDLRPVLKVAHGNTFVSELSIYAVAMLFGMAPFLMI
LWSYMKIVSTIQKIPSTTGKYKTFSTCSSHIMVVGLFFGSIIITYLQPKSSHSADNDKIFSLFYTILTPMFNPLIYTLRNRDVIIALKKLFKCGGTENN*
449 >lcl|XP_001373500.2|Plus1complement(16645533..16646462) NW_001581971 olfactory receptor 5W2-like LOC100021310 __SEG__ Chr5 {Monodelphis domestica} MDKNYSTPTEFVLLGITNDPERNMAFFVLFLIIYLGILITNIGMIILIWVDPQLHLPMYFFLSHMSFCDLCYSTAICPKMLVDFFAEDKSIPFIGCALQFYFFCTFTDSE
CLLLAVMAFDRYMAISNPLLYTVNMSSRVCYLLITGVYVVGMMDALLHTTLTFTLNFCRSNEINHFFCDVPPLLLISCSDTYINELVIFTVYGFIEMVTVSAVLISYCYI
ILSVLKIHSTEGRWKTFSTCTSHLAVVTIFQGTMLFMYFRPSSAYSLDQDKITSLFYTTVIPMLNPLIYSLRNKDVKGALEKVKNKICS*
450 >lcl|XP_001373518.2|Plus1complement(905754..906695) NW_001581929 olfactory receptor 51L1-like LOC100021334 __SEG__ Chr4 {Monodelphis domestica} MTIMASFNNSHFRPFLLTGFPGLEAFHPQISIVFCFLYLIAILGNGTILVVIWEEETLHQPMFLFLSMLAASDLGICITTLPTLFKLFWFNAREINIDACLVQMFFIHVF
SLMESGILLSMAFDRYVAISNPLRYTAILTNSVIMKIGLGLLVRAVSVIFPGPWLIKQMKFCKTNVLSHSYCLHPDIIQLSCSDHRISSITGLIIIISTFGTDSLLILLS
YLKILIIVLSIASQKEQLKALNTCVSHICAVLLVYIPMLGVSIIHRFGKYVPPVIHIIMGYVYLLIPPVLNPIVYCTKNHEIRTHIIRLFQPK*
451 >lcl|XP_001373541.1|Plus1928174..929118 NW_001581929 olfactory receptor 51G2-like LOC100021363 __SEG__ Chr4 {Monodelphis domestica} MVIPNIKNSSSFIFILMDLPGLEHAHHWTAIPVCTIYLLSFLGNITILYIVKTVPSLHTPMYLFLSMLSMADLGLSASTLPSMISVFLLGHREINSATCFAQLFFIHTFA
VIESAVLLAMAFDRCVAIREPLRYATILTNWRIGAIGLAIVTRSAGLHLPLLVLLNRLNFRSISTLSHSYCVHPDVLKMACSNTRVNSALGLFVMLSTLGLDVLLILFSY
VLILYTVLSIASNTERLKALNTCISHICAVLLFYTPTVSLSMIHRFGKKMPVQVYMLLSYLHFLVPPMLNPIVYSIKTKEIRVRILTMLYPKKF*
452 >lcl|XP_001373566.1|Plus1947590..948534 NW_001581929 olfactory receptor 51G2-like LOC100021392 __SEG__ Chr4 {Monodelphis domestica} MVIPNIRNSSSFIFILMDLPGLEHAHHWTSIPVCSIYLLSFLGNIAIMYIVKTVPSLHTPMYLFLSMLSMADLGLSASTLPSMMAVFLLGHREINSATCFAQLFFIHTFS
VIESAVLLAMAFDRCVAIREPLRYATILTNWRIGAIGLAIVTRSAVLHLPLPVLLNRLNFRSISTLSHSYCVHPDVLKLACSNTRVNSALGLFVMLSTLGLDALLILFSY
VLILYTVLSIASNTERLKALNTCISHICAVLLFYTPLVSLSMIHRFGKKMPAQVYMLLSYLHFLVPPMLNPIVYSIKTKEIRVRILRMLHPKKF*
453 >lcl|XP_001373568.2|Plus1complement(16685814..16686743) NW_001581971 olfactory receptor 5W2-like LOC100021395 __SEG__ Chr5 {Monodelphis domestica} MDKNYSSPTGFIFLGITNDPELNVAFFVLLLVIYLVILITNIGMIILIWVDPQLHLPMYFFLSNMSFCDLCYSTAIGPKMLVDFFAEDKSISFIGCALQFYFFCSFGDSE
CLLLAVMAFDRYMAISNPLLYTVNMSSRVCCLLIAGVYMVGMIDALLHTILTFTLSFCRSNEINHFFCDIPPLLLISCSDTHVNELMIFIVFGFIEVVSISAVLISYCYI
ILSVLKIHSTEGRWKTFSTCTSHLTVVTIFQGTVLFMYFRPSSAYSLYQDKMTSLFYTLVIPMLNPLIYSLRNKDVKGALEKLKNKICS*
454 >lcl|XP_001373635.2|Plus1complement(16784849..16785784) NW_001581971 olfactory receptor 10AG1-like LOC100021485 __SEG__ Chr5 {Monodelphis domestica} MVDTNITIMEDFILLGFSDFPNSQGFLFVVFLIIYVSILLGNGLIIIVTNVELALQTPMYYFLGNFSFVEICYTSVTLPRMLVNLWSQKRNISLLSCAVQLCFFLILASI
ESFLLAVMAYDRYVAICKPLYYPIIMNHKMCMKMVVGSWVSGIPVMIMQTYQVFSVPFCGSNKLNHIFCDMPPLIKLACGDISGDEFFLFVDCFLFGLIPFLMILMSYIR
ILNTILKLSSTTGRSKAFSTCSSHLIVVCLFYGSGLIAYLQSNFSYSGKTEKIFSVFYTIVTPMINPMIYSLRNKDFIAAMKRLFSKCVKN*
455 >lcl|XP_001373656.2|Plus1complement(16801033..16801989) NW_001581971 olfactory receptor 10AG1-like LOC100021516 __SEG__ Chr5 {Monodelphis domestica} MANTNLTIIEEFILLGFSEYPNVQGFLFVVFLFIYISIVLGNGLIIIITNMDSALHTPMYYFLRNFSFVEMCYTSNILPRMLVNIWRQKRNISLLSCAAQLCLFLILGAT
ETFLLAVMAYDRYVAICKPLYYPIIMNQRICVQMVFGSWVIGMPVLIGQTYQVFSGPFCGSNKLNHIFCDMPPLLNLSCGDTSGDEVFLYVDCFLFGLSTFLMILMSYIK
ILSTILKLPSTTGRSKAFSTCSSHVIVVCLFYGSGLIAYFQSVSSYSGSIDKFFSVFYTIVTPMINPMIYSLRNKDFIAAMKKLFSKWKGERLTKFLK*
456 >lcl|XP_001373672.2|Plus1complement(16816809..16817744) NW_001581971 olfactory receptor 10AG1-like LOC100021545 __SEG__ Chr5 {Monodelphis domestica} MEITNLTIMEEFILLGFSEYPNVQGYLFVVFLFIYICILIGNGLIIIITNVDSALQTPMYYFLGNFSFVEMCYTSNILPRMLVNIWRQKRNISLLSCAAQLCLFLILVVT
ESFLLAVMAYDRYVAICKPLYYPIIMNHRICVQMVFGSWVIGMPVLIGQTYKLFSGPFCGSNKLNHIFCDLPPLLKLACGDTSGDEFFLYVDCFLFSLTPFLMILMSYIK
ILRTVLKLPSTTGRSKAFSTCSSHVMVVCLFYGSGLTAYFHSLSSYSGSIEKIFSVFYTIVTPMINPMIYSFRNKDFIAAIKKMCSKSGDK*
457 >lcl|XP_001373689.2|Plus116849758..16850690 NW_001581971 olfactory receptor 10AG1-like LOC100021574 __SEG__ Chr5 {Monodelphis domestica} MAITNLTIMEEFILLGFSEYPNIQGFLFVVFLFIYISILLGNGLIIIITNVDSALQTPMYYFLGNFSFVEICYTSNILPRMLVNIWRQKRNISLLSCAAQLCFFLILAVA
ESFLLAVMAYDRYVAICKPLYYPIIMNHRICVQMVFGCWVIGIPILIGLTYQVFSGPFCGSNKLNHIFCDLPPLLKLACGYTSGEEFFLYVHSFLFGFTPFLMILVSYIK
ILSTILKLPLTAGRSKAFSTCSSHVMVVCLFYGSGLIAYFQSVSSSSGSIDKIFSVFYTIVTPMINPLIYSLRNKDFIVAMKKIFSKCGR*
458 >lcl|XP_001373705.1|Plus1complement(1157983..1158942) NW_001581929 olfactory receptor 51L1-like LOC100021601 __SEG__ Chr4 {Monodelphis domestica} MADFNASSIPSSTFYLTGIPGFETIHHWISIPFCILYFIGITGNCTILHAIWTDPSLHEPMYYFLAMLSFSDMGMCLPTLTSVLRVLWSISREIEFNTCVTQMFFIHAFS
FTGSGVLLAMAFDRYVAICHPLRYATILTPQRIARIGIFAFLRSSLPVIPLMIRLAYLPFCHSHVLSHSYCLHQDIIRLVCADTKFNFIYGLLLVTLFWGLDSLGILVSY
ILILHSVLSIASWEERLKALNTCASHICAVLILYVPMIGLSIVHRFAKHASPLVHVLMADIYLLVPPVLNPIIYSVKNKKIRRGILHLITHKRIHSTLR*
459 >lcl|XP_001373710.2|Plus1complement(16898523..16899455) NW_001581971 olfactory receptor 10AG1-like LOC100021606 __SEG__ Chr5 {Monodelphis domestica} MANTNLTIIEEFILLGFSEYPNVQGFLFVVFLFIYISIVLGNCLIIIITNVDSALQTPMYYFLGNFSFVEMCYTSNILPRMLVNIWRQKRNISLLSCAVQLCFFLILVVT
ESFLLAVMAYDRYVAICKPLYYPIIMNHRICVQMVFGSWVIGMPVLIGQTCQVFSVPFCGSNKLNHIFCDLPPLLKLACGDISGDEFFLYVDCFLFGLFPFLMILMSYIK
ILSTILKLPSTTGRSKAFSTCSYHVMVVCLFYGSGLIAYFQSMSSYSGNIDKFFSVFYTIVTPMINPMIYSLRNKDFIAAMKKFFSKWKG*
460 >lcl|XP_001373723.2|Plus1complement(1188784..1189743) NW_001581929 olfactory receptor 51L1-like LOC100021628 __SEG__ Chr4 {Monodelphis domestica} MAVFNASSIPSSIFYLTGIPGYEAIHHWISIPFCILYFIGIAGNCTILHAIRTDSSLHEPMYYFLAMLSFADMGMCLPTLASVLRVLWSISREIEFNTCVTQMFFIHSFS
FMESAVLLAMAFDRYIAICHPLRYTTILTPQRIARIGIVAFLRSSLPVIPLMIRLIYFPFCHSHVLSHSYCLHQDIMRLACADTKFNSIYGLVVIALYWGLDSLGILVSY
IFILRSVLSIASWEERLKALNTCASHICAVLILYVPMIGLSIVHRFAKHASPLVHVLMADIYLLVPPVLNPIIYSVKNKKIRRGIIYLFTPKRIHSTLR*
461 >lcl|XP_001373725.2|Plus1complement(16929679..16930602) NW_001581971 olfactory receptor 10AG1-like LOC100021630 __SEG__ Chr5 {Monodelphis domestica} MAITNLTIMEEFILLGFSEYPNVQGFLFGVFLFIYISILLGNGLIIIITNMDSALHMPMYYFLGNFSFVEMCYTSNILPRMLVNIWRQKRNISLLSCAVQLCFFLILGVT
ESFLLAVMAYDRYVAICKPLYYPIIMNHRICVQMVFGSWVIGMPVLIGQTYQLFSGPFCGSNKLNHIFCDLPPLLKLACGDNIWGELFLYLNCFLSGLTPFLLILVSYIR
ILSTILKLPSTTGRSKAFSTCSSHVMVVCLFYVCGLIAYFQSESNSSGSIEKIFSVIYTIVTPMINPMIYSLRNKDFITAMKKLFSK*
462 >lcl|XP_001373742.2|Plus1complement(1196018..1196977) NW_001581929 olfactory receptor 51L1-like LOC100021655 __SEG__ Chr4 {Monodelphis domestica} MADFNVSNSLSTTFYLTGIPGYEVAHHWISIPFCVLYLIGIIGNCTILHIVRTDPSLHEPMYYFLAMLSLTDMGMSLPTLVTLFRVLWSISREIEFNICVVQMFFIHTFS
FTESAVLLAMAFDHYVAICNPLRYATILTPQRIAKIGVAAFLRSAFCMIPLLALLAYFPFCHSHVLSHSYCLHQDMIRLACADTKFNVIYGLVLITVLWGFDSLGILVSY
IFILRSVLSIASREERLKALNTCASHICAVLILYVPMIGLSIVHRFAKDASPLVHILMAHIYLLVPPVLNPIIYSVKTKQIRRGVMRLLAPKRICSILE*
463 >lcl|XP_001373743.2|Plus1complement(16948231..16949166) NW_001581971 olfactory receptor 10AG1-like LOC100021659 __SEG__ Chr5 {Monodelphis domestica} MVDINITVMEEFILLGFSEFPKFQGFLFVIFLIIYISILLGNGLIIIITNVELALQTPMYYFLGNFSFVEICYTSNILPRMLLNLWSQKRNISLLSCAVQLFFFLLLAVA
ESFLLAVMAYDRYVAICKPLYYPIIMNHKICIKMVVGSWVSGIPILVGQIYQIFSVPFCGSNKLNHIFCDMPPLLKLVCGNIFGNEVFLYVDCFLFGLTPFLMILMSYIR
ILSTILKLPSTTGRSKAFSTCSSHVMVVCLFYGSGLIAYFQSKSSYSGSTDKIFSVFYTIVTPMINPMIYSLRNKDFIESMKRLFSKCVKN*
464 >lcl|XP_001373760.2|Plus141313915..41314973 NW_001581879 zinc finger and BTB domain-containing protein 44-like LOC100021683 __SEG__ Chr2 {Monodelphis domestica} MGVKTFTHSSPSHSQEMLGKLNMLRNDGHFCDITIRVQDKIFRAHKVVLTACSDFFRTKLVGQAEDDSKNVLDLHHVTVTGFIPLLEYAYTATLSINTENIIDVLAAASY
MQMFSVASTCSEFMKSSILWNTPNNQQEKGLDAGQENSSNCNFTSRDGSLSPVSSECSVVERTIPVCRESRRKRKSYIVMSPESPLKCSTQTSSPQVLNSSASYSEPRNQ
PVDSSLSFPWTFPFGIDRRLQSEKVKQVENPRTLELPGPSEAARRMTDYMTCESTKANLPLVTEKDVRVKVERLSDEEVHEEVSQPVSASQSSLSDQQTVPGSEQIQEDL
LISPQSSSKGIMSFVFLHIIIL*
465 >lcl|XP_001373763.2|Plus11211318..1212262 NW_001581929 olfactory receptor 52A5-like LOC100021686 __SEG__ Chr4 {Monodelphis domestica} MANGTVFMPSLLTLIGIPGLESVQCWIGIPFCGIYIIALVGNYMLLVIIQSERRLHKPMYLFLAMLGITDIALSTCILPKMLCVFWFHLQEIQFDVCLLQMWLIHTFQGI
ESGILLAMAMDRYVAICDPLRHGTIFTSQLLTQIGVGVTLRAGILMAPCLLLIKCRLKYYRTTVISHSYCEHMAVVKLAAEDIQVNKAYGLFVAFSILGFDVILILLSYV
RIFIAVFHLPQKEARLKAFNTCIAHIFVFLEFYILAFFSFFTHRFGFPIPPYVHILLSNLYLLVPPLLNPIVYGIKTKEIRDQVIKLVIFKNQA*
466 >lcl|XP_001373767.2|Plus1complement(16997976..16998908) NW_001581971 olfactory receptor 10AG1-like LOC100021691 __SEG__ Chr5 {Monodelphis domestica} MAITNLTIMEEFILLGFSEYPNVQGFLFVVFLFIYISILLGNGLIIIITNVDSALQTPMYYFLGNFSFVEMCYTSNILPRMLVNIWRQRRNISLLSCAAQLCFFLILGVT
ESFLLAVMAYDRYVAICKPLYYPIIMNQKICVQMVFGSWVIGMPVLIGQTCQVFSGPFCGSNKLNHIFCDLPPLLKLACGDTSGDEFFLYVDCFLFGLTPFLMILMSYIR
ILSTILKLPSTTGRSKAFSTCSSHVMVVCLFYGSGLIAYFQSKSSYSGSIDKIFSVFYTIVTPMINPMIYSLRNKDFIAAIKKLFSKWKG*
467 >lcl|XP_001373791.2|Plus1complement(17030614..17031546) NW_001581971 olfactory receptor 10AG1-like LOC100021726 __SEG__ Chr5 {Monodelphis domestica} MAITNLTIMEEFILLGFSEYPNVQGFLFVVFLFIYISILFGNGLIIIITNVESALQTPMYYFLGNFSFVEICYTSNILPRMLVNIWRQKRNISLLSCAVQLCFFLILGVT
ESFLLAVMAYDRYVAICKPLYYPIIMNHRICVQMVFGSWVIGMPVLIGQTYQVFSGPFCGSNKLNHIFCDMPPLLKLACGDTSGDEFFLYVDCFLFALPPFLMILMSYIR
ILSTILKLQSTTGRSKAFSTCSSHVMVVFLFYGCGLIAYFQSMSSSSGSIEKIFSVFYTIVTPMINPMIYSLRNKEFIAAMKKLFSKWGR*
468 >lcl|XP_001373807.2|Plus11285616..1286569 NW_001581929 putative olfactory receptor 52P1-like LOC100021749 __SEG__ Chr4 {Monodelphis domestica} MVKNSTEHSFSAFFLVGIPGLEAFHCWFSIPIFLLYTLTLLGNTLIIFTIKSEPSLHQPMFYFLCMLGLNDMAVASSTAPRMLSIFWLNAHFIEFDACVAQMYFIHTFSI
IESALLVCMAFDRYVAICHPLHYGTILTTSLVIRMGVVGTARAIIMVLPCPLLILRLPFCTKYIIKHAYCEHMAIVKLACANTLINRAYGISVALSVMVIDLGLITVSYI
KILQAVFRLSSKEARSKALGTCAAHVSTILVSYIPALFSFLTHRIGKKVPPSIHIIFASIYLLVPPTVNPLIYGVKTKQIRDRVMQMFFPNQKAGEH*
469 >lcl|XP_001373809.2|Plus1complement(17043629..17044561) NW_001581971 olfactory receptor 10AG1-like LOC100021751 __SEG__ Chr5 {Monodelphis domestica} MSDINLTIMEEFILLGFSEYPNVQVFLFVTFLVIYINILLGNGLIIIITNLEAALQTPMYYFLGNFSFVEICYTSVTLPRMLVNLWSQKGNISLLSCAVQLCFFLILAAV
ESFLLAVMAYDRYVAICKPLYYPIIMNHKMCMKMVVGSWVSGIPVMIMQTYHVFSVPFCGSNKLNHIFCDMPPLIKLACGDISGDEFFLFVDCFLFGLIPFLMILMSYIR
ILSTILKLSSTTGRSKAFSTCSSHVMVVCLFYGSGSIAYFQSESSSSGSRDKIFSVFYTIVTPMINPMIYSLRNKDFIAAMKKLFSKWGG*
470 >lcl|XP_001373825.2|Plus1complement(1304639..1305619) NW_001581929 olfactory receptor 51I2-like LOC100021778 __SEG__ Chr4 {Monodelphis domestica} MKPWNHSMAISNDSNVLSSIFYLTGIPGYEEAHCWISIPFCLLYLIGIVGNSTILHIIRTDPSLHEPMYYFLAMLSLTDMGMSLSTLPTVLRIFWFNANEITFDACVIQM
FFIHSLSLMESAVLLAMAFDRYVAICNPLMYAVILTPRRIVKMGVILLLRSTTLLPPLLIRLLWYPFCSSHVLSHSFCLQQDMIRLSCADTTFNVMYGLALIILFWGVDS
LGIIMSYIFILRSVLRIASREERLKALNTCASHICAVLILYVPMIGLSMVHRFAKHSSPLVHILMANIYLLVPPVLNPIIYSVKTKQIRRGIFRMLAPQRLLSTLK*
471 >lcl|XP_001373829.2|Plus1complement(17065020..17065952) NW_001581971 olfactory receptor 10AG1-like LOC100021783 __SEG__ Chr5 {Monodelphis domestica} MAITNLTIMEEFILLGFSEYPNIQGFLFVVFLFIYISILLGNGLIIIITSVESALQTPMYYFLGNFSFVEICYTSNILPRMLVNIWRQKRNISLLSCAAQLCFFLILGVT
ESFLLAVMAYDRYVAICKPLYYPIIMNQRICVQMVFGSWVIGIPVLIGLTYQVFSGPFCGSNKLNHIFCDLPPLLKLACGDTSGDEVFLYVHCFLFGLTPFLMILMSYIR
ILSTILKLPSTTGRSKAFSTCSSHVMVVCLFYGSGLIAYFQSMTSSSGSIDKIFSVIYTIVTPMINPLIYSLRNKDLIVGIKKLFSKCGG*
472 >lcl|XP_001373845.1|Plus1683468..684463 NW_001581884 G-protein coupled receptor 35-like LOC100021803 __SEG__ Chr2 {Monodelphis domestica} MNQSNCSTERSDLFQTISTLYLVILLVLGTALNVLALWVFCCRMRRWTEMRVYMANLAGADCCLLLSLPVVLYTMNRDHWEGSFLCTVSQSIYLINGYMSISIITAIAMD
RYAAIQYPLRARKWRSPQQAAGTCAVLWLLVICVVSLPAAWKQDGKSFCFGKSQTRSFWAIVSSLVLFFIPFVILVFCSVRVLRNLVRKKAQEPTQGRRLFRKAYHVVLA
NLIIFMVCFLPQHVALLAKLVAEYMEASCPIIQHVITSVRVASRLANANCCLDALGYYYVVQEFQEEVGMFLAMPKFLQSQTPDCPGSDYPDLPEGKVEVALKSAQALHD
S*
473 >lcl|XP_001373848.2|Plus1complement(1314661..1315620) NW_001581929 olfactory receptor 52Z1-like LOC100021807 __SEG__ Chr4 {Monodelphis domestica} MVSFPSNNTNFQDIRYILIGIPGLEDSHTWISIPICSMYLVAIIGNSFLIFLIIIERSLHEPMYLFLSMLALADVLLSTTTAPKMLAIFWFHSGAISFGNCVAQMFFIHL
IFVAESAILLAMAFDRYVAICYPLRYTTILTPSVIAKIGVAAVVRSFLICFPFIFLVYRLTYCGQNIIRHSYCEHMGIARLACDNIKVNIIYGLTMALLSTGLDVLFIII
SYSLILHAVFNIPSWSARLKALNTCGSHICVILMFYTPAFFSFFAHRFGGHTIPRHIHILVANLYVVVPPMLNPIIYGVKTKQIQDRVVQVFSSIRTCC*
474 >lcl|XP_001373851.2|Plus1complement(17115988..17116926) NW_001581971 olfactory receptor 10AG1-like LOC100021811 __SEG__ Chr5 {Monodelphis domestica} MAITNLTIMEEFILLGFSEYPNVQGFLFVLFLFIYISILLGNGLIIIITNVELALQTPMYYFLGNFSFVEICYTSNILPRMLVNIWRQKRNISLLSCAAQLCFFLMLAVT
ESFLLAVMAYDRYVAICKPLYYPIIMNQRICVHMVLGAWVIGIPFFIGQTYQVFSGPFCGSNKLNHIFCDLPPLLRLACGDTSGDEFFLYVDCVLFALLPFLMILMSYIR
ILSTVLKIPSTTGRSKAFSTCSSHIMVVCLFYGSGLIAYFQSISSSSGSIEKIFSVFYTIVTPMINPMIYSLRNKDFITAMKKLFSKWEDKE*
475 >lcl|XP_001373861.1|Plus1complement(4942010..4942288) NW_001581873 dolichol-phosphate mannosyltransferase subunit 3-like LOC100021825 __SEG__ Chr2 {Monodelphis domestica} MTKLKQWISTLLVLMLIWLCLVQDVLSLGYSQKFHDVILPLPVYLLVTAGSYMLGTLGLRLANFNDCEEAAQELFQQIQEAQADLASKGLIL*
476 >lcl|XP_001373862.1|Plus1692059..692991 NW_001581884 G-protein coupled receptor 35-like LOC100021827 __SEG__ Chr2 {Monodelphis domestica} MKVTNSCNSGFNSLEEAYVYMSLYGVIFIVGLTFNVLALWVFCCRMRKWTETQVYMVNLAVADGCLILVLPIVIYFTKMSCSEDLSCQVPQGIYLVNVYMSISIPTAIGV
DRYVAIKYPLKAKALRTPGRAAIVCVLLWVVVITMMAFRVIWQIHDGAFCFHKTTEIHTSMVLFSLLGVFLPLVILVFCTLQIVCTLLKVQRRDISEVRQIRKSVAMVCA
NLVVFVVCFLPLHISIVLNFFLGQNDRFKKVFKVVTLLSNTNCCLDAICYYFVAKEFQQVNPFFFLRCRQPRRVANRRQELQDKTCTTLM*
477 >lcl|XP_001373868.2|Plus1complement(17143165..17144097) NW_001581971 olfactory receptor 10AG1-like LOC100021834 __SEG__ Chr5 {Monodelphis domestica} MADINLTIMEEFILLGFSEYPNVQVYLFVTFLVIYITILLGNGLIIIITNLEAALQTPMYYFLGNFSFVEICYTSVTLPRMLVNLWSQKRNISLLSCAIQLCFFLILAAV
ESFLLAVMAYDRYVAICKPLYYPIIMNHKMCMKMVVGSWVSGIPVMIMQTYQVFSVPFCGSNKLNHIFCDMPPLIKLACGDISGDEFFLFVDCFLFGLIPFLMILMSYIR
ILGTILKLSSTTGRSKAFSTCSSHVMAVCLFYGSASIAYFQSMSSSSGSRDKIFSVFYTIVTPMINPMIYSLRNKDFIAAMKKLFSKWGG*
478 >lcl|XP_001373882.2|Plus1complement(1337556..1338500) NW_001581929 olfactory receptor 51V1-like LOC100021854 __SEG__ Chr4 {Monodelphis domestica} MFAQSGYNVSASTFLLTGFPGLEQSYVWIAIPFSSIYAMVLFGNCMILHVIRTEQSLHEPMFYFLAMLALTDLCMGLSTVHTVLGILWGLSHEISLDACIGQSYFIHGLS
FMESSVLLAMSFDRYIAICNPLRYSSILTATRIIKIGIAIVIRSFLFITPAIIRLKFFHYCRPHVLSHSFCLHQDLLRLTCSDIRFNSFYALGLVICTLLLDSVLILVSY
VLILKSVLAIASPDERLKSFQTCVSHICAVLVFYIPIISLTMVHRFGKHLSPIVHVLMGNIYILFPPLMNPIIYSVKTQQIRRRIKRLFSGQRY*
479 >lcl|XP_001373904.1|Plus1complement(1343819..1344769) NW_001581929 olfactory receptor 51V1-like LOC100021883 __SEG__ Chr4 {Monodelphis domestica} MFVLNSPNPNITSSHFFLTGLPGLEKSYAWISLLFFSIYAMVILGNCMILHVIQTEPSLHEPMFYFLAMLAFTDLCMGLSTVPTVLGILWGIIQEITLDACILQTYFIHG
LSCMESSVLLAMSFDRYIAICNPLRYTTILTNTRIIQIGVAIVIRSFLFITPPIVRLKFFNYCHIHTLSHSFCLHQDLLRLACSDIHFNSFYALALVICTLLLDSLLILI
SYILILHSVLAIASHEERLKSFQTCVSHICAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNIYILFPPLMNPIIYSVKTQQIRSRIQRWFSLKKE*
480 >lcl|XP_001373908.2|Plus117180731..17181654 NW_001581971 olfactory receptor 4P4-like LOC100021887 __SEG__ Chr5 {Monodelphis domestica} MEIHNNVTEFVFLGLFMNPEMKILSCMLFMLCYFAIFLGNLIIFITITCSHLIQQPMYYFLCHLSLMDLAYTSTIIPRLVRDLAAQRKNISFRSCMTQLFTGHFLAGVEM
FILVSMAFDRYVAICKPLHYMVIVTRQRCNMLILLAWGVAFWHSVAQMLMVLKLPFCGPNQIDHYICDVKPLLKLACADTYIASILVIANSGMVALATFLVLLASYIIIL
YNLRKRSSEVRHKALSTCGSHVMVVVLFFAPCIAIYVPPPSVSVNDKEITMFYAVITPLLNPLIYTLRNMEMKNAMRKVWKQKRPSR*
481 >lcl|XP_001373928.1|Plus1complement(1356356..1357300) NW_001581929 olfactory receptor 51V1-like LOC100021916 __SEG__ Chr4 {Monodelphis domestica} MSAQPEFNISSSTFLLTGFPGLEHLYVWIAIPFSSIYALVLLGNCMILHVIWTEQSLHEPMFYFLAMLALTDLCMGLSTVHTVLGILWGFSDKISLDACIGQSFFIHGLS
FMESSVLLTMSFDRYIAICNPLRYSSILTDARIIKIGIAIIIRSFLFITPVIIRLKIFNYCRPHVLSHSFCLHQDLLRLTCSDIRFNSFYALGLVICTLMLDSVLILLSY
VLILKSVLAIASQDERLKSFQTCISHICAVLVFYIPIISLTMVHRFGKNLSPIVHVLMGNIYILFPPLMNPIIYSVKTQQIRSRIQRLFSGQRN*
482 >lcl|XP_001373950.2|Plus1complement(17208301..17209245) NW_001581971 olfactory receptor 10AG1-like LOC100021946 __SEG__ Chr5 {Monodelphis domestica} MEDRNITDVKEFILLGFSDIPNLQGLLFGIFLVIYLGIIIGNILIIIITKADPVLQTPMYYFLGNFSFLEICYTSVTLPRMLMNLLIQKRNISFLACAAQLCLILGLGGS
ECFLLAAMAYDRYVAICKPLYYLFIMNHKICVQLVIGSWIIGTPVVLGQTYQIFSLPFCGPTKLNHIFCDIYPILQVACGDTSLSEIFIYADVVLFGIVPFLLICWSYVR
IIATILKLPSAIGKSKAFSTCSSHLMVVGLFFGSGIIVYLQPKSSHSSGRDKILSLFYTTLTPLCNPMIYSLRNKDFIVTIRKLLSKCIRSGNE*
483 >lcl|XP_001373966.2|Plus11383540..1384496 NW_001581929 putative olfactory receptor 52P1-like LOC100021970 __SEG__ Chr4 {Monodelphis domestica} MVDNANTSSFSSFFLVGIPGLEVYHFWFGIPVCLLYALTLMGNGLIVLVIKEEPSLHQPMFFFLCMLAFDDVAMASTIAPRMLGIFWLAAHVIGFDTCVVQMYLIHTFSI
IESALLVAMAYDRYVAICRPLHYATILTTPLVLKLGAVSVARGAIMVLPGPLLIKRLRYCTQSVIRHTYCEHMAVVKLACTDTYINRSYGIFVALSVIIMDFGLISMSYV
KILQAVFRLSSKEARSKALGTCAAHICTVLFTYIPALFSFLTHRIGKRVPPSLHIIFASIYLLVPPTVNPLVYGVKTKQIRDRVVILFLRKKDKFSTH*
484 >lcl|XP_001373971.2|Plus1complement(17222368..17223315) NW_001581971 olfactory receptor 10AG1-like LOC100021975 __SEG__ Chr5 {Monodelphis domestica} MAEVNLSHAKEFILLGFSDLPTLQDTLFSIFLVIYINILIGNGLIIVVTKSDKALQTPMYFFLGNFAFLEICYTSVTLPRMLSDLWTQNKNISVLACATQLCFFLILVVS
ESLLLAVMAYDRYVAICKPLYYTLIMNQKACIQLVVVSWITGTPVLIGQTYQVFSLPFCNSNIINHIFCDMPPLMKLACGNTTWNEILVYVEVVSFGFIPFVLILYSYIK
IFITIQKLPSVMGRSKAFSTCSSHLMVVVLFYGSGIVAYLQPKTSYVAGIEKMLSLFYTIITPMFNPLIYSLRNKDVIVAMKKYFLNVKCHEAMR*
485 >lcl|XP_001373987.2|Plus11397142..1398086 NW_001581929 olfactory receptor 56A1-like LOC100021998 __SEG__ Chr4 {Monodelphis domestica} MAPGNYSSPAAISEFLLICFPGYQSWQHWLSLPLSLLFLLAMAANATLLLTIWLEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLVIFWFDLRAISFSACFLQMFIMNSF
LPMESCTFMVMAYDRYVAICHPLRYPSIITDRFVVKAGIFIVARNALLTAPIPILSSRLRYCGKNIIENCICANLSVSRLSCDNFTFNRIYQFVAGWTLLGSDLILIFIS
YAFILRAVLRIKAEGAAAKALSTCGSHFILILFFSTILLVVVLTNVARKRVPMDILILLNVLHHLIPPALNPIVYGVRTKEIKQGIQKLLKRRV*
486 >lcl|XP_001373991.2|Plus1complement(17235582..17236505) NW_001581971 olfactory receptor 10AG1-like LOC100022003 __SEG__ Chr5 {Monodelphis domestica} MEGTNFTVVVEFILLGFSDLPNLQGFLFGIFLVIYLSILLGNGLIIIITKTDPSLQTPMYYFLGNFSFLEICYASVTVPRMLTDLWTHNGNISLWACAVQLCLFLILGVT
ECFLLAVMAYDRYVAICKPLYYFLIMRHHVCMGLVVGSWILGIPVVIGLTYQIFSMPFCESMKLNNVFCDIYPVLEVTCGDTSMNELSVYADVVLFGMIPFILILNSYIR
IITTIMKMPSATGRSKAFSTCSSHLTVVSLFFVTAILTHLRTKTSHSAATERVLSLLYTTMTPLVNPIIYSLRNKDVIVALRKVLLK*
487 >lcl|XP_001374010.2|Plus11410573..1411520 NW_001581929 olfactory receptor 51V1-like LOC100022032 __SEG__ Chr4 {Monodelphis domestica} MSSTLDGNSSYFTFLLTGFPGLEWAHHWISIPVFSVYLTAILGNATILHIVRTDPSLHQPMYYFLAMLASTDLGLCVSTIPTVLGVLWFDFRGIHLYPCVLQVYVFHAFS
FMESAMLFAMAYDRFVAITNPLRYPTILTSSRVVMIILTLGLRSIIFTIPPIIRLLWLTYCRNNVLSHSYCLHQDMIRLSCSNTRFNSLYALIVILLSMGSDFLFILLSY
IMIFHSVLTIASRREQLKVLNTCVSHILAVLCFYVPVLGLSIVHRFARHSSPIIHIVMGNVYILFPPLMNPLIYSIKTQQIRRAIIRIISLKGCR*
488 >lcl|XP_001374013.2|Plus1complement(17305648..17306571) NW_001581971 olfactory receptor 10AG1-like LOC100022035 __SEG__ Chr5 {Monodelphis domestica} MGKANFSLIVEFTLLGFSDLPNLQGFLFGLFLIIYIGILMGNGLIIIITKVDSALQTPMYFFLRNFSFLEICYTSVILPRILANLWTQKRNVSFVACAVQFCAFFVMAIA
ENFLLTVMAYDRYVAICKPLNYPLIMNHKVCVRLVVGSWMGGIPIHILLTYLIFSLPFCGSKNIDHIFCDIRPLLKLACGDTSVNEFTFYAVVLILGMFPFMLIIWSYMK
IITTILKVPGTKGRFKAFSTCSSHLMVVALYFGCGIITYLRPSSGHSAGLDKVLSIFYTTVTPMFNPIIYSLRNKDVVVAIRKLLFK*
489 >lcl|XP_001374030.2|Plus1complement(17336181..17337104) NW_001581971 olfactory receptor 10AG1-like LOC100022059 __SEG__ Chr5 {Monodelphis domestica} MAISNITEIVDFILLGFPELPNLQGFLFWLFLFIYLCILIGNGLIIVITKVDPSLQTPMYFFLGNFSFLEICYTTVTIPRMLTDLWTQNKHISFLDCVVQLCLFLILGGT
ECFILAVMAYDRYVAICKPLNYPLIMNHKVCVQLVVGSWIGAVPIQVGLTYQIFTLSFCSSNELNYVFCDAPPLVKLACGDSTLNEFPVFANAVLFGMIPFTLILVSYIR
IIITILKLPSATGRQKAFSTCSSHLIVVGLFYGTGISTYLLPKSKQTVLLEKILSLFYSTVTPMFNPMIYSLRNKDVIAALKKLLCK*
490 >lcl|XP_001374063.2|Plus1complement(1486811..1487749) NW_001581929 olfactory receptor 51B5-like LOC100022107 __SEG__ Chr4 {Monodelphis domestica} MWPNISSAPFVLTGFPGLEEAHQWISILFLAVYITVILGNGTLLVLIRDDHSLHEPMYYFLAMLAATDLGVTITTMPTVLGVLWLDHREIDHGVCFSQAYFIHSLSIVES
GVLLAMAYDRFIAIRNPLRYTSIITNSRVVKIGVGALLRGCVSIVPPIVPLHWFPYCHSHILSHAFCLHQDVIKLACADITFNRIYPVVLVSFTVFLDSLIILLSYILIL
KTVMGIASGEERAKALNTCVSHICCVLVFYVTVIGLSLIHRFGKHVPRVAHIAMSYVHFLFPPLMNPIIYSIKTKQIQRGILHMFSLCKSKD*
491 >lcl|XP_001374065.2|Plus1complement(17412088..17413032) NW_001581971 olfactory receptor 10AG1-like LOC100022111 __SEG__ Chr5 {Monodelphis domestica} MSEENHTEIKEFILLGFSDVPNLRGLLFGIFVIIYVSILTGNGLIIVINKFNPALQTPMYFFLGNFSFIEICYTSVTLPRMLADIWTQRKSISLLTCATQLGFFLIFGGI
ECFLLAVMAYDRYVAICKPLYYPLIMNYKMCIQLVIGSWITAIPFQAGLTYQIFSLPFCGSNKLDHVFCDASPLVKLTCGHNTFNEFSVYANAALFGMFPFLLILVSYIK
IITTILKLPSATGRSKAFSTCSSHLIVVGLFFGSATITYLLPKSKEPAGTEKVLSLFYTTVTPLFNPLIYSLRNKDVIEAIKKLLPKWLNSLKK*
492 >lcl|XP_001374091.1|Plus1complement(1523961..1524899) NW_001581929 olfactory receptor 51B6-like LOC100022151 __SEG__ Chr4 {Monodelphis domestica} MWHNSSTVPFLLTGFPGLERAHCWISIPFFIVYTSVILGNGTLLFLIKDDHSLHEPMYYFLAMLAATDLGVTLTTMPTVMGVLWLNHREISHGLCFSQAYFIHTLSVMES
GVLLAMAYDRFVAICNPLRYTSILTNSRVMKIGIVVFMRASLSIIPLIMRLHWFPYCHSHILSHTFCLHQDVIKLACADITFNRIYPVVLVSLTGFLDSIIILFSYVLIL
KTVMSIASGEERAKALNTCVSHVCCVLVFYVTVIGLTLIHRFGKHAPPVVHITMSYVYFLFPPLMNPIIYSVKTKQIQNGILRIFSLHRPIA*
493 >lcl|XP_001374144.2|Plus1complement(1552097..1553035) NW_001581929 olfactory receptor 51B5-like LOC100022225 __SEG__ Chr4 {Monodelphis domestica} MWPNNSLSPFLLTGFPGLEAVHHWISIPFFFVYFSVILGNGTLLFLIKDDHSLHEPMYYFLAMLATTDLLVTLNTMPTVLGVLWLDQREIQLELCFSQAYFVHSLSIVES
GVLLAMAYDRFIAIRNPLRYRSILTNSRVVKIGVGVLLRGCMSVVPPIVPLHFFPYCHSHVLSHAFCLHQDVIKLACADITFNRIYPMVLVSFTFFLDFLVILFSYILIL
KTVMSIASGEERNKALNTCISHICCVLVFYVTVIGLSLIHRFGKHAPHVIHITMSYIHFLFPPFMNPVIYSVKTKQIRNGILRKFSLHRFRA*
494 >lcl|XP_001374158.2|Plus1complement(1575124..1576062) NW_001581929 olfactory receptor 51B5-like LOC100022248 __SEG__ Chr4 {Monodelphis domestica} MWSNNSLSPFLLTGFPGLEAIHHWISIPVFVVYFSVIIGNGTLLFLIKDDHSLHEPMYYFLAMLAGTDLLVTLNTMPTVLRVLWLDEREIGHGTCFSQAYFIHSLSFVES
GVLLAMAYDRFIAIRDPLRYRSILTNSRVLKIGIGAFLRGFISVVPPIVPLHFFPYCHSHVLSHAFCLHQDVIKLACADITFNRIYPVVLLSFIFFGDSLIILFSYLLIL
KTVMSIASGEERNKALNTCISHICCVLVFYVTVIGLSLIHCFGKHAPHVVHITMSYIYFLFPPFMNPIIYSIKTKQIRNGILRKFSLHRFRA*
495 >lcl|XP_001374173.1|Plus1complement(2984087..2985172) NW_001581914 G-protein coupled receptor 109A-like LOC100022273 __SEG__ Chr3 {Monodelphis domestica} MNSKNCCVFRDEFIPRVLPPVLGLEFVFGALGNGLALWAFCFSLKSWKSSRIFLFNLAVADFLLIFCLPFLTDNYVRKWDWKFGDIPCRMMLFMLAMNRQGSIIFLTVVA
VDRYFRVVHPHHALNKISNRTAAVISCLLWGVTIALTGHLLITSHVKKMGDSQFCSSFAICPTFGWHDAMFLLEFFLPLGIIIFCSTSIIWSLRRRQLDKQAKIKRAIRF
IMVVAIVFVICFLPSVAVRIRIFWLLYSQGTSSCKIYRSADLAFYITLSFTYMNSMLDPLVYYFSSPSFPNFFSKLITCRLRQKSTGESDNNRSTSGDPTGDLCLTNSSC
ANTITRQNLPDALMTNSSVAWNSTRIDPTSP*
496 >lcl|XP_001374174.1|Plus11595192..1596133 NW_001581929 olfactory receptor 51B6-like LOC100022274 __SEG__ Chr4 {Monodelphis domestica} MWPNGSNTAPFLLTGFPGLEVAHRWISIPFFVVYLSVILGNSGLLFLIKNEHSLHEPMYYFLAMLAATDLGVTLTTMPTVLGVLWLDQRKIGHGICFSQAYFIHTLSIVE
SGVLLAMAYDRFIAIRNPLRYTAILTNSQVMKIGIGVLMRAALSIMPIIVRLHWLPYCHSHVLSHAFCLHQDVIKLACANITFNRLYPVVVVFALVLMDFLIIVFSYVLI
LKTVMGIASGEERAKALNTCVSHICCILVFYVTVVGLTFIHRFGKHVPHVVHITMSYVYFLFPPLMNPVIYSVKTKQIQTGFLRLFSYNKAGM*
497 >lcl|XP_001374190.2|Plus1complement(17649010..17649951) NW_001581971 olfactory receptor 10AG1-like LOC100022299 __SEG__ Chr5 {Monodelphis domestica} MAGDNISFVVEFILLGFYDLPHLQGVLFGVFLVIFMYILIGNGLIVVITKVDPALQTPMYFFIGKFSLLEICFTSATLPRMLSDLWTQKRHISMLACAVQLCFLYICGSF
ECLLLAIMAYDRYVAICKPLYYSIIMNNRVCNMLILGSLMFVTPVMIGETYQIFSLTFCGSNELDHLFCDVTSLLKLACADTSVNEFSLYIYCVFFGFLPFFLILLSYIK
IINAILKMPSVGRHKAFSTCSSHLIVVVLFYGSGIITYSQPKSKHSAEKEKMLSLLYTIMTPVFNPIIYSLRNKDVITSLKKIITKGLLSVTK*
498 >lcl|XP_001374208.2|Plus1complement(17687448..17688389) NW_001581971 olfactory receptor 10AG1-like LOC100022327 __SEG__ Chr5 {Monodelphis domestica} MAGENISFVVEFILLGFYDLPNLQGVLFGVFLVIFMYILIGNGLIVVIIRVDPALQTPMYFFLGNFSFLEICYTSAILPRMLSDLWTQKRQISLLACAVQLCFFYIMGAT
ECLLLGIMAYDRYVAICKPLYYPVIMNNRVCNILILGSLMFVTPVMIGETYQIFTLPFCGPNELNHLFCDVTSLLKLACADTSVNEFSFFVNSVLFGILPFFLILVSYIR
IINTILKLPSVGRQKAFSTCSSHLIVVGLFYGSVIITYLQPKSSHSAEKDKMLSLLYTIVTPTFNPMIYTLRNKDVITSLKKIKTKGLFSIKK*
499 >lcl|XP_001374217.1|Plus1complement(28907931..28908944) NW_001581842 leukotriene B4 receptor 1-like LOC100022340 __SEG__ Chr1 {Monodelphis domestica} MGSDESSGEFDFPMALNVVRPVACVVLGLAFILGVPGNLAVVWTVCRKMKTPQPTVLLILNLAAADLLALVTVPFWIHALTGVWNLGPSACRVLVWLVNGSMFSGVLLVT
LLSAERVAALSRPFHLQRWWRRAGTRRVLGLLWVVSLALAAPAPLTADPSSCLNRQFSSGRQLVTLLLLETVAGFVGPFTVIAICSACFRSRLRTLCHPSKRRAGRIVAA
VVMAFAGFWLPYHVSNGVSVAAELLEDSSEELADWLRSVAYVGHSASGPLIFLSSCINPLLYAFASRRSGGLRGLAALFTRMVPTFDSDGAHNEASQSGGGSASDQPVAL
NRRDSAS*
500 >lcl|XP_001374220.1|Plus19131916..9132542 NW_001581881 amiloride-sensitive cation channel 1, neuronal-like LOC100022343 __SEG__ Chr2 {Monodelphis domestica} MDLKDSTSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWALAFMGSLGLLLVESSERISFYLTYQHVTKVDEVVAHSLAFPAVTFCNLNGFRFSRLTTNDLYHA
GELLALLDVNMNIPNPHLADPTVLEALREKANFKHYKPKVFSMREFLERVGHDLKDMMLYCKFKGQECDHQDFTTVSNLVFSSLWAFHSWPRRALGEL*
501 >lcl|XP_001374222.1|Plus1complement(3004429..3005457) NW_001581914 G-protein coupled receptor 81-like LOC100022345 __SEG__ Chr3 {Monodelphis domestica} MNGTCCLIQGDTIAQVMPPLLVLAFVLGALGNGLALCGFCFHMKSWKPSTIYLFNLAVADFLLMVCLPFRTDYYRKNRKWGFGDAPCRLVLFMLATNRAGSIVFLTVVAI
DRYFKVVHPHHTLNAISNRTAAGLACALWVLVIAGTLYLLTETHLCVQGHTVSCESFIMESANGWHDIMFQLEFFLPLAIISFCTFNIIGSLRQRQQLTRQRRVKKATRF
IVAVAAVFVTCYLPSVSARLYFLWTIPSSACDGSVHVALHVTLSFTYMNSMLDPLVYYFSSPSFPKVYTKFKIWGPRPKPAGESKAQNPRGTPASKLCPESCIGVENHSR
SCPEVQWDLQIF*
502 >lcl|XP_001374224.2|Plus1complement(17701572..17702516) NW_001581971 olfactory receptor 10AG1-like LOC100022350 __SEG__ Chr5 {Monodelphis domestica} MAENNLTYLAEFVLLGFSDLPNLHGFLFGVFLVIYLCILMGNGLLIVITKVDPSLQTPMYFFLGNFSFLEICYTSVTIPKMLADLWSQKTTISFVACAVQTCFLYILGGA
ECLLLAVMAYDRYVAICKPLYYPLIMNNKICIELVVASWMIGVPILIEETYLIFSLNFCGPNKINHIFCEAPPLLKLACGDTYKIEVSVHVIALLFVLIPFLLIFTSYLK
IITTILKLPSTSGRTKAFSTCSSHLMVVTLFYGSGSIVYLQPRSFQSAESGKVLSLFYTTVTPMLNPVIYSLRNKDVVAALRKLLPKSIGSLNN*
503 >lcl|XP_001374228.2|Plus1complement(890996..891937) NW_001587045 olfactory receptor 1019-like LOC100022354 __SEG__ ChrX {Monodelphis domestica} MEDGNMTTVRDFVLWGISEDPEQQKLLFSLFSLMYTITLVGNLGLIFLIRIYPKLHTPMYFFLSNLSFLDSCYSSVTAPRMLADLLSKDKVISFSGCMTQLGLFIVFATA
ELYLLASMAYDRYVAICNPLLYPVLMSSWACTTLVIACYIAGIINSLTVTSSISRLSFCRASMVKSFFCDIRPLLALSCSDTEVCNILVFAFGAFIQMSSLLVIVVSYTF
IITAIMRIRLAEGKRKAFSTCASHLTAVSLFYGTLIFMYLRPTSNSASNQDQVVSIFYTMVIPMLNPIIYSLRNQEVKQALKKILYKDSPIQA*
504 >lcl|XP_001374240.2|Plus11635717..1636667 NW_001581929 olfactory receptor 51I1-like LOC100022370 __SEG__ Chr4 {Monodelphis domestica} MGMTFNISQLTPETFLLTGLPGLEAIYPWLAIPFCSMYLVALVGNSLILLVIHGSPPLHQPMYLFLAMLAFSELGVSASTLPTVISIFLFNSNEINFDACLFQMFSIHSF
SIMESAVLLAMSVDRFIAIYSPLRYATILTLPRIARTGIAIGLKSVVVMFPLPFLLRRLPFCGHNTLSHSYCLHSDLIQLPCGNTRPNSILGLCIVTSTFGLDSLLIVIS
YGLILHTVLGIASGEGRRKALNTCVSHICAVLVYYVPMIGVAMVHRFVKHAAPAVRLLLANVYLLVPPVVNPIVYSIKTKQIRHGLIQMLFQKKCH*
505 >lcl|XP_001374243.2|Plus1complement(17734706..17735647) NW_001581971 olfactory receptor 10AG1-like LOC100022374 __SEG__ Chr5 {Monodelphis domestica} MAGDNVSFVVEFILLGFYDLPNLQGSLFGIFLVIFMYILIGNGLIVVITKIDPALQTPMYFFIGKFSLLEICFTSAILPRMLSDLWTQKRHISMLACAVQLCFLYICGSF
ECLLLAIMAYDRYVAICKPLYYPIIMNNRVCNILILGSLMFVTPVMIGETYQIFTLPFCGSNELDHLFCDVTSLLKLACADTSVNEFSLYVYCVFLGFLPFFLILLSYIK
IFNTILKMPSVGRRKAFSTCSSHLIVVVLFYGSGIITYSQPKSKHSAEKEKMLSLLYTIVTPMFNPIIYSLRNKDVITSLKKIITKGLLSVTK*
506 >lcl|XP_001374248.2|Plus1947232..948158 NW_001587045 olfactory receptor 13H1-like LOC100022379 __SEG__ ChrX {Monodelphis domestica} MEANATSMVLEFLIIGISNYPEWRDTFFTLVLLTYLTILLGNSLIIALIHLDSRLHTPMYFFLGNLSFLDLCYATASMPQALVHCFSAYPLLSYPRCFAQMSVSLFLATA
ECLLLAVMAYDRMVAIGDPLRYTLVMSPAVCIWLATISWGASLMLTIMLISSLRLHFCGAKVLNHFVCEILSLIKLACSNTHLNELMILATSFFTLLLPFLFILLSYARI
AAAVLRIRSAQGRLKAISTCGSHLAVVTIFYGAAISMYMKPQSKSSSNQEKFISMFYGALTPMLNPLIYSLRNKDVKGAIKKVMGKQA*
507 >lcl|XP_001374255.2|Plus11645332..1646279 NW_001581929 olfactory receptor 51G2-like LOC100022389 __SEG__ Chr4 {Monodelphis domestica} MFNKSIAFTPQTFILVGIPGLEAEHIKISFPFCLIYVIIFLGNGTILHVIRVDQTLHQPMYFFLAMLASAELGVTTCTLPTVLGIFLFGINEISFEACLLQMFFMHSFTM
IESAVLLAMSVDRFIAIYNPLRYTAILTLPRITCTGVAILLKTLGLMLPLPLLLRRLPFCGHNTLSHSYCLHSDLIKLPCGNTRPNSILGLFIVIFTFGVDSMLIVVSYV
LILRTVLSIASREGQLKALNTCVSHICAVLAYYIPVISLSVLHRFMHPMPPLLQVMMANAYLLFPPVVNPFVYSVKTKEIRRAISQVLSRKRARS*
508 >lcl|XP_001374258.2|Plus1complement(17790124..17791068) NW_001581971 olfactory receptor 10AG1-like LOC100022392 __SEG__ Chr5 {Monodelphis domestica} MAGDNLTFLAEFVLLGFSEIPNLHGFLFGVFLVIYLCILMGNGLLIVITKVDPSLQTPMYFFLGNFSFLEICYTSVTIPRMLADLWSQKTTISFVACAVQVCFLYILGVA
ECLLLAVMAYDRYVAICKPLYYPLIMNNKICIELVVASWMIGVPILIEETYLIFSLNFCGPNKINHIFCEAPPLLKLACGDTYKIEISVHVIALLFVLIPFLLIFTSYLK
IITTILKLPSTSGRTKAFSTCSSHLTVVALFYGSGSIVYLQPRSGQSAESGKVLSLFYTTVTPMLNPVIYSLRNKDVVAALRKLLPKSIGSLNN*
509 >lcl|XP_001374263.2|Plus1960208..961146 NW_001587045 olfactory receptor 13H1-like LOC100022399 __SEG__ ChrX {Monodelphis domestica} MESLTIVNTTEVTEFILVGLSNHPKAQIAFFCALVVIYSVTLVGNSVIILVVRIDEQLHTPMYFFLSNLSFLDICYSTSSVPPLLFNGLRDFPTISYNSCYAQMTISLFL
GMTECLLLAVMAYDRLVAISNPLRYTVIMNNRVCLQMAISTWVSAFFLSVTPIIAIPARYCGHNVINHFTCEFQALLKLVCSDTLMDLILGLVISVCTLPLPFSFILISY
IRIVIAVLKIRSTEARLKAFSTCSSHLTVVTIFYGTAIYMYVKPQSKKSQDQDKIISVFYGVVTPMLNPLIYTLRNKDVKSALRKITRRKES*
510 >lcl|XP_001374264.1|Plus1144955439..144957388 NW_001581841 leucine-rich repeat transmembrane protein FLRT3 FLRT3 __SEG__ Chr1 {Monodelphis domestica} MINPTWSIFLIWTKIGLFLKMAPQSVMAKSCPSVCRCDAGFIYCNDRALTSIPKGIPEDATTLYLQNNQINNAGIPSELKNLLKVERIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEDGAFRDNNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQDLTSLKRLVLDGNLLNNHGLGDKV
FMNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQENHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLFLRNNPWYCGCKMKWVRDWLQSLPVKVNVR
GLMCQAPEKVRGMAIKDLNTELFDCKDSGIVSTIQITTAIPNTLYPAQGQKPVSVTKQSEVKNPKLNKDYRTTVSPMRKIITITVKSVSTETIRISWKLALPMTALRLSW
LKLGHSPAFGSITETIVTGDRNEYLVTALEPDSPYRICMVPMETSNLYLSDETPVCIETETAPLKMYNPTTTLNREQEKEPYKNSNLPLAAIIGGAVALVAIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPINNEPISKEEFVIHTIFPPNGINLYKSNHSESSSNRSYRDSGIPDSDHSHS*
511 >lcl|XP_001374271.1|Plus11658988..1659950 NW_001581929 olfactory receptor 51I2-like LOC100022414 __SEG__ Chr4 {Monodelphis domestica} MQTSNSSDLIVGFTPKTFILAGIPGMEAEHIWISIPFCLMYVIIFLGNGTILHVIHMNPTLHQPMYLFLAMLALAELGISVSTLPTVLGIFLFDVTEIDFHVCLLQMFSI
HSFSIMESGILLAMSMDRFVAIYSPLRYTAILTLPRIISIGATVTLKSVVLMAPLTGLLQRLPFCGHNILSHSYCLHPNLVHLPCADTSINNIYGLFIVLSTFGLDFLLI
IVSYVLILRTVLSIASGESRWKALNTCGSHVCAVFVYYVPMIGLSMVHRFGRHLPSVLQPTMANIYLFFPPVVNPIVYSIKTKEIRKGIVHVFSRKRVRV*
512 >lcl|XP_001374275.2|Plus1complement(17818994..17819929) NW_001581971 olfactory receptor 10AG1-like LOC100022418 __SEG__ Chr5 {Monodelphis domestica} MERDNFTAVVEFILLGFYELPKLQRLLFGIFLVIYICIFLGNGLLIVITNIEPSLQTSMYFFLANFSFLEICYTSVTIPRMLADLWTQKRTISLLECAAQACFLYILGVA
ECLLLAVMAYDRYVAICKPLYYALIMNHKVCVQLVVVSWMIGAPILMEQIYQIFSLNYCGSNKINHIFCDGPPLMKLACGDIYKIEVSSYAFALLFITIPFLLTLTSYVK
IITTVLKLPSNSGRSKAFSTCSSHLMVVGLFYGTGSIMYLRPESSRSARSDKVLALFYSTVTPVFNPLIYSLRNKDVLAALRKLLPKFFRS*
513 >lcl|XP_001374282.2|Plus11001847..1002788 NW_001587045 olfactory receptor 13H1-like LOC100022429 __SEG__ ChrX {Monodelphis domestica} MDGLQRTNYSEVTEFILVGFSQKPHVQVAFFTGLLCFYLFTVWGNSLIITVIQRDTQLHTPMYFFLSNLSFLDICYTTSWEPYVLAQCFKDFPTISYTSCYAQMTISLFL
GMTECLLLAIMAYDRFVAISNPLRYTVIMSNQVCLQMAVGTWASAFLLSVMPIVAIPAQYCGHNVINHFTCEIQALLKLVCSDTPMSLILGLVISTFTLPLPFTFILISY
IRIVAAVLRIRSTEAKLKAFSTCGSHLTVVTIFYGTAIYMYLKPQSKESPDQDKVIFIFYGAVTPMLNPLIYTLRNKDVKGALRKLAGGKEKS*
514 >lcl|XP_001374294.2|Plus1complement(17847457..17848374) NW_001581971 olfactory receptor 10AG1-like LOC100022446 __SEG__ Chr5 {Monodelphis domestica} MAGDNFTVVTEFILLGFSDLPKLQGILFGIFFVIYMSIILGNGLLIVITKIDSGLQTPMYFFLGNFSFLEICYTSVTIPRMLADLWTQKKTISFLACAVQTFFLYILGSA
ECLLLAVMAYDRYVAICKPLYYPLIMNHKLCVQLVVSSWLIGIPILFVETYQVFHLHFCGPNKLNHIFCDAPPLLELACGDTHKTEIFVAVPALLLILIPFLLILASYIK
IITTILKLPSNSGRIKAFSTCFSHLTVVGLFYGSASIVYLQPKSSGESVKIFALVYTTVTPMFNPLIYSLRNKDVIAALRKLLPK*
515 >lcl|XP_001374301.2|Plus11040139..1041080 NW_001587045 olfactory receptor 13H1-like LOC100022456 __SEG__ ChrX {Monodelphis domestica} MDGLQRTNYSEVTEFILVGFSQKPHVQVAFFTGLLCFYIFTVWGNSLIITVIQRDTQLHTPMYFFLSNLSFLDICYTTSWEPYVLAQCFKDFPTISYTSCYAQMTISLFL
GMTECLLLAIMAYDRFVAISNPLRYTVIMSNQVCLQMAVGTWAGAFLLSVMPIVAIPAQYCGHNVINHFTCEIQALLKLVCSDTPMSLILGLVISTFTLPLPFTFILISY
IRIVAAVLRIRSTEARLKAFSTCGSHLTVVTIFYGTAIYMYLKPQSKESQDQDKVISILYGAVTPMLNPLIYTLRNKDVKGALRKLIGGKEKS*
516 >lcl|XP_001374309.2|Plus11688133..1689080 NW_001581929 olfactory receptor 51I1-like LOC100022469 __SEG__ Chr4 {Monodelphis domestica} MGNSATTNGTELPSFTLTGLPGLEASQHWMFLLLGALYTVSIVGNSLILFIVKEEQSLHQPMYYFLSLLSVNDLGVSLSTLPSVLATFCFHAQEITFDACMAQMFFIHLF
SFMESGILLAMSFDRYVAICNPLRYSTILTDNRVAQMSLFIGIRSFCVVFPMPFLLKRLPFCKPNILSHAYCLHPDLIHLPCGDITINNIFGLCIVISTFVLDSALILLS
YILILHSVLAIASQEERLKTLNTCVSHICAVLIFYVPMVSVSMVHRYGRAAPPYVHTLMSLVYLFVPPMLNPVIYSIKTKEIRRRLIRLFSVTKL*
517 >lcl|XP_001374321.1|Plus1complement(1693822..1694760) NW_001581929 olfactory receptor 51I2-like LOC100022493 __SEG__ Chr4 {Monodelphis domestica} MGLFNVSHPTVFLLTGIPGLESSQEWLAGPLCVMYIVALGGNVMILLAVRGESSLHAPMYYFLSMLSFSDVAMSLATLPTVFRTFCLNARTIVFDVCLTQMFLIHSFSMM
ESGILLAMSFDRYVAICNPLRYASVLTNQVIVGMGLAVTARSFTTLFPLPFLIKRLPICRSNVLSHSYCLHPDMMKLACADITVNSIYGMFVLVSTFGLDLLFIILSYVL
ILRSVLAIASREERLKALNTCVSHICAVLIFYIPMIGVSTVHRFGKHAPRYVHVLMSNIYLFVPPVLNPIIYSAKTKEIRRSIVRMFHRLAN*
518 >lcl|XP_001374337.2|Plus1complement(44586283..44587449) NW_001581879 5-hydroxytryptamine receptor 1B-like LOC100022515 __SEG__ Chr2 {Monodelphis domestica} MEQPSRQCSPPASGSLTSSQTNHSTFPNPNCSSRDLEPYQDSIALPWKVLLATFLALITLATTLSNAFVIATVSRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTV
TGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAGMIVMVWVFSVSISMPPLFWRQAKAEEVADCSVNTDHILYTVYSTVGAFYFPTL
LLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSSSSGTSINSRVPEGPSESGSPVYVNQVKVKVSDALLEKKKLMAARERKATRTLGIILGAFIVCWLPFFI
ISLALPICDNACWFHLAIFDFFNWLGYLNSLINPIIYTKSNDDFKQAFQKLIRFRRTS*
519 >lcl|XP_001374342.2|Plus11714670..1715608 NW_001581929 olfactory receptor 51I1-like LOC100022521 __SEG__ Chr4 {Monodelphis domestica} MWHFNDSHFQPDKLQLTGIPGLETGEGWVALIFCLLYLISIGGNLAILGLVVRETALHQPMYYFLSMLSLNDLGVSLSTLPTMLGTFCFNYREVGFDACLVQMFFIHTFS
FMESGILLAMSFDRFVAICNPLRYATILTNTRIVVMGLAILLKSFVTLFPFPFLVKRLPFCKGNVLHHSYCLHPDLMKVACGDIHVNNIYGLFVVIFTYGVDSTFILLSY
ALILKAVLAIASQEQRLKALNTCISHICAVLAFYVPIIAVSMIHRFWKKAPPVVHVMMSNVYLFVPPMLNPIIYSVKTKEIRRGFLKIFQKS*
520 >lcl|XP_001374359.2|Plus11727652..1728602 NW_001581929 olfactory receptor 51I2-like LOC100022548 __SEG__ Chr4 {Monodelphis domestica} MGVLANVTLSPLPFYLTGIPGLEAQHGWLSIPFFAMYVVAIVGNTLILAAVQAESSLHEPMYLFLSMLAITEVGVSVSTLPTVMGILWFDAREISMGGCLAQMFFIHTFS
CMESGVLLAMSYDRYVAIYNPLRYTTILTLPRIVAMGLAITLKSVAFMAPLPFLLQRLPFCHANVLSHSYCLHSDLIQLPCADTTINSILGLSIVLASFGLDSLLIVFSY
ALILWTVLGIASKEGRLKALNTCASHICAVLLYYVPMIGVSVMHRAAKHASPIAHTLMSSAYLFVPPVLNPIIYSVKTKPIRKGILSLFSRKRILP*
521 >lcl|XP_001374382.2|Plus1complement(1734619..1735581) NW_001581929 olfactory receptor 51I2-like LOC100022580 __SEG__ Chr4 {Monodelphis domestica} MESFLTNDSGLPPFILTGFTGFEDSQQWIFLLFGALYSVSIVGNCLILFIVKEEESLHQPMYYFLAVLSVNDLGVSLSTLPTVMATFCFHAREIAFEACMAQMFFIHFFS
WTESGILLAMSFDRYVAICNPLRYSTILTDARVAQMNLAVVLRSFFMVFPLPFLLKRLPFCRANVLSHAYCLHPDLIHLPCGDSTPNSIYGLCIVISAFGLDSALILLSY
VLILRSVLAIASREERLKTLNTCVSHICAVLIFYVPMVGVSMAHRFGKNSLPHLNTVMSVIYLFVPPMLNPVIYSIKTKEIRWRIIRIFSASSSVQRELG*
522 >lcl|XP_001374430.2|Plus1complement(1775741..1776697) NW_001581929 olfactory receptor 52D1-like LOC100022644 __SEG__ Chr4 {Monodelphis domestica} MSAANNSNSLPTTIFLTGIPGLEPFYMWISIPFCAMYLVALIGNLILILVICTDHSLHTPMYIFLCLLSFSDLTISSTTVPKMLAILWFHAGQMTFAGCLAQMFFLHSIF
AVESSVLLAMAFDRYVAICNPLRYTTILNHGVIVRIFFAGIIRSVICTAFLIFLVWRLPYCGHHIIMAHTYCEHMGIARLSCGDIRLNIVFGLTMALLVMGLDAVLIAVS
YCIILHAVFRLPSRDARRKALGTCGSHIGVILVFYIPAFFSFLTHRFGYNRVPKHVHIFLANLYVLLPPVLNPIIYGAKTKEIRIRLLRLMSPGQDFA*
523 >lcl|XP_001374433.2|Plus128665268..28665717 NW_001582018 calmodulin-like LOC100022649 __SEG__ Chr8 {Monodelphis domestica} MADQFTEEQIAEFKEAFSLFDKDSDGTITTKELGTVMRSLGQNPTEAELQTMMGEVDADGNGTIDFPEFLGMMAKKMKGAETEESIREAFRVFDKDGNGFVSAAELRHVM
TSLGEKLTDEEVDEMMGEADVDGDGQVNYEEFVRVLSSK*
524 >lcl|XP_001374439.1|Plus120040070..20041290 NW_001581861 c2 calcium-dependent domain-containing protein 4A-like LOC100022659 __SEG__ Chr1 {Monodelphis domestica} MWCLERLLRIRTRPAATSAFSPASFTNVLTPANIPEFCIPPRLLPSPSPALTRDLWQEEELRQECVRAREDPDLTDWDPRSQAALSLPHLPRQPTSYGFCTLLESPNTRR
KESLFLGGSAAAAALLLQAPSQSLLRPRAHTYCGSGGTNASCNLRGRRVAPDSPAIGCSSSSSSSSASSSPCSSPRPQVAPAKRSRSRQGYRHLLRAPDALGRALRASGS
RVLARARSVSSAEDDDEDYEAVGDACRISQTATCQSGSAQKRALSPSPSPSPLGPLQERLEVQSTLALDCDGGALHLATEYCPVSQRLRIRLLSAQGLYSCTAEPGAIGC
RVSITLVLPGKTHKQRSAVVRRSRNPVFNEDFFFEGLSENDLRRTAVRVKAENKGRGLERDRLLGRGELELRTILL*
525 >lcl|XP_001374451.2|Plus1complement(17970956..17971879) NW_001581971 olfactory receptor 10AG1-like LOC100022674 __SEG__ Chr5 {Monodelphis domestica} MSEDNFTVVVEFIILGFSDLPNMQGFLFGVFLVIYLCILIGNGLLIVITKIDPGLQTPMYFFLGNFSFLEICYTSVTFPRMLADLWTHKGTISFVTCAVQTCFLYILGAA
ECLLLAVMAYDRYVAICKPLLYPLIMNHKVCVQLVVVSWVIGVPVMIDETYRIFNLNFCGSKKLNHVFCDAPPLIELACEDTYEIEIYVHVAALIFVITPFLLILISYIT
IITTILRLPSTSGRYKAFSTCSSHLMVVGLFYGSGSIVYLQPKSRQSAGSIKVFALFYTTVTPMFNPLIYSLRNKDVIAALRKLLPK*
526 >lcl|XP_001374460.1|Plus1complement(20248571..20249896) NW_001581861 c2 calcium-dependent domain-containing protein 4B-like LOC100022688 __SEG__ Chr1 {Monodelphis domestica} MRFLEKLRDSTGVSTALEPEKVAVDLVSKRPAVSPFCNVLTPGRIPAFCIPPRLPSHTVPALQPLGSSTSPPRRCTVETDMWPHSRNSSGSTGEELLRSECVRAREDPDL
TDWDPRSQAALSLPHLPRQPTSYGFCALLESPNTRRKESLFLGSSAAAAALLLQAPSQSLLRPRAHTYCGSGGTNASCNLRGRRVAPDSLAIGCSSSSSSSASSSPCRSP
RPQEATAKRSRSRQRYRRLLRAPDALGRALRASGSRVLARARSVSSTEDDDEDYEAVGDARSISQTATCQSGSAQTRALSPSPSPSPLGPLQERLEVQSTLALGCDGGAL
HLATEYCSVSQRLRIRLLSAQGLYSCTAEPGAIGCRVSITLVLPGKTHKQRSAVVRRSRNPVFNEDFFFEGLSENDLRRTAVRVKAENKGRGLERDRLLGRGELELRTIL
L*
527 >lcl|XP_001374464.2|Plus1complement(17988274..17989197) NW_001581971 olfactory receptor 10AG1-like LOC100022694 __SEG__ Chr5 {Monodelphis domestica} MSEDNFTVVVEFILLGFSDLPNMQGFLFGIFLVIYLCTLIGNGLLIVITKIDPSLQTPMYFFLGNFSFLEICYTSVTFPRMLADLWTHKGTISFVACAVQTCFLYILGAA
ECLLLAGMAYDRYVAIYKPLLYPLMMNHKVCVQLVVASWLIGVPILIEETYQIFSLNFCGSKKLNHVFSDAPPLIELACGDTYQREISVHVTALVFVITPFLLIHISYIR
IITTILRLPSTSGRSKAFSTCSSHLMVVGLFYGSGSIVYLGPKSSHSAEPVKVFALFYITVTPMFNPLIYSLRNKDVIAALRKLFPK*
528 >lcl|XP_001374472.2|Plus1complement(5204385..5205323) NW_001581877 olfactory receptor 2T27-like LOC100022712 __SEG__ Chr2 {Monodelphis domestica} MRRNNETSMEDFILLGLFPEFRHSGILIYILLMIYIIAFLGNSLLILLIWGDSRLHTPMYILLSQLSLIDLTLTSTIVPKMVTNFCSGTKTISWIGCGTQSFFFLTLGMS
ECLLLTLMAYDRYVAVCNPLHYPVIMNFTVCLQMAIGCWIGGALSSLVHTVYPMNFPICGSREIHHFFCEVPVILKLSCEDTSTYELVVMVTSIVLLVVPFSLITASYIA
IFLTVLQMNSVKGRRKALAICSSHLTVVSLFFGPNIFIYMTLSSSHSPEQDQALSVFSNILTPMLNPVIYSLRNKEVVAALKKVLGKCTLSL*
529 >lcl|XP_001374478.2|Plus1complement(18010649..18011572) NW_001581971 olfactory receptor 10AG1-like LOC100022719 __SEG__ Chr5 {Monodelphis domestica} MSGDNFTVVVEFILLGFSDLPNMQGFLFGVFLVIYLCILIGNGLLIVITKIDPGLQTPMYFFLGNFSFLEICYTSVTIPRMLADLWTHKGTISFLACAVQACFLYILGAA
ECLLLAGMAYDRYVAICKPLYYPLIMNHKVCVQLVVASWVVGVPVLVEETYQIFSLNFCGPNKLNHVFCDAQPLIELVCGDTYQRQISVHVAALIFVITPFLLILISYVK
IITTILRLPSTSGVFKAFSTCSSHLMVVGLFYGSGSIVYLWPKSSHSAGSVKVFALFYTTVTPLFNPIIYSLRNKDVIAALRKLLPK*
530 >lcl|XP_001374488.2|Plus1complement(5227000..5227938) NW_001581877 olfactory receptor 2T27-like LOC100022735 __SEG__ Chr2 {Monodelphis domestica} MDKSNETSTTDFILLGLFPEFKYSGFLVSIIISFYIIAFTGNSILILLIWVDSRLHTPMYFLLSQLSIIDVAYISSSVPKMALNYYLGKRNISRVGCGTQMFFCLTLGGS
ECLLLTFMSYDRYVAICKPLHYPIIMCPRICLHMAVVSWVGGALNSLIQTIYTMHFPVCGSREIHHFFCEMPAILKLSCEDTTDYEMGIFVVSIVFILLPFSLIVTSYTL
IFLTILHMNSPEGRNKALATCSSHLTVVSLYLGPGIVVYMTPGSSHTPELTQGLSVFYTILTPMLNPLIYSLRNKDVLASLRKTMTKNLISK*
531 >lcl|XP_001374489.2|Plus146443313..46444266 NW_001581879 olfactory receptor 14A2-like LOC100022736 __SEG__ Chr2 {Monodelphis domestica} MSNLTSMTEFLLMGFSNTWELQVVHATFFLMIYLMALIGNLIIFTIISLDVHLHTPMYFFLKNLSFLDLCLISVTVPKSIVNSLSHNSSISYLGCVLQLFLVILFAGSEI
SILTVMSYDRYVAICQPLHYETIMIKGSCVKMAVASWFSGGVVGTMYSASTFSLPFCGSREIHQFFCDVPSLLRISCSEKHIVVYVSVAIGLGLGIFCCIYIITSYVHIF
STVLKIPTTQGRSKAFSTCLPHLIVFIVFIITGAMAYLKPPFDSNTVLDLLLSMFYTVVPPTLNPVIYSLRNKDMKTSINKLIAWKHSSEGLMKFFP*
532 >lcl|XP_001374507.2|Plus146478494..46479408 NW_001581879 olfactory receptor 14A2-like LOC100022766 __SEG__ Chr2 {Monodelphis domestica} MNNLTMVTEFLLMSFSKTWELQILQAILFLLIYLVALMGNLLIFTLISLDGHLHTPMYFFLKNLSFLDLCLISTTVPKSIANSMSHSHSISLLECILQLFLVIFFASSEL
FLLTVMSYDRYVAICRPLNYEVVMNKGTCVKMAAFSWLTGGLFGVLYTISTFSLSFCNSNEIHQFFCDVPSLLRISCSDTHIALDVTIAMGFSLGILCCISITISYGPIF
STVLKIPTTEGRSKAFSTCLPHLFVLLIFITTAALSYLSPPLDTNSVLDLLLSMFYMVVPPTLNPIIYSLRNKDVKTSLKKLIA*
533 >lcl|XP_001374525.2|Plus1complement(222534..223487) NW_001581878 olfactory receptor 2W1-like LOC100022788 __SEG__ Chr2 {Monodelphis domestica} MRHHNYSSPDGFILLGFSDHPELEMVLSGIVTVFYLITLIGNTAVILVSLLYPQLHTPMYFFLRNLSFLDLCFTTSIIPQMLVNLWGQDKAISYVGCAIQLYGYMWFGSV
ECLLLAVMSYDRFTAVCKPLHYLVIMNPQICLQMVSAAWGISLANSVVLCTMTLKLPRCGNHILDHFLCELPALVKIACIDTTAIEMTVFALGIIIILIPLSFILISYAL
IAKAVIRMKSAVGRKKAINTCGSHLTVVSIFYGTIIYMYMQPGNSASKDQGKFLTLFYTIITPSLNPIIYTLRNKDMKGAMKKLVKGDKGSLEIGGH*
534 >lcl|XP_001374526.2|Plus146496968..46497897 NW_001581879 olfactory receptor 14A2-like LOC100022789 __SEG__ Chr2 {Monodelphis domestica} MANLTLVTGFLLLGFAKSWELQVLHAILFLLIYLMSLMGNLVIFTLISLDEHLHSPMYFFLKNLSFLDLCLISTTLPKSITNSLSNSRSISFMGCVLQFFLVILFSGSEL
FLLSVMSYDRYVAICQPLHYEVIMTRGLCVKMAAVSWFFGIVFGTLYSATTFTLPFCHSKEIHQFFCDVPSLLRLSCSDVHIGVDVTMAIAAAIGILCFISITISYGPIF
STVLKIPTTEGRSKAFSTCIPHLTVLMVFITTAVIVYLKPPQQSDSILDLLLSMFYAVVPPTLNPVIYSLRNKDMKTSLRKLIAGKHIS*
535 >lcl|XP_001374527.2|Plus1complement(1962470..1963468) NW_001581929 olfactory receptor 52D1-like LOC100022791 __SEG__ Chr4 {Monodelphis domestica} MEPGPKLFPLNLTTLTLDPNSGPGPFVLLGIPGLEGAHAWLSVPICLLYLVAIIGNSLLLVLMAVDPAFHAPMYQLLGMLAAADLVLSTATVPKALSVLWGFSGEISFGA
CLAQLFFAHVAFVAESSVLLTMALDRYLAICWPLHYGTLLTPRVVGAAGVVALVRGMCVMAPPIVLLQKLPYCGRRAIPHTYCEHMGVARLSCGDTQVNIWYGLATTLLS
PVLDAGLIALSYAFILRAIFRLPSRGARHKALSTCGAHAGVIFLFYVPALFSFLTHRFGRHTVPGHVHILLANLYVVIPPALNPIVYGIRTRCIAERILRWLAPGRVGVG
RE*
536 >lcl|XP_001374531.2|Plus1complement(18068076..18069020) NW_001581971 olfactory receptor 5F1-like LOC100022796 __SEG__ Chr5 {Monodelphis domestica} MSGKNHSTVTEFILLGLTDSRELQVIFFVIFLAIYTLTVVGNVGMIVLIILDSRLHTPMYFFLSNLSFTDVCYSSTIAPKMLADLMSKKKTISFAGCFLQMYVFIALATT
ESILFGLMAYDRYVAICNPLLYTVTMSRNICLKMAAGAYTAGLLNSMINTSYLSSLSFCASNIIHHFFCDSPPLFKISCSDTHMNESIFSLCAGVNMVGTVLIILTSYIY
ILVSIMRMNSREGRHKAFSTCASHLTAIIIFYSTAIFTYLRPSSSYSLNQDKVASVFYTMVIPMLNPLIYSLRNKEVKKALKNVIRRKRNFAFI*
537 >lcl|XP_001374550.2|Plus1complement(1978788..1979735) NW_001581929 olfactory receptor 52H1-like LOC100022823 __SEG__ Chr4 {Monodelphis domestica} MVTFNLSGYNPDIFILVGIPGLEQFHIWIGIPFCVIYLIAVVGNSVLLYLIIMERSLHEPMFFFLSLLASTDLILSTAGVPKTLSIFWFGAREITFSGCLTQMFFLHYSF
VLDSAILLAMAFDRYVAICSPLRYSTILTPQAIIKIIVGICFRSFCIILPDVFLLKRLPFCQTRTIPHTYCEHIGVARLSCADISINIWYGFAVPIMTVISDVVLIAVSY
TLILHAVFRLPSHDARQKALGTCGSHVCVILMFYTPAFFSILAHRFGHNVPRTFHIMFANLYIVIPPALNPIVYGVKTKQIRDKIIILFSPKGTQ*
538 >lcl|XP_001374567.2|Plus1complement(1991825..1992772) NW_001581929 olfactory receptor 52H1-like LOC100022852 __SEG__ Chr4 {Monodelphis domestica} MVTFNLSGYNPDIFVLVGIPGLEQFHIWIGIPFCAIYLVAVVGNSVLLYLIIMERSLHEPMFFFLSLLASTDLILSTAGVPKTLSIFWFGAREITFSGCLTQMFLIHYSF
VLDSAILLAMAFDRYVAICSPLRYSTILTPQAIIKIIVGICFRSFFIIFPVIFLLKRLPFCQIRTIPHTYCEHIGVARLSCADISINIWYGFAVPIMTVISDVVLIAVSY
TLILHAVFRLPSHDARQKALGTCGSHVCVILMFYTPAFFSILAHRFGHNVPRTFHIMFANLYIVIPPALNPIVYGVKTKQIRDKIIILFSPKGTQ*
539 >lcl|XP_001374583.2|Plus1complement(404270..405229) NW_001581878 olfactory receptor 2B11-like LOC100022878 __SEG__ Chr2 {Monodelphis domestica} MSGSNESLPDMFVLLGFSDHSWIELPLFFILLISYLLAMLGNFSIILICRLDHHLHSPMYFFLTNLSFLDICFTTSIVPQILFNLGSSKTITYIGCAIQLYFFHFLGSTE
CLLLAVMSLDRYVAICKPLRYTLIMNQNICFLLVSIVWLSGLIYSLSEVTLTLQLPLCGHNELDHVVCEMPVLIKAACGDKSSNEFGLSLVCVFFLAIPLVLVIASYVCI
GKAVMNIQSSEGRKKAFGTCSSHLIVVLLFYGPAISMYLQPPSSISRDQPKFMALFYGVITPTLNPFIYTLRNKDVKGAIGNVLRTMFKSKRVSVSNIK*
540 >lcl|XP_001374586.2|Plus1complement(2007754..2008701) NW_001581929 olfactory receptor 52H1-like LOC100022881 __SEG__ Chr4 {Monodelphis domestica} MDSFNMSSFSRGPFMLMGIPGLEDFHIWISIPFCIIYLVAIAGNSILLYLITVEHSLHAPMFYFLAMLTVTDLVLSTTCVPKTLSIFWLGPQEIAFSSCLTQLFFLHYSF
VLDSAILLAMAFDRYVAICSPLRYTTILTPQVIVKIMVGISFRSFFVFVPCVFLVDRLPFCQTHIIHHTYCEHIGVARLSCADISINIWYGFCVPIMTVIIDVVLIAISY
TLILKAVFRLPSLDARQKALSTCGSHVFVILMFYIPAFFSILAHRFGHNVPLTFHIMFANLYVVIPPALNPIIYGVKTKQIRDKVFLLFSIKGTK*
541 >lcl|XP_001374590.2|Plus118142958..18143896 NW_001581971 olfactory receptor 5AS1-like LOC100022886 __SEG__ Chr5 {Monodelphis domestica} MSERNYTAPTEFVFIGFTDYLPIRIILFLLFLAVYVLTLVGNIGLIVLVNIDSNLQTPMYYFLSNLSFLDISYSTAIAPKMLADFLASRKNISLYGCALQMYFFACFADA
ECLILAAMAFDRYAAICNPLIYSTLMSRKVCVCFVVLAYVSGSMTSLVHVCLAFRLPFCRSHVINHFFCDIPPLLALSCASTSLNELLLFALCGFIQTTTFVIIFISYFC
ILITVLSIKSSGGRSKTFSTCASHLIAVALFYGTLLFMYLRPSNKYSPDTDKVVAVFYTVVFPMFNPIIYSLRNKDVKNSLKKMLDRISPNQ*
542 >lcl|XP_001374604.2|Plus1complement(476846..477790) NW_001581878 olfactory receptor 2B2-like LOC100022904 __SEG__ Chr2 {Monodelphis domestica} MMDWANETFPKEFILLGFSDWPWLEMPLFIILLVSYTMSIFGNMAIILVSYLDPKLHTPMYFFLTNLSLLDLCYTTSTVPQMLINICSKVKTISYGGCVAQLIIFLALGS
TECLLLAIMSFDRFVAICRPLHYQVIMHQRLCLKLAAACWLSGFSNSVLQSTWTLFMPRCGHYKVDHFFCEVPALLKLSCVDITANEAELFFICVLFLLIPLSLILISYG
FIAQAVLRMRSAEGRRKAFGTCGSHLVVVSLFYGAAIYMYLQPPSSTSEIWGKIVSLFYGIITPMLNPLIYTLRNKDMKGAFKGLLKRLLFLKK*
543 >lcl|XP_001374605.2|Plus146565437..46566366 NW_001581879 olfactory receptor 14A2-like LOC100022905 __SEG__ Chr2 {Monodelphis domestica} MANLTLVTGFLLMGFSKSWELQVLHAILFLLIYLMSLMGNLVIFTLISLDEHLHSPMYFFLKNLSFLDLCFISTTLPKSITNSLSNSRSISFMGCVLQLFLVILFGASEL
FLLTVMSYDRYVAICLPLHYEVIMTRGLCVKMAAVPWFVGILFGTLYSATTFTLPFCHSKEIHQFFCDVPSLLRLSCSDVHIGVDVTLAMGVAYGILCFISITISYGPIF
STVLKIPTTEGRSKAFSTCIPHLTVLMVFITTAVIVYLKPPQQSDSVIDLLLSMFYAVVPPTLNPVIYSLRNKDMKTSLRKLITRKHIS*
544 >lcl|XP_001374607.2|Plus1complement(2022778..2023704) NW_001581929 olfactory receptor 52B2-like LOC100022909 __SEG__ Chr4 {Monodelphis domestica} MADTNHTFNPAVFLLWGISGLEEFHIWISIPFCTMYVVALGGNSLLITFIWMEHSLHEPMYLFLSMLSLSDLFLSSAIMPKMLAIFWFQDRGISFHACIIQMFSVIAIFV
MESTVLLAMAFDRYVAICYPLRYTMILTPSVIRKIAGFSVTRGLIFTFPFAFLVEQLPFCGNNIIANTYCELPTVSRLACGDITASNIYILVLSFLSTGLDVILISISYM
FILRAVIRLPSRDAQFKALGTCSSHVCVILMFYLPAYLTLLISHLHCVVLLTNLYVVVPPALNPIIYVVRTKQIRDHIIRRFSQLGLA*
545 >lcl|XP_001374613.2|Plus118183959..18184900 NW_001581971 olfactory receptor 1052-like LOC100022915 __SEG__ Chr5 {Monodelphis domestica} MAVWNHTGFVKEFLLVGLTEIPELQIPLFLLFFVIYMVTLVGNWGMIIIIWMNIQLHTPMYFFLSNLSLCDISFSTVIAPKMLINFLVDNKASWFASCVLQGFFFAVYIT
TEVMLLSMMAYDRYVAIANPLLYTVAMTPRVCILMVLGSYLGGLINSLTHTIGLLRLNFCGPNVVNHYFCDFPPLLKLSCSDAHTNEMLILVFSGVITVFAFMIIMVSYI
HIIIAILRIRSAEGRRKAFSTCASHLTAVTLLLGSVTFSYIQPSSQYSMEQEKVSAVFYTLIIPMLNPLIYSLRNKEVKDAAKRSIIWKHSHN*
546 >lcl|XP_001374628.2|Plus1complement(2038362..2039291) NW_001581929 olfactory receptor 52B2-like LOC100022937 __SEG__ Chr4 {Monodelphis domestica} MVDTNHTFHPAVFILWGIPGLEELHIWISIPFCTMYVVALGGNSLLIIFIWIEHSLHEPMYLFLAMLAVSDILLSSVIMPKMLAIFWFQERVISFQTCITQMFSVIAIFV
MESTVLLAMAFDRYMAICFPLRYTMILTPSVIKKIVGFSVARGLMLSVPFVFLVEQLPFCGNNIIADTYCAEAKISRMACGDITAINIYTLVLSFLSTGLDVILISISYS
FILRAVFRLPSRDAQLKALGTCSSHVCVILMFYLPAYLTVLISHLHCVVLLTNLYMVVPPALNPIIYGVRTKQIRDHIIRRFSQLDRAA*
547 >lcl|XP_001374632.2|Plus118215442..18216383 NW_001581971 olfactory receptor 1052-like LOC100022942 __SEG__ Chr5 {Monodelphis domestica} MAVWNHTGFVKEFLLVGLTEIPELQIPLFLLFFVIYMVTLVGNWGMIIIIWMNIQLHTPMYFFLSNLSLCDICYSTVFAPKMLVNFLVENKASSFVGCVLQSFFFAVYVT
TEGILLSMMAYDRYVAIANPLLYTVIMTQRVCILMVLGSYLGGLINSLTHTIGLLRLNFCGPNVVNHYFCDIPPLLKLSCSDAHTNEMLLLVFSGVIAMFTFMIIMVSYI
HIIIAILRIRSAEGRRKAFSTCASHLTAVTLFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLIIPMLNPLIYSLRNKEVKDAAKRSIIWKHSHN*
548 >lcl|XP_001374642.2|Plus1549915..550877 NW_001581878 olfactory receptor 10-like LOC100022960 __SEG__ Chr2 {Monodelphis domestica} MRRHNDTLPHPTGFILVGFSEWPRLEMVLFVAISIFYIMTLLGNTAIIILSYLDPRLHTPMYFFLANLSFLDLCYTTSTVPQMLVNIQSKERSITFVGCVAQLLIFLGLG
STECVLLSVMAFDRYVAICRPLRYTVIMHSRLCHQLAIVAWVTGFSNSLIQTVLTLHLPRCGHYRLENFFCEVPAMLLLSCADTWVNEVEMYAAVVVIKVIPVGLILFSY
ANIAWAVLKIQSSEGRKKAFNTCGSHLLVVIMFYGSAISGYAYMAPKSKSAKLKGKLLALFYGLITPMLNPLIYTLRNKDVKAATKRLLGREQEHGWSMT*
549 >lcl|XP_001374643.2|Plus146611093..46612022 NW_001581879 olfactory receptor 14A2-like LOC100022961 __SEG__ Chr2 {Monodelphis domestica} MANLTLVTGFLLMGFSKSWELQVLHAILFLLIYLMSLMGNLVIFTLISLDEHLHSPMYFFLKNLSFLDLCLISTTLPKSITNSLSNSRSISFMGCVLQLFLVILFGASEL
FLLTVMSYDRYVAICLPLHYEVIMTRGLCVKMAAVSWFFGILFGTLYSASTFTLPFCHSKEVHQFFCDVPSLLRLSCSDVHIGIDVTLAIAVPIGFLCFISITISYGPIF
STVLKFPTTAGRSKAFSTCIPHLTVLMVFITTGVIAYLKPPQESDSVIDLLLSMFYAVFPPTLNPVIYSLRNKDMKTSLRKLLAQKHIS*
550 >lcl|XP_001374647.2|Plus1complement(2056328..2057281) NW_001581929 olfactory receptor 52B2-like LOC100022966 __SEG__ Chr4 {Monodelphis domestica} MAATNHTFHPVVFLLWGISGLEELHIWISIPFCTMYVVALGGNSLLIIFICMEHSLHEPMYLFLAMLSTSDLLLSTAIMPKMLAIFWFEDKVIPFQACITQMFSVIATFV
MESTVLLAMAFDRYVAICFPLRYTMILSPMVIRKIAIFSLARGLLITSPFIFLVEQLPFCGNNIITNTYCELPKISRLACADITAINIYTLVLSFLSTGLDVILISISYT
FILRAVFRLPSRDAQLKALGTCSSHVCVILMFYIPAYLTVLISHIQYGILLTNLYVVVPPALNPIIYGVRTKQIRDHIIRRFSQLGQVCLAGDVRNN*
551 >lcl|XP_001374653.2|Plus118232142..18233080 NW_001581971 olfactory receptor 1052-like LOC100022972 __SEG__ Chr5 {Monodelphis domestica} MAKENSTVVTEFFLLGLTDREELKLILFIFFLIIYIISLMGNLGMIVLIQITPKLHTPMYFFLTCLSFVDACYSSVAGPKMLWHFIVEKATISFTACMLQYFLLATFITT
EGFFLAVMAYDRYVAIAKPLLYMVAMTKRVCIMLVIGSCIGGLFNSLTHTIGLVQLTFCGPNVISHFFCDLPPLLKLSCSDTSLNELLVIIYTGVISIITLLTVIISYIF
IVVAIFRIRSAAGMRKAFSTCASHLTAVTLFYGSISFNYIQPSSKYSLEQEKVVSVFYIMVIPMLNPLIYSLRNKEVQDAVKKVIELKTSFS*
552 >lcl|XP_001374668.2|Plus1complement(588224..589168) NW_001581878 olfactory receptor 2G6-like LOC100022990 __SEG__ Chr2 {Monodelphis domestica} MERTNESSPVGFILLGFSDQPQLEMVLLFVISIFYILILVGNTTIILVSYLDPKLHTPMYFFLSNLSFLDLCFTTSIIPQMLWNLRGPDKTITYIGCVIQLYVALGLGST
ECVLLTVMAYDRYIAICRPLHYAIIMHPRLLKQLAAVIWASGFIESLVQSILTFQLPLCSHHRLDDFMCEEPAVIKIAAVDTTFMENELCIAIILYVVIPLGLILISYGC
IARTTLRIKSAEGRKKVFGTCGSHLVVVALFFGTIIAVYIQPKNKYTENQGKFLTLFYTVVTPTLNPMIYTLRNKDVKGALRRLLGQNQGSGET*
553 >lcl|XP_001374669.2|Plus146638198..46639127 NW_001581879 olfactory receptor 14A2-like LOC100022991 __SEG__ Chr2 {Monodelphis domestica} MANLTLVTGFLLMGFSKSWELQVLHAILFLLIYLMSLMGNLVIFTLISLDEHLHSPMYFFLKNLSFLDLCFISTTLPKSITNSLSNSRSISFIGCVLQLFFVILFGASEL
FLLTVMSYDRYVAICQPLHYEVIMTRGLCVKMAAVPWFIGILFGTMYSASTFTLPFCNSKEIHQFFCDVPSLLRLSCSGVHIGVDVTLAMGVAYGILCCISITISYGPIF
STVLKIPTPEGRSKAFSTCIPHLTVLMVFITTILIDYLKPPQESDSVIDLLLSMFYAVVPPTLNPVIYSLRNKDMKTSLRKLIARKHIS*
554 >lcl|XP_001374678.2|Plus118260038..18260976 NW_001581971 olfactory receptor 1052-like LOC100023001 __SEG__ Chr5 {Monodelphis domestica} MAIENSTVVKEFLLLGLTDHAELKVPLFILFLLIYFISLVGNLGMIVLIRISPKLHTPMYFFLSCLSFVDACYCFVFGPEMLLNFFEEKATISFAACILQYFVFAELITT
EGFFLAVMAFDRYMAIANPLLYMVVMTKKVCAILVIGSCIGGIINSLTHTIGLVRLSFCGPNVISHFFCDVPALLELSCSDTSGNELLLLIFSGVIAIMTFLTVIISYIF
IVVAILKIRSAAGTRKAFSTCVSHLTAVTLFYGSVSFSYIQPSSQYSMEQEKVVSVFYTMVIPMLNPFIYSLRNKEVKDAVKRAIELKPSFY*
555 >lcl|XP_001374688.2|Plus1629776..630744 NW_001581878 olfactory receptor 10C1-like LOC100023020 __SEG__ Chr2 {Monodelphis domestica} MNSRYRVSLDNHTYISQFIFSNFSDVPELCYLLFAIVLLMFLTSLTGNTLIGIVIQSTPALHTPMYFFLVNLSFLEIGYTCTVVPKMLQSLVSENREISRLGCATQMFFF
TLFGISECCLLASMAFDRYVAICTPLRYATRMSWSMCTQLAGVSWSIGTLVALGQTNYIFSLNFCGPTKINHLFCDILPVIALACGDTSHNEMAVYAVAFLFIASPFLLI
IASYGFILADVLAMSSPEGQRKALSTCSSHLIVVTLFYGSGSITYLRPKASHSPILDKLLALFYTVVTSMLNPIIYSLRNKEVKAALQKTLGKIMCSVQDKN*
556 >lcl|XP_001374689.2|Plus146671283..46672239 NW_001581879 olfactory receptor 14A2-like LOC100023021 __SEG__ Chr2 {Monodelphis domestica} MANLTIVTGFLLKDFSDIWELQILHAMLFLLIYLVTLIGNFLIFTIISLERKLHTPMYFFLKNLSFLDLCLISITVPKSIANSLSHNCSISFLGCVSQLFLMILFAITEL
FLLTAMSYDRYVAICQPLNYEVIMNSETCVKMAATSWLSGVLFGVLYSASIFTLPFCHSKEIHQFFCDVPSLLRISCSDSHLAVDVTISLAFSLAVLSSIYIIISYSYIF
STVLKIPTTEGRSKAFSTCLPHLIVLIVFVTTGSISYLKPSQDSDSVLELLLAMFYTVVPPTLNPVIYSLKNKDMKTALRKFITWKYFSKGLILKSFP*
557 >lcl|XP_001374692.2|Plus1complement(2076132..2077085) NW_001581929 olfactory receptor 52B2-like LOC100023025 __SEG__ Chr4 {Monodelphis domestica} MDSTNYTFHPTVIILKAIPGLEKVQFWISIPFSSMYVVALGGNSLLIILIWMEHSLHEPMYIFLAMLAMTDFLLCNTIMPKMLALFWFQAESISFQACITQMFFVIFIFV
MESTVLLAMAFDRYVAICFPLRYTMILTPSVIWKIAGFSVARGLVITSPFVFLVERLPFCGNNIIADTYCELTKISRLACADITANNIYTLVMSFLSTGLDVLLISISYV
FILRAVFRLPSRDAQLKALGTCSSHVCVILMFYLPAYLTVLTSHLGCGVLLANLYVVVPPALNPIIYGVRTKQIRDIVTSRLSQLGLWSRGEGVQED*
558 >lcl|XP_001374696.2|Plus118270698..18271633 NW_001581971 olfactory receptor 1052-like LOC100023030 __SEG__ Chr5 {Monodelphis domestica} MAIKNSTVVTEFLLLGLTDREELKVFLFILFLLIYIISLVGNLGMFILIQITPKLHTPMYFFLSCLSFVDACYCSVSGPKMLMNFFKQATISFSACILQGFLFGVFVTTE
GFFLAVMAYDRYVAIANPLLYMVVMTKRVCIMLVFGSCIGGMINSLTHSIGLVKLSFCGPNIISHFFCDVPAMLKLSCSDTSRNELLLLIFSGVIAIITFLTVIISYVFI
VVAILRIRSAAGKRKAFSTCASHMIAVTLFYGSISFSYIQPSSQYSMEQEKVVSVFYTLVIPMLNPLIYSLRNKEVKDAVKRARELKPSFC*
559 >lcl|XP_001374706.1|Plus1complement(5213005..5213904) NW_001587050 casein kinase I isoform alpha-like LOC100023040 __SEG__ ChrX {Monodelphis domestica} MASSIVGGKYELLRKVGAGSFGDIYLAINITNGEEVAVKLESQKAKHPQLLYESKLYKVLQGGVGIPHMRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLA
DQMISRIEYVHTKNFIHRDIKPDNFLMGIGPHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNKSSLPWQGLKAA
TKKQKYEKISEKKMSTPVEVLCQGFPAEFAMYLNYCRDLCFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKMT*
560 >lcl|XP_001374710.2|Plus1complement(673838..674758) NW_001581878 olfactory receptor 2H1-like LOC100023046 __SEG__ Chr2 {Monodelphis domestica} MERSNKSSSVGFILLGFSDQPQLEIVLLYVVSIFYFLTLVGNTTIILVSYLDPKLHTPMYFFLSNLSFLDLCFTTSIIPQMLWNFKGPDKSITYVGCIIQFFVALGLGCT
ECILLTVMAYDRFVAICQPLHYAIIMHPRLLKQLAAVSWISGFLESLVQSNLTFHLPLYSHHRLDDFMCEEPALIKIAAVDTTFIETEICIASILHVMIPLGLILVSYGF
IARTTLRIKSSGGWRKVLGTCGSHLVVVTLFFGTILVAYIQPKKKYTQSQTKFFTLFYTVITPTLNPIIYTLRNKDVKGALTRLLG*
561 >lcl|XP_001374711.2|Plus146689412..46690338 NW_001581879 olfactory receptor 14A2-like LOC100023047 __SEG__ Chr2 {Monodelphis domestica} MANLTLVTGFLLMGFSKSWELQVLHAILFLLIYLMSLMGNLVIFTLISLDEHLHSPMYFFLKNLSFLDLCFISTTLPKSITNSLSNSHSISFIGCVLQFFLVILFAASEL
FLLTVMSYDRYVAICQPLHYEVIMTRGLCVKMAAVSWFFGIVFGTLYSATTFTLPFCHSKIHQFFCDVPSLLRLSCSDVHIGVDVTLAVGVAIGILCFISITISYGPIFS
TVLKIPTTEGRSKAFSTCIPHLTVLMVFITTSVIDYLKPSQQSDSILDLLLSMFYAVVPPTLNPVIYSLRNKDMKTSLRKLIARNHIP*
562 >lcl|XP_001374713.2|Plus12097374..2098321 NW_001581929 olfactory receptor 52B2-like LOC100023050 __SEG__ Chr4 {Monodelphis domestica} MSTPNFSINYDMFVLIGIPGLKEMHLWISIPFCLMYLVALSGNLILIFVVAIERSLHEPMYLFLSMLAFWDLILSTSTVPKALAIFWLEDTNISFGGCVTQLFFMHFAFV
VESGILLAMAFDRYVAICYPLQYTTILNHGVIGKIGGIVVFRSFATVFPIVFLLKRLPFCRTNIIAHTFCEHMGLAKLACADITINIWYGISVPLLSVMLDMVAIVISYI
LILRAVFRLPSRDARLKTLSTCGSHVCVILMFYLPGIFTVIAQRFGRKIPRHVHILLANLYVLVPPMMNPVIYGVKTKQIRERVGLLFSPKGKCC*
563 >lcl|XP_001374717.2|Plus118282857..18283792 NW_001581971 olfactory receptor 1052-like LOC100023056 __SEG__ Chr5 {Monodelphis domestica} MAKENSTEVTEFLLLGLTDREELKVFLFVLILLIYIISLVGNLGMFILIQITPKLHTPMYFFLSCLSLVDACYCSVFGPEMLVSFFEKTTISFSACILQGYLFGVFVTTE
GFFLAVMAYDRYVAIVNPLLYMVVMTKRVCALLVIGSFIGGISNALIHTIGLVRLSFCGSNIIHHFFCDVPAMLKISCSETSRNELLLLIFSGIIAILTFLIVIISYIFI
VVSILRIRSAAGTNKAFSTCASHLTAVTLFYGSLSFSYIQPSSQYSLEQEKVVSVFYTMVIPMLNPLIYSLRNKEVKDAAKRAIELKPSFC*
564 >lcl|XP_001374730.2|Plus1complement(727680..728600) NW_001581878 olfactory receptor 2G6-like isoform 1 LOC100023079 __SEG__ Chr2 {Monodelphis domestica} MERTNKSSPVGFILLGFSDQPQLEMILLYVISVFYILTFVGNTTIILISYLDPKLHTPMYFFLSNLSFLDLCFTTSIIPQMLWNFRGPDKNITYIGCMIQFFVALGLGSA
ECVLLTVMAYDRYIAICRPLHYTLIMHPRLLKQLAVVIWISGFLESLVQSILTFQLPFCSHHKVDDFMCEEPALIKIAAVDTTFIETELCIASILYVMMPLGLILVSYGC
IARTTLKIKSTEGRRKVFGTCGSHLMVVTLFFGTVLIVYIQPKNKYTQNQSKFLTLFYTVVTPTLNPMIYTLRNKDVKGALGRLLG*
565 >lcl|XP_001374731.2|Plus146700227..46701183 NW_001581879 olfactory receptor 14A2-like LOC100023080 __SEG__ Chr2 {Monodelphis domestica} MANLTIVTGFLLKGFSDIWELQILHAMLFLLIYLVTLIGNLLIFTSISLERKLHTPMYFFLKNLSFLDLCLISITVPKSIANSLSHNCSISFLGCVSQLFLLVLFAVTEL
FLLTAMSYDRYVAICQPLNYEVIVNSETCVKMAATSWLSGVLFGVLYSASIFTLPFCDSKEIHQFFCDVPSLLRISCSDSHLAVNITISLAFSLGILFSIYIIISYSYIF
STVLKIPTTEGRSKAFSTCLPHLIVLIVFITTSSISYLKPSQDSDSLLELLLAMFYTVVPPTLNPVIYSLRNKDMKTALRKLITWKYFSKGLILKSFP*
566 >lcl|XP_001374734.2|Plus12108237..2109187 NW_001581929 olfactory receptor 52H1-like LOC100023083 __SEG__ Chr4 {Monodelphis domestica} MMATFNLSSYNPSFFILVGIPGLEKFHIWIAIPFCVIYLVAIVGNCVLLYLIAVEHSLHEPMFFFLSMLAKTDLILSSTTMPKLLSNLWFGDKKITFSGCLTQMFFLHFS
FVVDSAILLAMAYDRYVAICSPLRYTTILTHQVIIKIVVGIIFRSFCVILPDVFLLKRLPFCRTRIIPHTYCEHIGVARLSCADISINIWYGFAVPLMTVVSDIVLIAVS
YTIILSAVFRLPSRGARQKALGTCGSHVCVILMFYTPAFFSILAHRFGHDVPRHVLILFANFYVAIPPALNPIVYGVKTKQIRDKILLLFSPKGTQ*
567 >lcl|XP_001374753.2|Plus1complement(2125020..2125952) NW_001581929 olfactory receptor 52A5-like LOC100023111 __SEG__ Chr4 {Monodelphis domestica} MANGTIFMPSLLFLIGIPGLETVQCWIGIPFCAMYVVAMVGNYLLLFIIRSESSLHKPMYLFLAMLGVTDIALSTCILPKMLGIFWFHLKEIYFEACLLQMWLIHTFQSI
ESGILLAMALDRYVAICDPLRHTTIFTPQLLTQIGVGVTLRAAILVAPCLVLIKCRLKHYRTTVISHTYCEHMAIVKLAADDIRVNKAYGLFVAFTILGFDIIFITLSYI
LIFIAVFRLPQKEARLKAFNTCIAHIFVFLEFYLLAFFSFFTHRFGFHIPPYVHILLSNLYLLVPPLLNPIVYGVKTKEIRNRIIKMFHY*
568 >lcl|XP_001374754.2|Plus118340393..18341328 NW_001581971 olfactory receptor 8I2-like LOC100023114 __SEG__ Chr5 {Monodelphis domestica} MAGGNLTTITSFTLSGFANQPELQVGLFLIFLFIYFFTIWGNLGLIILIQMDSQLHTPMYFFLSNLAFIDISYSSTITPKALDNFLSDQKDISFVGCFVQMYFFVGLVCS
ECFLLGSMAYDRYVAICNPLLYSVVMSQKVCIWLAIIPYVVGFNNSLITVCVISSLAFCNSTIDHFFCDTTALLALSCHDSFNTEMVIFLLAGFTLLSSLIIITISYFAI
ISAILKIRSSEGQRKAFSTCASHLMGVTIFYGSLIFTYLQPDNTLFLTEAQVASVFYTIVIPMLNPLIYSLRNKDVKNALIRVIQKKLFPQ*
569 >lcl|XP_001374762.2|Plus1complement(761372..762307) NW_001581878 olfactory receptor 2G3-like LOC100023127 __SEG__ Chr2 {Monodelphis domestica} MMKVMNDSTGGDFILVGFSDQPKLEKILFVVVLISYLLTLLGNTAIILVSRLDSKLHTPMYYFLTNLSLIDLCFTTSIVPQLLWNLRGPAKTITPIGCAIQLYVSLALGS
TECVLLAVMAFDRYAAVCRPLHYATFMHPRLCQTLAGVAWVSGLGNTLIQGTITLQLPLCGHRRLYHFICEVPAMIKLACVDIHANEIQLFVASLVLLLLPLGLILISYA
LIAQQVLRIRSAQAWQKAMRTCGSHLLVVTLFYGTITAVYIQPNSSYAHRQGKFITLLYTVVTPTLNPLIYTLRNKDMKGALKRLLGKEPR*
570 >lcl|XP_001374765.2|Plus1complement(18366722..18367705) NW_001581971 olfactory receptor 5T1-like LOC100023135 __SEG__ Chr5 {Monodelphis domestica} MIKTTTMTTTTIMSNHTEVIMFVFIGFTNHLEIQISLFLMFLLIYIFTMVGNLGLVLLVAMDSRLHTPMYHFLSVLSFLDACYSSVITPKMLVNFLAENKTISFSGCVTQ
MLISITFGTTECFLLAVMAYDRYIAICNPLLYTAIMSPQVYVPLIIGSYVAGVLHAIIHTVATFHLSFCASNEIRHIFCDIPPLLAISCSDTHVNELLLFTFVSSIEIFT
ILIVLVSYGFILAAILRIRSTEGRKKVFSTCGSHLTGVSIYHGTILFMYLRPTASYSLQHDMIVSVFYTIVIPMLNPIIYSLRNKDVKDAIKKVLGRNKCTDTLLNA*
571 >lcl|XP_001374769.2|Plus1680935..681879 NW_001587030 olfactory receptor 13H1-like LOC100023139 __SEG__ ChrX {Monodelphis domestica} MNYQEIGNHSKVTEFILVGLSRQPASQISLFWTLLFVYVVTLLGNSAILVAVWGESRLHTPMYFFLGNLSFLDLLFSTSTVPLVMMNALWDFPTISYNDCFTQLAFRAFL
ALAECFLLAIMAYDRFVAISTPLCYPAVMNIRVCRGLAVACWTMALVVTVIPILTVPVSFCGRNAINHFSCEVQAIFKLLCSDTSLLESLMMASATISMPVPLAFILASY
LRIIAAVLRIHPLKARLKAFSTCGSHLTTVAIYFGTLIYIYLKPQSKESQDGDKLFSIFYAVVTPMLNPLIYTLRNKDMKFALRKVFFKTKSLE*
572 >lcl|XP_001374775.2|Plus1complement(792575..793519) NW_001581878 olfactory receptor 2G6-like LOC100023151 __SEG__ Chr2 {Monodelphis domestica} MERNNKSSPMGFILLGFSDQPQMERVLLFIIAIFYVLTLMGNTTIILVSFLDPKLHSPMYFFLSNLSFLDICFTTSIIPQMLWNLSGTDKTITYIGCIIQLYIFLGVGST
ECILLTVMAYDRYIAICRPLHYNVIMHPRCLKQLAAVIWVSGFVGPLIQSILTFQLPLCSHHRVEHFMCEAPALIKIAAVDTTFIETELSIASILYVVIPLVLILVSYGC
IARTTLRMNSAEGRWKLFGTCGSHLMVVALYFGPIIAVYIQPKNEYTQKRTKFLALFYTVVTPTLNPMIYTLRNKDVKGSLRRLLGSNKGSEHT*
573 >lcl|XP_001374779.2|Plus1complement(2174425..2175357) NW_001581929 olfactory receptor 52A5-like LOC100023155 __SEG__ Chr4 {Monodelphis domestica} MANGTIFMPSLLFLIGIPGLETVQCWIGIPFCAMYVIAMVGNYLLLFIIRSESSLHKPMYLFLAMLGVTDIALSTCILPKMLGIFWFHLKEIYFEACLLQMWLIHTFQCI
ESGILLAMALDRYVAICDPLRHTTIFTPQLLTQIGVGVTLRAAILVAPCLVLIKCRLKHYRTTVISHTYCEHMAIVKLAADDIRVNKAYGLFVAFTILGFDIIFITLSYI
LIFIAVFRLPQKEARLKAFNTCIAHIFVFLEFYLLAFFSFFTHRFGFHIPPYVHILLSNLYLLVPPLLNPIVYGVKTKEIRNRIIKMLNY*
574 >lcl|XP_001374783.2|Plus118391234..18392199 NW_001581971 olfactory receptor 8J3-like LOC100023160 __SEG__ Chr5 {Monodelphis domestica} MVPENLSHVNTFILIGVSDDPYLQVPLFFIFLVIYGVTVTGNMGIITLTNIDSRLQTPMYFFLRHLAIINLGNSTVIAPQMMVNFLAEKKTISYYGCATQMGAFLVFIIA
ETFMLAAMAYDRYVAICNPLLYMVVVSRKVCILLVFLTYIYSFSTSATVTPYVFSMSYCSSNVINHFCCDTVPLLALSCSDTSIPQTVIFISAAINMFFSITIVLVSYFY
IILAILRIRSAEGRKKAFSTCASHMMAITIFYGTLLFMYLQPGSKHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKEALKRFLTSPHQFHTYSSHKRDS*
575 >lcl|XP_001374786.2|Plus1complement(698010..698993) NW_001587030 olfactory receptor 3A1-like LOC100023164 __SEG__ ChrX {Monodelphis domestica} MSPQAPLSMGERTPGTLPRANGTPVLEFLLEGLTDVTDVKPVLFTVFLLIYVVALAGNLGIASLIALDRRLHTPMYFFLANLSLLDAAYVSNSVPQILAHLLATEQLMSY
RACLTQMFFLHFLAPWECFLLTAMAYDRYAAICRPLHYLVLMGPRTRTILASVSCLLALTNALTHTLLATRLDFCGPRLITHFFCDLPPLLKLACSSTQPNELGLFFFSF
LVALLPCALVVVSYFNVAVAILRIRSAEGRRKAFSTCAAHLTVVCIFYITSVLCYILPSSAYSRTRSRVFSVLYTILTPMLNPIIYSMRNKEVKRAVYKVLRREEPM*
576 >lcl|XP_001374799.2|Plus1complement(825920..826846) NW_001581878 olfactory receptor 2G3-like LOC100023178 __SEG__ Chr2 {Monodelphis domestica} MMNDSTGGDFILVGFSDQPKLEKILFVVILISYLLTLLGNTAIILVSHLDPKLHTPMYYFLTNLSLVDLCLTTSIVPQLLWNLRGPAKTITPIGCAIQLCVSLALGSTEC
VLLAVMAFDRYAAVCRPLHYATFMHPRLCQTLVGVAWVSGLGNTLIQGTITLQLPLCGHRRLYHFMCEVPAMIKLACVDIHANEIQLFVASLVLLLLPLGLILISYAVIA
QQVLRIRSSQAWQKAMRTCGSHILVVTLFYSTITAVYIQPNNSYAHSQGKFITLLYTVVTPTLNPLIYTLRNKDMKGALKRLLGKDPR*
577 >lcl|XP_001374823.2|Plus1complement(859097..860029) NW_001581878 olfactory receptor 2G3-like LOC100023209 __SEG__ Chr2 {Monodelphis domestica} MRMINDSTGGDFILVGFSDQPQIEKILFIVVLISYLLTLVGNTAIILVSRLDPKLHTPMYYFLTNLSLIDLGFTTSIVPQLLWNLRGPAKTITPIGCAIQLYVSLALGST
ECVLLAVMAFDRYAAVCRPLHYATFMHPRLCQTLVGVAWVSGLGNTLIQGTITLKLPLCGHRRLYHFICEVPAMIKLACVDIHANEIQLFIASLVLLLLPLGMILISYAL
IAQEVMRIRSAQAWQKAIKTCGSHLLVVSLFYGPSTAVYIQPSSSYAHRQGKFITLLYTVVTPTLNPIIYTLRNKDMKEALIKLLGKDTR*
578 >lcl|XP_001374824.2|Plus1complement(1494853..1495872) NW_001581904 leucine-rich alpha-2-glycoprotein-like LOC100023210 __SEG__ Chr3 {Monodelphis domestica} MGSSRPMQLLLFLLLFPSFGQGVPQCPEACKCTLSVNGTSVICGPLDSFPKSFPMDTISISVEYTNLSQLSSDALRGLPNLKELHLAGNRIDSLSPGLLMSTPALEVLDL
TGNALTGLPSGLFRNSEALHSLVLKGNKLNTLQVDWLEGLVALNWLDVSENQLQKLPPDLLLNLTRLQTLDLSDNMLLELPSNLLQGLSALKKLHLEDNKLQTLADGTFS
TTPYLCHLFLQGNRLDSLPSNIFSNLTELDMLDLSNNSLAQVPDGLLDRVGLPQHQMKDGFDLSGNPWNCDEKLHGLYSWLLINQDRMFFKDKTLCVGPKDQAGQRLLEV
AKKRVSPKQ*
579 >lcl|XP_001374827.1|Plus12208016..2208963 NW_001581929 olfactory receptor 52B6-like LOC100023213 __SEG__ Chr4 {Monodelphis domestica} MPSLNITDARLSGCFLTGIPGLEDEHIWLSIPFFIMYMAALAGNSILISVIITQRSLHEPMYLFLSMLASADVLLSTSTMPKALTIFWLGTQAISFNECLTQMFCIHFLF
VADSAILLAMAFDRYVAICSPLHYHNILTPTVIKKITGATLTRSFCIIFPSVLLLKRLPYCKTNIISHTFCEHMGIAWLACADISVNVWYGLAAALLSTGLDIILIAVSY
VLILRTVFHLPSQEAQRKALGTCGSHICVILLFYIPALFSVFAYHFGRKNIPRYVHILLANLYVVIPPMLNPVIYGVRTKQIWEGAVQMFSQLRK*
580 >lcl|XP_001374832.2|Plus118439750..18440700 NW_001581971 olfactory receptor 8K5-like LOC100023218 __SEG__ Chr5 {Monodelphis domestica} MDNWNETKWTRVTEFILRGITDFPELQIPLFIVFLIIYTVTALGNLGLIILTKIDSRLKTPMYFFLRNLAFIDLGYSTAIGPKMLGNFVMERNTISYAGCATQLVVFITF
IISELFMLSVMAYDRYVAICNPLLYMVIMSDRLCCLLVAIPYLYSTSLALVTTIKIFNSSSWKSNVISHFYCDSLPLLSILWNDAKDVELIILSLSAVNLVSSLLVVLLS
YALILVAILRMNSAEGRRKAFSTCGSHLTVVVVFYSTLTFMYLQPKSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKGALKKALENRLKCVL*
581 >lcl|XP_001374842.1|Plus1890250..891194 NW_001581878 olfactory receptor 2B2-like LOC100023238 __SEG__ Chr2 {Monodelphis domestica} MWTSNQSSLEGFVLLGFSDRPWLEKPLFVIFLVAYIFALFGNVSIILVSRLDPQLDSPMYFFVSNLSLLDLCYTTSTVPQMLVNLWGPEKTISYGGCVAQLYIFLALGST
ECILLAIMAFDRYAAICKPLHYPVIMNQRRCIHMAAGTWFSGFANSLVQSTLTMVAPRCGRKIVDHFFCEVPALLKLACIDTHVNEAELNVLGALLLLVPLTLILGTYGF
IAQAVMKIRSAESRWKAFNTCASHLLVVSMFYFTAISMYVQPPSSYSRDRGKVMALFYGIVTPTLNPFIYTLRNKDVKAALRRALTKEFWIKAR*
582 >lcl|XP_001374850.2|Plus118464940..18465890 NW_001581971 olfactory receptor 8K5-like LOC100023249 __SEG__ Chr5 {Monodelphis domestica} MDKRNETKWTRVTEFILRGITDFPELQIPLFILFLIIYTVTALGNLGLIILTKIDSRLKTPMYFFLRNLAFIDLGYSTAIGPKMLGNFLVERNTISYVGCATQLVVFITL
IISELFMLSVMAYDRYVAICNPLLYMVIMSDRLCCLLVAIPYLYSSSVALVITIKIFNSSSWKSNVISHFYCDSLPLLSILWNDTKDVELIILSLSAFNLISSLLAILLS
YALILVAILRMNSAEGRRKAFSTCGSHLTVVVVFYATLTFMYMQPKSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKGALKKALENRFKCVL*
583 >lcl|XP_001374871.2|Plus1complement(994233..995168) NW_001581878 olfactory receptor 12D2-like LOC100023283 __SEG__ Chr2 {Monodelphis domestica} MSNHTSVNELLLIGITETQELQPFLFAVFLIIYILILIGNGAILVIVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKLLDNFLSTHKTISFVGCITQLHFFHFFGSTEA
ILLGVMAFDRFMAICNPLRYTILMNHEVCLCLAAAAWITGFFHALLHSIMTSHLNFCGSNLIHHFFCDIKPLLELACGNIELNQWMLEIVTGTLGMSPFFFILLSYFYII
SFLLFKSRSCSTLQKALSTCASHFMVVMLFYVPALFTYIRPSSGSSMDQDRIVAIIYSVVTPVLNPVIYTLRNKDVKGALSKAIRKKLWFE*
584 >lcl|XP_001374873.2|Plus1complement(2266247..2267215) NW_001581929 olfactory receptor 52B4-like LOC100023285 __SEG__ Chr4 {Monodelphis domestica} MNIPIANITVISHKFFYLMGIPGLEDQHIWISVPFFTSYIIAFLGNSFLIFIIVTDHSLHEPMYIFLCMLAIFDLGLSTIIIPKALTIFWFNSGGISLDGCIIQIFFVHS
TFIAESGILLIMAFDRYIAICYPLRYTMILKSSVIIKISIAAYMRGIVTVFPLTFLLKKLIFCKNNFLPHTFCEHIGLAKYACVSIRVNLWYGLFVILITIVLDVILIVA
SYCMILRAIFHMPSQEARLKTLHTCGSHICVILLFYIPAIFTTLVQRYGKSIPPHVHILIANIAILIPPMMNPIIYGIKTKQIRNRMFQHCLRAKNDLRSDG*
585 >lcl|XP_001374875.2|Plus118499523..18500473 NW_001581971 olfactory receptor 8K5-like LOC100023288 __SEG__ Chr5 {Monodelphis domestica} MDNWNETKWTQVTEFILRDITDLPELQIPLFILFLIIYTITALGNLGLIILTKIDSHLKTPMYFFLRNLAFIDLGYSTAIGPKMLGNFVVERNTISYVGCATQVVLFITF
IISELFMLSVMAYDRYVAICNPLLYMVVMSDRLCCLLVAIPYLYSSSVALVITIKIFNSSSWKSNVISHFYCDSISLLSILWNDAKDLELMILSISVFNLISSLPAILLS
YALILVAILRMNSAEGRRKAFSTCGSHLTVVVVFYATLTFMYLQPKSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKGALKKALENRFKCVL*
586 >lcl|XP_001374889.2|Plus1complement(2307655..2308605) NW_001581929 olfactory receptor 52B4-like LOC100023310 __SEG__ Chr4 {Monodelphis domestica} MNMAIANITVISHTYFYLLGIPGLEDQHIWISIPFFAFYIIALLGNILLIIIVVIDQSLHEPMYIFLCMLAVTDIGLSTTTIPKALAIFWFNSGIISLDGCITQLFFIHS
TFVVESGILLVMAFDRYIAICYPLRYTMILNSSVIIKLGIAAYMRGAVTIFPIIFLLKRLPFCKNNLLPHTYCENIGLAKYACASIRANIWYGIFVLLVTVVLDIILIVA
SYSMILHAIFRIPSQDARHKALHTCGSHVCVILLFYIPGIFTFLVQRFGRQIPPHIHILIANICMLAPPLMNPIIYGIKTKQIKNSIYHLLFQRQK*
587 >lcl|XP_001374903.2|Plus1complement(1050265..1051200) NW_001581878 olfactory receptor 12D2-like LOC100023328 __SEG__ Chr2 {Monodelphis domestica} MPNHTSVNEFLLLGITDIRELEPFLFAVFLIIYILILIGNGAILVIVISDSRLHSPMYFFLGNLSCLDICYSTVTLPKMLDNFLSTHKTISFVGCIIQLHFFHFLGSTEA
ILLGVMAFDRFMAICNPLRYTILMNHEVCLCLAAATWITGFFHALLHSIMTSRLTFCGSNHIHHFFCDIKPLLDLACGNTELNQWMLETVTGTIAMSPFFFILLSYFYII
SFLLFKSRSCSMLQKALPTCASHFIVVILFYAPVVFIYIRPTSDSSMDQDRIAAIMYSVVTPVLNPLIYTLRNKDVKGALSKVIRKKLSVT*
588 >lcl|XP_001374908.2|Plus1complement(2336843..2337793) NW_001581929 olfactory receptor 52B4-like LOC100023334 __SEG__ Chr4 {Monodelphis domestica} MTMAITNITVISHTYFYLLGIPGLEDQHIWISIPFFTSYIIALLGNIFLIFIVVTDHSLHEPMYIFLCMLAILDIGLSSITIPKALTIFWLNYGGISLDGCITQLFFIHF
TFIAESGILLLMAFDRYIAICYPLRYTMILNSSVIIKLSIVVYMRSIVTIFPMIFLLKRLTFCKNNLLPHTFCEHIGLAKYACVSIHVNIWYGLFVLLMTVVLDIILIVA
SYCMILYAIFRIPSQDARHKALHTCGSHICVILLFYIPGVFTSVVQRFGKQIPPHIHILIANVCLLVPPVMNPIIYGIKTKQIRNRVYLLLFQRQS*
589 >lcl|XP_001374923.2|Plus1complement(1066735..1067670) NW_001581878 olfactory receptor 12D2-like LOC100023355 __SEG__ Chr2 {Monodelphis domestica} MFNHTSVNEFLLLGITDIRELEPFLFAVFLIIYILILIGNGAILVIVISDSRLHSPMYFFLGNLSCLDICYSTVTLPKMLDNFLSTHKTISFVGCIIQLHFFHFLGSTEA
ILLGVMAFDRFMAICNPLRYTILMNHEVCLCLAAATWITGFFHALLHSIMTSRLTFCGSNHIHHFFCDIKPLLELACGNTELNQWMLETVTGTIAMSSSFFILLSYFYII
SFLLFKSRSCSMLQKALSTCASHFIVVILFYAPVVFIYIRPTSDSSMDQDRIAAIMYSVVTPVLNPLIYTLRNKDVKGALSKVIRKKLSVT*
590 >lcl|XP_001374930.2|Plus12363862..2364806 NW_001581929 olfactory receptor 52B4-like LOC100023364 __SEG__ Chr4 {Monodelphis domestica} MVILNHTSISHTIFILVGIPGLEDQHMWISIPFLISYLTAIIGNSLLIYIIATERTLHEPMYLFLSMLATADIVLSTTTVPKTLSIFWFNAREISLGGCITQLFFIHSTY
VIESGFLLVMAFDRYIAICYPLRYSMILTNLVTGNIGLAVVLRSFITIFPIIFLLTRLTFCQNNILPHTSCEHIGLAKYACADIRVNIWYGVFVLLTTIVLDIILIATSY
GLILQAVFRIPSREARHKALNTCGSHVCVIALFYVPGIFTFLTQRFGHHIPPHVHILLANVCALAPPMLNPIIYGAKTKQIRDRLVYVFFPRQK*
591 >lcl|XP_001374934.2|Plus118552920..18553870 NW_001581971 olfactory receptor 8K1-like LOC100023370 __SEG__ Chr5 {Monodelphis domestica} MEGGNETSLTKITEFIFMGVTDDPELQVPLFLVFLLIYTVTVVANFGMVILTKIDSRLQTPMYFFLRHLALIDLGYSTAIGPKMLVNFVVEKNIISYTGCAIQLFVFVTL
IISELFVLSAMAYDRYVAICKPLLYTVIMSDKVCWILVAIPYIYSMFVSLTIAIKIFNSYFCGSNVIRHFYCDNLPLLSMICSNTSDIELIILSLSALNLFSSLLVVLIS
YVFILVAILKMNSAEGRRKAFSTCGSHLTVLVVFYGTLTFMYLQPKSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNTEVKAALQRTLKNRQKCFI*
592 >lcl|XP_001374943.2|Plus1complement(1084804..1085745) NW_001581878 olfactory receptor 12D2-like LOC100023386 __SEG__ Chr2 {Monodelphis domestica} MTNYTSMNEFLLLGITDCQELEPFLFAVFLTIYILILIGNGAILAIVISEPRLHSPMYFFLGNLSCLDICYSTVTLPKVLDDLFSNQKTISFMGCIIQLHFFHFLGSTEA
ILMDVMAFDRFVAICNPLRYTILMNHQVCLCLAATSWITGFSYALLHSIMTSRLTFCGSNHIHHFFCDIKPLLELACGNTELNQWMVETVTGTIAMGSFFFILLSYFYII
SFLLFKSRSCSMLQKALSTCASHFMVVILLYVPVVFTYIRPSSGSSMNQDRIVAIMYSVVTPVLNPLIYTLRNKDVKGALNKAMRKKLCSKQF*
593 >lcl|XP_001374953.2|Plus118566964..18567938 NW_001581971 olfactory receptor 8K1-like LOC100023396 __SEG__ Chr5 {Monodelphis domestica} MEEIKFNETTGSQATEFILMGITNRPELQGPLFVVFFFNYMAIALGNLGLIILTTFDSHLQTPMYYFIRHLAFVDLGYSTAVGPKMLVSFIEKKNIISYYGCAIQLFFIV
IFLTSEFFNLSAMAVDRYVAICKPLLYMVIMSDRVCWISVVISYVYSIILALLVTIKIFQSSFCKSNVLRYFYCDSLLLVSIICSDTSEIELIIMTFAALNMVSSLFIIL
VSYMLILVAILRMNSSEGRQKAFSTCGSHLTVVVVFYGTLLFMYLQPHSSHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKDALKRLIKKLMQTLSFMTNVK*
594 >lcl|XP_001374965.2|Plus1complement(1123318..1124271) NW_001581878 olfactory receptor 11A1-like LOC100023412 __SEG__ Chr2 {Monodelphis domestica} MEITFTGNQSTITEFILLGFSELPDLHLLFFIFSTIIYITIILGNMLIIVAVVSSSGLHTPMYFFLVNLSFLEILYTSTVVPKMLAGFLRKKEAISLAGCLLQFFIFGSL
ATSECFLLAIMAYDRYLAICYPLHYTLLMGSKQCVCLVVTAWLTGFVVDGLVVVLMAQLKFCGSNHINHFYCDFMPIVGLACSDPQVAQATTFILSVICLTIPFGLILIS
YARILMAVLKVPTGASRKKAFSTCSSHLAVVSTFYGTLMVMYIAPSAIHSQLLSKVFALLYTVVTPIFNPVIYTLRNKEVHQALKKLLCNKQQGNSA*
595 >lcl|XP_001374969.1|Plus12436827..2437777 NW_001581929 olfactory receptor 52D1-like LOC100023416 __SEG__ Chr4 {Monodelphis domestica} MLTESMPNDTAFHPSTFILLGIPGMQDQHIWISIPFCSMYIFALVGNGTILFIIITDKTLHEPMYLFLCLLSVTDLVLCSTTLPKMLAIFWLDAHTISFHGCLTQMFFVH
AVFATESAILLAMAFDRYVAICRPLHYTSILNASVIGRIGAACVARGLLFVFPFIILIKRLPFCGRHVLAHTYCEHMGIAKLACTSIKPNTIYGLTVALSVTGMDVVLIA
ASYVLILRAVLSLPSQDAQLRAFSTCGAHVCVILVFYIPAFFSFFTHRFGRHVPPQAHIILANLYLLVPPVLNPLVYGINTKQIRTRILGLDLRRR*
596 >lcl|XP_001374975.2|Plus118584891..18585838 NW_001581971 olfactory receptor 8K1-like LOC100023423 __SEG__ Chr5 {Monodelphis domestica} MEEMIKMNETTKSQVTEFILMSITNRPELQHPLFAVFFLNYMATALGNLGLIILTSVDSHLQTPMYFFLRHLALVDLGYSTAIGPKMLVSFIEEKNIISYNGCAVQLAFF
VIFINSELFILSAMAYDRYVAICKPLLYTIIMSDRACWILVASSYLYSIMVDLVMTINIFKSSFCKSNVLRHFYCDSLSLLSIMCSDTSEIELIIMTFGVLNLIPSLLII
LFSYLLILVAILRMNSPEGRHKAFSTCGSHLTVVIVFYGTLFFMYLQPQSNHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVTGALKRLFKKLI*
597 >lcl|XP_001374987.2|Plus11144325..1145281 NW_001581878 olfactory receptor 6Q1-like LOC100023445 __SEG__ Chr2 {Monodelphis domestica} MEKANHTLVNEFVFLKFSNSPQIQMLFFILFLLIYLLSLAANTLILLLVVLDERLHTPMYFFIGNLSLVEIWYTTVTVPKMLANFISTRGVISVPSCIAQYYFFFSLAAT
ELFILTTMAFDRYVAICRPLHYTLLLSPKTCKMLAWICWSLGFLCPMFPSFLLTQISFCTPNQINHFFCDADQIFRLSCTDTYAIQAVGYAFSTVIILGALLFTLLSYAQ
ILATILAMASATARGKAFSTCTAHLSVVTIYFGTLIFMYVRPAVKYESSINKVVAIFYSVITPLLNPLIYTLRNKDVKDALRIIAAQIQGHHPISLET*
598 >lcl|XP_001374991.2|Plus12452129..2453106 NW_001581929 olfactory receptor 52N4-like LOC100023449 __SEG__ Chr4 {Monodelphis domestica} MTTFNFTHEKPSYFILKGIPGLEDTHFWISIPFSSMYFITVLGNFVILFIITTERTLHKPMFLLLCMLALTDLGMSTTTIPKALCIFWFGQREISFEGCLIQLFFIHSIS
VMQSAVLMTMALDRYVAICEPLRYATILSNGRIGLIALASLVRAVAFILPMPVLLQRMPFCTSRVIPTTYCEHMAVVKMVCADTTVNRIYGLVVALVVIGLDFSAIGSSY
VFIIRAVMRLSSKEAHHKAVNTCTTHICVMLTSYTPPLFSFLAHRFGRGIPPHVHTILGNLYFLVPPMLNPIIYGVKTKEFRDKVTKYGCWKKEPVTKPPTQKPV*
599 >lcl|XP_001375019.1|Plus112219035..12220750 NW_001581875 frizzled-2 FZD2 __SEG__ Chr2 {Monodelphis domestica} MRPPSALPRLLLPLLLLPAAGRAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPC
RSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGGPALLTTAPPGLQPGGGGTPGGPGGGGGGGAAGGGSPRYATLEHPFHCPRVLKVPSYLNYK
FLGERDCAAPCEPARTDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSDDGYRTVVQGTKK
EGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAG
FVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPLQYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKT
LHSWRKFYTRLTNSRHGETTV*
600 >lcl|XP_001375023.1|Plus1complement(2475348..2476319) NW_001581929 putative olfactory receptor 52P1-like LOC100023494 __SEG__ Chr4 {Monodelphis domestica} MLIFNHSGASTFTLLGVPGLEAQHLWLSIPFSSIFVAILIGNGGILFLVATEPSLQTPMYSLLAMLMVADLVSTLGIIPRQLCIFWFDAHDIGTKGCLVQMFFIHCASVV
RSALLVAMAFDRYVAVCEPLRYNTILNWTMVGQLALLALAKGVVLVLPVPFLLQRLTFCRTVIPHTYCDHMAVVKMACGHTKPNRVYGLFVILLVVGLDLLLIGVSYALI
LHAVLRLSSRDAILKTLNTCSAHFFLILISYVPGLFSLITHRMGHIIPPHAHILLANFYLLVPSLFNPIIYGIKMKEIRNKISKCLCKKDTQAISSKHKYVSA*
601 >lcl|XP_001375039.2|Plus12497811..2498776 NW_001581929 putative olfactory receptor 52P1-like LOC100023514 __SEG__ Chr4 {Monodelphis domestica} MISSNHTIQEPLVFFLLGIPGLESIHQWLSIPVCCLGVATVVGNVTILVVVATEPALHKPVYFFLCMLSTIDLAASITTLPKLLAILWFGAGHIAAAACLAQMFFIHAFC
MMESTVLLAMAFDRYVAICDPLRYTTILTDTVIARIALAAVLRGSLLMVACPFLIGRLAFCRSHVIPHTYCEHMAVVKLACGNTMPNRVYGLTAALLVIGVDLLCIGLSY
TLIARAVLRLSSREARSKALGTCGSHICVILISYTPALFSFFTHRFGRHVPLHIHILLANVYLLFPPALNPIVYGVKTKEIRDRVLRVFLRDQSSGNKGLG*
602 >lcl|XP_001375057.2|Plus118709402..18710349 NW_001581971 olfactory receptor 8K1-like LOC100023543 __SEG__ Chr5 {Monodelphis domestica} MEEIIKLNETTGSQVTEFILMGITKSPALQGPLFVLFLLNYIATALGNLGLIILTTIDSHLQTPMYFFLRHLAFVDLGYSTAIGPKMLVSFTEEKNIISSNGCAIQLVLF
GIFITNDFFILSAMAYDRYVAICKPLLYIVIMSDRVCWISMAFSYLYSIMVNLLITIKIFKSSFCKSNVLRHFFCDGPPLLSIICSDTSEIELIIFTFAAFDLVFSLLII
LVSYMLILVAIFRMNSPEGRHKAFSTCGSHLTVVVVFYGTLLFMYLQPPSKHSFDTDKMASVFYTLVIPTLNPLIYSLRNKEVKGALRRLFKKLK*
603 >lcl|XP_001375070.1|Plus1complement(2513832..2514797) NW_001581929 olfactory receptor 52N4-like LOC100023562 __SEG__ Chr4 {Monodelphis domestica} MQRTNATTLTPVSFILNGVPGLEDMHIWISLPFCSMYIVAMVGNCGLLYLISYEETLHKPMYFFLAMLSLTDVAMSTSTLPNTLGIFWFNLKEIDFNACLTQMFFIHTFT
GMASGVLMLMALDRYVAICYPLRYATILTNPIIANAGFITFLRGVILVIPFAFLTKRLPYCRGNVIPHTYCDHMSVAKISCGNVKINAVYGLMVALLIGGFDILCITVSY
TMILRAVVKLSSADARQKAFGTCSAHICAIVFSYTPAFFSFFTHRFGGHRIPHSLHIIMANIYPLLAPALNPIVYGVKIKQIRDCIIRLLLRSNDIKSRVI*
604 >lcl|XP_001375086.2|Plus1complement(2524690..2525655) NW_001581929 olfactory receptor 52N4-like LOC100023588 __SEG__ Chr4 {Monodelphis domestica} MQRTNATTLTPVSFILNGVPGLEDMHIWISLPFCSMYIVAMVGNCGLLYLIRYEDSLHKPMYFFLAMLSFTDIIMCSSTLPNTLGIFWFNLKEIDFNACLTQMFFIHTFT
GMESGVLMLMALDRYVAICYPLRYATILTNPIIANAGFITFLRGVILVIPFAFLTKRLPYCRGNVIPHTYCDHMSVAKVSCGNVKINAVYGLMVALLIGGFDILCITVSY
TMILRAVVKLSSADARQKAFGTCTAHICAIVFSYTPAFFSFFTHRFGGHRIPHSLHIIMANIYLLLPPTMNPIVYGVKTKQIRDCVIRFFVASKDTKSHNI*
605 >lcl|XP_001375172.2|Plus118820602..18821534 NW_001581971 olfactory receptor 5M3-like LOC100023702 __SEG__ Chr5 {Monodelphis domestica} MLNFTDVTEFILLGLTNRWELQVLFFIVFLIVYIITLIGNIGMIILIRISPQLSSPMYFFLSHLSFADVWFSSNVTPKMLENLLSETKTISYAGCLVQCFFFIFLVHVEV
FILAVMAFDRYMAIGNPLLYGSKMSRNVCMGLISFPYLYGFFISLISTLWTYGLYFCGNIEINHFYCADPPLIKMACAGTHIKEYTMHTLAGLNFSYSLSVIFVSYIFIL
IAIIRMRSAEGRRKAFSTCGSHLTAVIIFYGTLFFMYLRTPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAIGKAISKICQTT*
606 >lcl|XP_001375185.2|Plus118834570..18835502 NW_001581971 olfactory receptor 5M3-like LOC100023723 __SEG__ Chr5 {Monodelphis domestica} MLNFTDVTEFILLGLTSHRELQVVFFVIFLMVYIITIFGNIGMIILIKVSPQLSSPMYFFLSHLSFVDVWFSTNVTPKMLENLISETKTISYASCLVQCFFFIALVHVEI
FILAVMAFDRYMAIGNPLLYGSKMSRTVCIRLISFPYTYGFLTSLAATLWTYGLYFCGNIEINHFYCADPPLIKMACGGTYVKEYTMIILAGINFTYSLSVIIISYLFIL
IAILRMRSAEGRRKAFSTCGSHLTAVVIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMIRLISKTCSAK*
607 >lcl|XP_001375220.1|Plus1complement(1173391..1175112) NW_001581885 3-phosphoinositide-dependent protein kinase 1-like LOC100023778 __SEG__ Chr2 {Monodelphis domestica} MQLCSQSRLTWSFSSLKIANAKLALLLQEWRQWLRRIMASHWGLPGAGAMLEASASPCASSEPSKQPDSRTMPAGTGTNPIGAKPGSPRQAQQPSQLWEMRPEDFALGRI
LGTGSFATVVLARELATSRDYALKILEKRHVIKEKVVRYVASEREALARLDHPFFVKLYFTFQDQEKLYFGLSYARNGDLLRFLEKVGPLAEPLVCFYSAELVCALEYLH
GLDIIHRDLKPENILLTDDMHLQITDFGSAKILAQAGGGGDGGGKPARMNSFVGTAEYVSPELLLDKGTCKSSDLWALGCIIYYLVAQEPPFQAQSEYFIFQKIMRLTYA
FPKEFFPKARDLVEKLLVLDSAHRLGCEDMGGYRALKAHPFFETVTWDDLHLQTPPLARALLEDKNYFGEVGTRQSRSLPLSWAAVEPAFPQPSNNVERYIHCLDANSLE
LDLNFSGKERRLLLEKQAWGNPWHRFVGNRLILKMGRVDLRKGLFASAHSCQLLLTEGPCLYLVDPVNKFLNEEIFWSPQLPLEVKSVKTFFVHTPDRIYHLMDPSGNAP
RWCQKIRAAGHMQELASLEQAPV*
608 >lcl|XP_001375265.1|Plus137737924..37742096 NW_001581989 insulin receptor substrate 2-like LOC100023831 __SEG__ Chr7 {Monodelphis domestica} MASPPLNGLLTPANSSNGGGGGGGGGTNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGSGGEEQGGGGAGGQPPLPARLEYYENEKKWKNKSGAPKRVIALDSCL
NINKRADAKHKYLIALYTKDEYFAVAAENEQEQEGWYRALTDLLNEGKAAYDSSSLYPHCLSGTSSASASSCSASLPGSGGSGSFGAAAEDLHYGLITPASAAYREVWQV
NLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEVPSVTLQLMNIRRCGHSDSFFFIEVGRSASTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFRPRSKSQSSG
SSSTHPISVPGTRRHHHHHLVNLPPSQTGLLRRSRTDSLAATPPTTGTPISTQASGAGKCNSCRVRTASEGDGSSSGGAGGVGCRPVSVAGSPMSPGPVRTPLSRSHTLS
SSCSASMRPNKMMLAPAGGPLQHSRSMSMPVSHSPPSATSPGSLSSSSGHGSASYSLPQGQHPHPHHLHHHQGQRPSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCS
NRSNTPESIAETPPARDGSGTELYGYMTMERPLSLCGRTYRRVSGEGALDLDKGHRKRTYSLTTPARQRAVPQVSSASLMKYTLMRASFAGSSSRLYPASSPKVTYNPYP
EDYGDIEIGSHRSSSSNLGADDGYMPMTPGVAPLAGGSIGSCKSDDYMPMSPTSVSAPKQILQPRMAAASLATGAASQAASSATSGRGSPMNGSSYKTSSPAESSPEDSG
YMRMWCGSKLSVESSEGKLLPNGDYLNMSPSDAGASLTPPDFFYDSVPLPGGGEPPKGVPGCCYSSLPRSYKTPCPRNGDSDQYVFMNSPVGRRIVEEEQEQPSLQPLPN
TTTPCTQPTRPFVSNGGSHSQPHHLVPSAVRQSGSSSGNSNRPESFLIQRCRAVRPTRLSLEGLRTLPSMHEYPLPPEPKSPGEYINIDFSESGAHLSPPPPPLLTSAAS
SSSLLSASSPASSMGSGTPGTSGDSRRRSPLSDYMNLGFGSPKSPKSGTEGGGSVGSLDALMSPEASSPCPPLPTPPASSTSSSQQQQLPPPPPGELYRLPPASSTCHPT
PVSASSPSSPPETEDSGDYTEMAFGIAATPPQPIAAPPKPESARVTSPTSGVKRLSLMEQVSGVEAFLLASPPPDPHRGAKVIRADPQGGRRRHSSETFSSTTTVTPVSP
SFAHNPKRHNSASVENVSLRKSGEGPSGNGGESLGGGEEEPSTSPHPRQPSLPLPPQSQQLRWTQNQHGALVGCPGSSGSPMCRETSAGFQNGLNYIAIDVRDEAGLLLQ
QQQQSGDKNSWALTRGLSGLINGGSGSSTGGCVGPGSGPLPTTNTYASIDFMTHHLKEATAVKGEAIFAL*
609 >lcl|XP_001375278.2|Plus12769368..2770333 NW_001581929 olfactory receptor 52N1-like LOC100023848 __SEG__ Chr4 {Monodelphis domestica} MSVPNTSSLTPSSFILNGIPGLEAAHGWISLPFCTMYVIAITGNFGLMYLIYSEDTLHRPMYIFLALLSFTDVLMCTSTLPNTLFIFWFNLKEIDFNACLVQMFFVHTFT
GMESGMLMLMALDRYVAICFPLRYGTILTNPIIAKAGLLTFLRGVMLVIPFAFLTKRLPYCRGNLIPHTYCDHMSVAKVSCGNIKINAVYGLMVALLIGGFDILCITISY
TMILKAVVSLKSADARQKAFGTCTAHLCAIVITYVPAFFTFFTHRFGGHTIPPHIHIIMANLYLLLPPTMNPIVYGVKTKQIRNCVIRFFFQKKDASSQSI*
610 >lcl|XP_001375302.2|Plus12778645..2779592 NW_001581929 olfactory receptor 52N5-like LOC100023877 __SEG__ Chr4 {Monodelphis domestica} MLVFNNSYVAPDSFILNGIPGLEAAHIWISLPLCAMYAISLVGNLGLVYLIQYEESLHRPMYFFLAMLSLTDLLTCTTTLPNALSIFWFNLKEIKFDACLVQMFFVHGFT
GVESGVLMLMALDRYVAICYPLRYATILTNPIIAKAGLATFLRGMILMIPFPFLVKRLPFCQSNIISHTYCDHMSVVKLSCASIKVNVIYGLMVALLIGVFDICCISVSY
TMILRAVVSLASTDARQKAFSTCTAHICAIIITYVPAFFTFFTHRFGGHTIPPSLHIIVANLYLLLPPTLNPIVYGVKTKQIRESVIRFFHCEER*
611 >lcl|XP_001375306.2|Plus118967221..18968180 NW_001581971 olfactory receptor 1038-like LOC100023882 __SEG__ Chr5 {Monodelphis domestica} MAKGNHSEVTEFILLGLTTRPELQVVLLILFLIIYSVSVVGNFSLILLIQVSAHLHTPMYFFLSHLAFVDFCLTSAITPNMLVNFVQKINVISFHACAIQVFCFISLVNM
EMFLLAVMAYDRYVAIGNPLLYTVAMSGKLCWQLVTVPYIYCFSMALFQTIITFQFSYCASNVINHFYCDDIPLLVLSCSDIHVKEILIFIFAGFDMMCSLLIVIISYVF
IIAAILRIRSTEGKLKAFSTCSSHMVAVTIFYGTLIFMYLQPHSKQSLDTDKMTSVFYTIVIPMLNPLIYSLRNKEVKEAVTKILENSWSVIHFRLLQK*
612 >lcl|XP_001375323.2|Plus118985352..18986311 NW_001581971 olfactory receptor 1038-like LOC100023908 __SEG__ Chr5 {Monodelphis domestica} MARGNHSEVTEFILLGLTTHPELKVVLFIIFLVIYSVSAVGNLGLILLIQVSSHLHTPMYFFLSHLAFVDFCLTSAITPNMLVNFVQEINVISFHACVIQVYCFITFVNM
EMFLLAVMAYDRYVAIGNPLLYTVAMSGKLCWQLVTVPYVYCFSGALFHTIYTFQFSYCASNVINHFYCDDIPLLLLSCSDTHVKEMLVFVFAGLDMICSLLIVIISYVF
IIAAILRIRSTEGRLKAFSTCGSHMVAVTIFYGTLIFMYLQPQSNQSMDTNKMTSLFYTTLIPMLNPLIYSLRNKEVKEAVRKILGNTWSVVHFKLLHK*
613 >lcl|XP_001375337.2|Plus12808985..2809941 NW_001581929 olfactory receptor 52N2-like LOC100023923 __SEG__ Chr4 {Monodelphis domestica} MYNSNSSSLTPIFFILNGVPGLEEAHTWISFPFCSMYLIAVLGNSGLLYLIHHEESLHRPMYYFLALLSFTDVALCTTTVPNMLCIFWFNLKEITFNACLVQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYTTILTNSVIAKAGFITFLRGVMLIIPFTLLSKRLPYCHGNIIPHTYCDHMSVAKVSCGNVKVNAIYGLMVALLIGVFDICCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPAFFTFFTHRFGGNTIPHHIHIIVANLYLLLPPTMNPIVYGVKTKQIREGVIKILFGEKSVLA*
614 >lcl|XP_001375355.2|Plus1complement(2820177..2821112) NW_001581929 olfactory receptor 52E4-like LOC100023950 __SEG__ Chr4 {Monodelphis domestica} MLLSNDTQFHPISFLLLGIPGLEEMHIWIGFPFCSVYLIALLGNLTILFVIQTERSLHQPMFYFLAMLSTIDLGLSTSTIPKMLGIFWLNQREVSFGSCVAQMFFIHMFT
AMETVVLVAMAFDRYVAICHPLRYSMILTNRTIVITMTILFLINFILVFPMVFLILRLPFCGHHIIPHTYCEHMGIARLSCANIKINMIFGLILIAMVFGDVILIAISYL
KILHAVFLLPSREAQLKALNTCGSHICVILAFFIPAFFSFLTHRFGHKVPGYIHILLANLYVVVPPALNPVIYGIRTKQIRELVLRVFKKK*
615 >lcl|XP_001375364.1|Plus1complement(33892066..33893043) NW_001581837 b1 bradykinin receptor-like LOC100023962 __SEG__ Chr1 {Monodelphis domestica} MNTFQNNTSYCVDRKELWDMLYRVLPTSIIVICCLGLLGNIFALFVFLLSRRRLTVAEIYLTNLSASDLVFVMGLPFWAENIREQFNWPFSHVLCYVINGATKANLFISI
FLVVAISRDRYMALVHTMSSQMQRSQRQAQIICAFIWFLGGLLSIPTFLFRSVETVPNLNISSCILQFPHEIWLSIKVIKMSMVGFILPLVAIIFFSSHMIISLRSRTNT
NLKRTGKINNTKATSLILTIVTVFIICWTPYHCFAVLEYLFWLKAVQGCFWEEFIDLGLICSTFFAFLNSCLNPVIYFFVGKLFRARVWEVYKQCITRCSTLMYP*
616 >lcl|XP_001375373.1|Plus160794721..60795335 NW_001581900 protein phosphatase inhibitor 2-like LOC100023972 __SEG__ Chr3 {Monodelphis domestica} MAASEASHQSIKGILKNKSTAQGSVILPRPPSSSTSSATVLRRPKPSSSRISDEDFRKKCQKWDEMNILATYHPAHKDYGLMKIDEPSTPYHSMVGENDEDALSDSETNE
TLTPEVLARKLSAAEGSDTKFLVQDETSEEEDLTPEEQEKRRQFEIKRKLHYNEGLNINLARMLISKELQGYPEEEDDDDEGKIRPGRSSQFQS*
617 >lcl|XP_001375376.2|Plus12838441..2839379 NW_001581929 olfactory receptor 52E4-like LOC100023975 __SEG__ Chr4 {Monodelphis domestica} MSSLNNTEFHPQNFLLLGIPGLEELHIWIGFPFCAVYVIAFVGNLSILFVINSEKSLHQPMFYFLAMLATVDLGLSTATIPKMMGIFWFNLTEISFGGCLTQMFFIHIFT
GMESIVLVAMAFDRYVAICHPLRYSMILTNKAIVTISGVSILRNFSLVTPMVFLVLRLPYCGHHVIRHTYCEHMGIARLACSSININIIYGLFIICIIFLDMTLIAISYI
QILQAVFRLPSQEARFKALNTCGSHICVILAFFTPALFSFLTHRFGHNIPHYIHILLANLYVVVPPALNPVIYGVRTKQIRECLIQIFTRKD*
618 >lcl|XP_001375383.2|Plus1125512..126453 NW_001582010 olfactory receptor 8S1-like LOC100023985 __SEG__ Chr8 {Monodelphis domestica} MMPDNLTTDPEFILLPFPSSLHIHYILGFLFLLIYFLTLAGNLLIMAIIKMDSHLHTPMYFFLVNLSFFDLFYSSVMVPKLIQILLARRKTIFFSGCMIQIGLVFFIASS
EALLLSAMAYDRYSAICNPLVYVTVMNKQFCAFLACGSCLLGVINSLLNTLPLLRLHFCGPFLIHHYSCEMPELLPLSCTDLFLNKMILFTTLVIFGFGCFFPIMFSYTR
IISAILKISSASGRSKAFSTCSSHVIVVTLFFVTGVGRYLSPATGSILEQVISLQYSTVTPLLNPIIYSLKNVEVRIAIKKIWEKKSILSHSY*
619 >lcl|XP_001375387.1|Plus1complement(33930359..33931471) NW_001581837 b2 bradykinin receptor-like LOC100023990 __SEG__ Chr1 {Monodelphis domestica} MINGTQEDLPLGINESLFNETKNSSCSPDEFWDSFNTIQTPFLWIIFVMITVENLFVLSVFCLHKSSCTVPEIYLGNLAAADLILGVCLPFWAINIASNYDWSFGLVLCK
VVNSTMCMNLYSSIFFLMLVSIDRYLALVKTMSMGRMRGTCYAKFYSFIIWLFAIIMSCPMLIFRSLTNYDEEGHNVTICFLNYPSSKWAVFNNVLLNVVGFVLPLCVIS
FCTVKIIHVLQNNEMQKFKAIQREKKATILVQVVLLFFVICWLPFQVSTLMDTFFRLNFISDCQTKTTLDVFTQIGTYVGCSNSFLNPLVYVIVGKRFRKKSKEVYKRWF
KIARCQSDSIQTENSLSTLKTSITVDRQINKIDRHLEGTE*
620 >lcl|XP_001375396.2|Plus1complement(2867146..2868093) NW_001581929 olfactory receptor 52E4-like LOC100024002 __SEG__ Chr4 {Monodelphis domestica} MSFLNNTLSHPSSFLLLGIPGLEAMHIWIGFPFCAMYLVALLGNITILFVIKTERSLHQAMFYLLATLAVIDLGLSTATIPKMLGIFWLHLREISFEGCVTQMFFIHMFT
GMETFMLVAMAFDRYVAICYPLRYSTILTNNIIGIIAGMAVMKNFILIVPLTFLIFRLSFCEHHIIPHTYCEHMGIARLACVNIRLNVIFGLFLVCMILLDVFLIAVSYV
KILQAVFRLPSREARLKALNTCSSHVGVILAFFTPALFSFMTHRFGQNVPHYVHILLANLYVIIPPALNPIIYGVRTKQIRERVVAIFFIRKDGD*
621 >lcl|XP_001375405.1|Plus123946413..23947798 NW_001581861 kelch repeat and BTB domain-containing protein 13 KBTBD13 __SEG__ Chr1 {Monodelphis domestica} MAAPTPQPSLPGCIRVWVGGRLFVADKALLVENSDFFRGLFRSGMQEASRGEIHLGVLSAGGFQTTLEVLGGQRPALGGEEELFEAVECAAFLQAPPLAHYLSHSVTSDN
CVVLCEAASAFGLWEVLQGAALFIRDGPPELTNELSPEVRSYVEALRPSSFVAVGTHTPTPQYLEDATRTLCYLDEKDDVWRTLSSLPVEASTLLAGVTTLENKLYIVGG
VRGANKEVVEPGFCYDADRGTWHEFPSPHQARYDVALVGYEGSLYAIGGEFQRVPLRSVERYDFASGCWTFIADIPQPAAGVPCAQALGRLFICLWQPADTTAVYEYKPG
ADSWLPVASLRRPQSYGHCMVAHRDSLYVVRNGPSDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVRGDTVYTVNRMTTVLYSVGDGSWRLLREKAGFPRPGSL
QTFLLRLPDVALAPAVSSPEP*
622 >lcl|XP_001375423.2|Plus1complement(2931582..2932517) NW_001581929 olfactory receptor 52E8-like LOC100024049 __SEG__ Chr4 {Monodelphis domestica} MSRNDTEFHPAFFLLLGIPGLEAVHLWIGFPFGFVYLIALMGNITILFVIQKDPSLHQPMFYFLAILATIDLGLSTTTIPRMMGIFWFNLKEIAFESCLTQMFFIHFFTV
MESTVLVAMAFDRYVAICNPLRYNTILTNKIIVIIAEFAVLRSMCQVTPAVFLLLRLPFCGKHVIAHTYCEHMGIARVSCGNIRVNIIFGLGDISILFLDVVLIAVSYMR
ILHVVFHFPSQDARLKALSTCGSHVCVILAFFTPAFFSFLTHRFGHNIPGYIHILLANLYVVVPPALNHIIYGVRTKQIRDRVMNVFLKNK*
623 >lcl|XP_001375425.2|Plus1complement(19112615..19113574) NW_001581971 olfactory receptor 1044-like LOC100024051 __SEG__ Chr5 {Monodelphis domestica} MAEINFTQVTEFILLGITDKLELKMPLFVVFLSIYVFTVVGNLGLITIIRMDSRLKTPMYFFLSHLAFVDFCYSSSIAPKMLGNFLYEKNTISFNACAAQLGCFLAFMTA
ECLLLASMAYDRYVAICNPLLYMVLMSPKICIQLVAVPYSYSFLVALFHVILTFRLSYCGSNIINHFYCDDMPLLRLSCSDTHSKQMWIFACAGIMFISSLMIVFISYMY
IISAILKMQSADGRQKAFSTCGSHMVAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKRALSNSSHGLIVIKLTN*
624 >lcl|XP_001375437.1|Plus1complement(2940786..2941727) NW_001581929 olfactory receptor 52E8-like LOC100024076 __SEG__ Chr4 {Monodelphis domestica} MSLNDTEFHPAFFLLLGIPGLEAVHLWIGFPFGFVYLIALMGNITILFVIQKDPSLHQPMFYFLAILATIDLGLSTTTIPRMMGIFWFNLKEIAFEGCLTQMFFMHFFTV
MESIVLVAMAFDRYVAICNPLRYNTILTNKIIIIITEFAVLRSLCMCVPAVLLLLRLPFCGKHVIAHTYCENMGIARVSCGNIRVNSIFGLGNISILLLDVVLIAVSYMR
ILHVVFRFPSQYARLKALSTCGSHVCVILAFFTPAFFSFLTHRFGHNIPGYIHILLANLYVVVPPALNPVIYGVRTKQIRDKVMNVFLKKSDV*
625 >lcl|XP_001375440.2|Plus1complement(19126421..19127368) NW_001581971 olfactory receptor 1044-like LOC100024081 __SEG__ Chr5 {Monodelphis domestica} MAVINFTQVTEFILLGITEKQELKMPLFVVFFSIYVFTVVGNLGLITVIRMDSRLKTPMYFFLSHLAFVDFCYSSSITPKMLESFLYEENTISFNACATQLGCFIAFMDA
ECLLLASMAYDRYVAICNPLLYMVLMTPKICIQLVAIPYIYSFLVALYHVILTFRLSFCGSNIINHFYCDDMPLLRLSCSDTHSKQIWIFVCAGVMLIASFLVVFVSYMY
IISAILKMQSAEGRHKAFSTCGSHMVAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKILRNSNHGFRKT*
626 >lcl|XP_001375448.1|Plus17769506..7770576 NW_001581841 neuropeptides B/W receptor type 2-like LOC100024094 __SEG__ Chr1 {Monodelphis domestica} MWNMGQEPLAPSQVIAEDDQHQQTGDLGMRHEDNCSLYNMTGGDFYPDNSSQSNFTFPEQSLDFYILLPVMYSVICAVGLTGNTAVIYVILKAPKMKTVTNMFILNLAIA
DDLFTLVLPINIAEHLLRYWPFGELLCKIILAVDHYNIFSSIYFLTVMSVDRYLVVLATVQSRRLPYRTYHAARTTSICIWLWVTLIVLPFFIFASVYTNELQIKSCGLS
FPQPERFWFKASRIYTLVLGFAIPVSTICILYIGMLHKLRTMNLNSNARALNKAKRKVTIMVIIVLAVCLLCWMPFHLATIVALTTDLPQTSLVIGISYFITSLSYTNSC
LNPFLYAFLDDNFRKSFRKMLECRAT*
627 >lcl|XP_001375461.2|Plus1complement(19136401..19137360) NW_001581971 olfactory receptor 1044-like LOC100024108 __SEG__ Chr5 {Monodelphis domestica} MAAINFTRVTEFILLGITEKTELKMPLFVIFLFIYVFTVVGNLGLITVIRMDSRLKTPMYFFLSHLAFVDFCYSSSITPKMLGNFLYEKNIISFYACATQLGCFINFMNA
ECLLLASMAYDRYVAICNPLLYMVLMPPKVCIQLVAAPYIYSFVVALYHVILTFRLSFCGSNIINHFYCDDMPLLRLSCSDTHFKQIWIFACAGIMLIASFLVVFVSYMY
IISAILKIKSAEGRRKAFSTCGSHMVAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNTEVKDALKKALSNSNYVLILIQSKK*
628 >lcl|XP_001375474.2|Plus12997803..2998744 NW_001581929 olfactory receptor 52E5-like LOC100024127 __SEG__ Chr4 {Monodelphis domestica} MGPSNSTQFHPTSFLLLGIPRMEYIHIWIGFPFCTVYLIALVGNVSVLLVIKTERSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFNLREILFGACVTQMYVIHMCT
GLESVVLTVMAIDRFVAICKPLRYTMILTDKVVANLGIMIIVRSLVFATPFIFLILRLPFCGARIIPHTYCEHMGLARLACTSIRINIIYGLVAFSIGYIDLLVIGFSYI
QILRAVFRLPSHDARIKALSTCGSHVCVMLAFYTPALFSFMTHRFGHNIPGYIHILLANLYVVVPPALNPVIYGVRTKQIRERVLRILNPKGS*
629 >lcl|XP_001375475.2|Plus1complement(19153073..19154011) NW_001581971 olfactory receptor 1030-like LOC100024128 __SEG__ Chr5 {Monodelphis domestica} MSSRNYTQVTEFILLGLTSRPELRTAFFALFLMIYMITVVGNVGMIVLIKIDSRLHTPIYFFLSSLSFLDLCFSTNVTPKMLENFISEKKTISYAGCLVQCYIVIAVVLT
EHCMLAVMAYDRYMAICNPLLYSSKMSNAVCIRLVIIPYVYGFLLSVMETLRTYNLSFCGDNEINHFYCADPPLIKLACSDTYSKELSMYIVAGYSNVQSLLIILTSYMF
ILVAILRSHSAEGRRKAFSTCGSHLTVVTIFYSTLFCMHLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYGLRNKDVKEALTKAIGRKVLTK*
630 >lcl|XP_001375490.1|Plus11103205..1104035 NW_001581891 keratin-associated protein 10-8-like LOC100024146 __SEG__ Chr2 {Monodelphis domestica} MAHGSFTGPYMPSTSADSVCSSDVSHSSNICLPSSCPGGSSWQLDDCPESCCEPCGGCGPSCCPASCCPPASCLTLVCRPVCCMPASCQPCPAVCTPSCCQSTGCGASCC
QTCPCAPIQSCCCVPVCCKPSCCISLPVCCKPSCCVISACPAPSCCPVPSCCQPPCCVSLTCQPACSPATCCVPLSCKPTCCTTSSSSCCCGPSCCQPVCKPATCSVPLS
CKPTCCTTSSTSCCCGPSCCCAPSCCRPTSSVSLICRPTCCRPSCCSTSCGQKSCC*
631 >lcl|XP_001375495.2|Plus1complement(59198963..59200111) NW_001581968 neuropeptide Y receptor type 2-like LOC100024152 __SEG__ Chr5 {Monodelphis domestica} MGPTGAQTEENQTTEETEVEWYETVQTTPRGQLAPDPKPGLTDSTKLIEVQVVLILAYCTIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLT
YTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVVCTEKWPGEEKSMYGTIY
SLSSLLILYVLPLGIISFAYIQIWSKLKNHISPGVANDHYHQRRHKTTKMLVCVVVVFAVSWLPLHAFQLAIDIDNQVLDLREYKLIFTIFHIIAMCSTFANPFLYGWMN
SNYRKAFLSAFHCEQRLDSIHSEVSVTFKAKKDLEVKKNTCANDSFTEATNV*
632 >lcl|XP_001375498.2|Plus1239973..240902 NW_001582010 olfactory receptor 145-like LOC100024155 __SEG__ Chr8 {Monodelphis domestica} MSDNQTISIGFILLPFPSSLNVHYTLVFIFLLIYFLTLAGNLFIMVIIKMDSHLHTPMYFFLVNLSCCDIFYSSVMVPKLVQILLTKNKTISFSGCLAQIGLTFFIASSE
SFILSAMAYDRYSAICNPLFYMMVMSKRFCVFLTCGSCLLGIASSLLNTLPLLRLNFCGPHLIYHYSCEMPELLTLSCTDLFLNKIILFSTLVIVGFGCFFPIVFSYTRI
ISAILRISSASGKSKAFSTCSSHVIVVSLFFLTGVGRYLSPATGSILEQVISLQYSIVTPLLNPFIYSLKNVEVKIAIKKMWEKKSILY*
633 >lcl|XP_001375511.2|Plus1complement(19184629..19185567) NW_001581971 olfactory receptor 1030-like LOC100024173 __SEG__ Chr5 {Monodelphis domestica} MFRRNYTQVTEFILLGLTSRQDLHTLLFVLFLIIYMITVVGNVGMIVLIKIDSRLHTPMYFFLSSLSFLDLCFSTNVTPKMLENFLSEKKTISYSGCLVQCYIVIAVVLT
EHCMLAVMAYDRYMAICNPLLYSSKMSNAVCIRLVIIPYVYGFLLSVMETLRTYNLSFCGDNEINHFYCADPPLIKLACSDTYSKELSMYIVGGYSNVQSLSIIVTSYMF
ILVAILRSRSAEGRRKAFSTCGSHLTVVTIFYGTLLCMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYGLRNKDVKEALNKAIGRKVLTK*
634 >lcl|XP_001375525.2|Plus13051411..3052352 NW_001581929 olfactory receptor 52E5-like LOC100024194 __SEG__ Chr4 {Monodelphis domestica} MGPSNSTQFHPTSFLLLGIPGLEDIHIWIGFPFCTVYLIALIGNVTVLLVIKTERSLHQPMFYFLAMLAIIDLGLSTATIPKMLGIFWFNLREILFGACVTQMYAIHMCT
GLESVVLTVMAIDRFVAICKPLRYTMILTDKVVANLGIMIIMRSLVFVTPFIFLVLRLPFCGARIIPHTYCEHMGLARLACTSIRINIIYGLVAFSVGYIDLLVIGFSYI
QILRAVFRLPSHDARIKALSTCGSHVCVMLAFYTPALFSFMTHRFGHNIPGYIHILLANLYVVVPPALNPVIYGVRTKQIRERVLRILNPKGS*
635 >lcl|XP_001375569.2|Plus1complement(19222846..19223784) NW_001581971 olfactory receptor 5M8-like LOC100024252 __SEG__ Chr5 {Monodelphis domestica} MLSRNVTTNPQFILLGLTSRLELQVLFFVLFLTIYIITVVGNLGMMVLVRITPKLHTPMYFFLSHLSFADLCFSSNVSPKMLETFIVKKATISYSACLVQCYLFIALVHV
EIYILAVMAFDRYMAICNPLLYGSKMSPTVCASLISVPYVYGSLTGLMETMWTYSLSFCDLHEINHFYCADPPLIKLACSSTYNKELSMFVVAGFNFTFSLLIILISYVY
IFPAIFRLRSADSRRKAFSTCGSHLTAVTIFYAALFFMYLRPPSETSVEQGKMMAVFYTTVIPMLNPMIYSLRNKDVKEALSKGLFRKELSK*
636 >lcl|XP_001375574.1|Plus1complement(186470384..186472003) NW_001581841 suppressor of cytokine signaling 5-like LOC100032188 __SEG__ Chr1 {Monodelphis domestica} MDKVGKMWNNFKYRCQNLFNHEGGNNNENTVVNSNRCLSVKERNISIGDLAPQQQSSPLRENVALQLEISPSKNSSRRNQNCATDIPQIVEISIEKESDSCITTTGTRLA
RRDSYSRHAPWGGKKKHSCSTKTQSSLDTEKRFGRTRSGLQRRERRYGVSSVHDMESVSSRTVGSRSLRQRLQDTVGLCFPMRTYNKQAKPLFSNKRKIHLSELMLEKCP
FPAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTDMTGDGAVAPQGSCDSEEDAT
TLCLQARRQKQRQGSGDSHGHAHTGRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNF
SFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTVSLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPIKAK*
637 >lcl|XP_001375608.2|Plus1complement(19250039..19251040) NW_001581971 olfactory receptor 5M11-like LOC100024304 __SEG__ Chr5 {Monodelphis domestica} MFDSFLLSFQRPREMMSQNGSTKITEFILLGLTDRPELQHILFVVFLGIYIVTLLGNFGMIMLIKLEPRLHTPMYFFLTNLAFVDLCYSTNATPKMLANFLSEKKTISFA
ACFVQCYIFIALLLTEYYMLAAMAYDRYVAICSPLHYNVKMSRRVCICLATFPYVYGFSDGLLQSILTFRLSFCRSNVINHFYCADPPLIKLSCSDTYVKEHAMFISAGF
NLSNSLAIILVSYAFILAAILRIRSADGRRKAFSTCGSHMMAVTLFYGTLFCMYVRPPTDKSVEESKIIAVFYTFVSPVLNPLIYSLRNRDVKVALRNVLRRNVLKKMVS
NIS*
638 >lcl|XP_001375623.2|Plus1complement(19267797..19268819) NW_001581971 olfactory receptor 5M11-like LOC100024324 __SEG__ Chr5 {Monodelphis domestica} MILNNFSFVSNGVRRPQRPREMLNQNGSTRITEFILLGLTNRPDLQHILFVVFLGIYIVTLLGNFGMIMLIKLEPRLHTPMYFFLTNLAFVDLCYSTNATPKLLENFLSE
RKTISFAACFVQCYIFIALLLTEFYMLAAMAYDRYVAICSPLHYNVKMSRRVCICLATFPYIYGFSDGLLQSILTFHLSFCRSNVINHFYCADPPIIKLSCSDTYIKEYA
MLISAAFNLSNSLSIILISYAFILAAILRIHSAEGRWKAFSTCGSHMMAVTLFYGTLFCMYLRPPTDKNVEESKIIAVFYTFVSPVLNPLIYSLRNRDVKVALRNVLRKK
ALKKMVSSIS*
639 >lcl|XP_001375635.2|Plus13126860..3127807 NW_001581929 olfactory receptor 56A3-like LOC100024343 __SEG__ Chr4 {Monodelphis domestica} MILPSNSSSPTEVSEFLLNCFVRSPSWQRWLSLPLSLLFLLAMGANATLLITIRLEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLLIFWFDLRPISFPACFLQMYIMNC
FLAMESCTFLIMAYDRYVAICHPLRYPAIITDEFVAKAALFILARNIFFTVPIPILSARLNYCHSNVIENCICANLSVSKLSCNDVTVNRLYQFAGGWTLLGSDLILIFL
SYSFILRAVLRLKAKGAAAKALSTCGSHFILILFFSTILLVFVLTHVAKKMVSPDVPILLNVLHHVIPAALNPIVYGVRTQEIKQGIQKLLRKGL*
640 >lcl|XP_001375662.2|Plus1complement(19290238..19291176) NW_001581971 olfactory receptor 1030-like LOC100024378 __SEG__ Chr5 {Monodelphis domestica} MAKTNHTVVTEFILLGLTDRPELQPALFVIFLVIYLITVVGNVGMIALIRIDSKLHTPMYFFLSHLSFVDLCYSTNITPQMLVNFLSSRKTISFCGCLVQFHVFITLVIT
EYYMLTAMAYDRYVAICNPLLYSSKMSKSICLSLVTANYIYGFANGLIQTILMLRLTFCGPNEINHFYCSDPPLMVLACSDTYIKKTAMFVVAGFNLTCSLTIILISYIF
IFMTILHIHSTEGRRKAFSTCGSHLTVVTIFYGTLFCMHLRPPSEKAVEQGKIIAVFYIFVSPMLNPLIYSLRNKDVKDAVKRIIKNKLQTK*
641 >lcl|XP_001375676.2|Plus1complement(19308116..19309054) NW_001581971 olfactory receptor 1030-like LOC100024398 __SEG__ Chr5 {Monodelphis domestica} MSKTNQTMVTEFILLGLTDRPELQPALFVIFLVIYLITVVGNVGMIALIRSDSKLHTPMYFFLSHLSFVDLCYSTNVTPQMLVNFLSERKTITFAGCFIQFNFFIALVII
DYYMLSVMAYDRYVAICNPLLYSSKMSKNICISLVTAPYVYGFVNGLIQTILMLHLSFCGPNEINHFYCADPPLMVLACSDTYIKETAMFVGAGSNLICSLIIILISYMF
IFMAILRIRSTEGRRKAFSTCGSHLTAVTVFYGTLFCMYLNPPSETSIEQGKIVAVFYIFVSPMLNPMIYSLRNKDVKDAVKRIIKRKLQTK*
642 >lcl|XP_001375679.2|Plus132392..33330 NW_001582011 olfactory receptor 6C1-like LOC100024402 __SEG__ Chr8 {Monodelphis domestica} MKNHTQVTEFILLGLSDDPEIQIVIFFFLLLAYILSIAGNSTIIILTLFDSHLQTPMYFFLRNFSFIEISFTTVCIPRFLSTIITGDKTISYNCCMSQLFFVILFGVTEF
YLLAAMSYDRYVAICKPLHYTTIMSSRVCTLLVFCSWFISFVVIFPALIMMQELDYCAGNIVDHFTCDYSPLLQLSCTDPQLLEKIGFSWAVVTLMLTLILVVLSYSYII
QTILRIPSVSQRKKAFSTCSSHMIVTSISYGSCIFMYIKSSAKERVSLIKGVAVLNTSVVPMLNPFIYSLRNKQVKQAFMDMTRKIVFSNKK*
643 >lcl|XP_001375691.2|Plus1complement(19321493..19322431) NW_001581971 olfactory receptor 1030-like LOC100024421 __SEG__ Chr5 {Monodelphis domestica} MSKTNQTMVTEFILLGLTDRPELQPALFVIFLVIYFITVVGNVGMIVLIRIDSTLHTPMYFFLSHLSFVDLCYSTNVTPQMLVNFLSQRKNISFVGCFIQFNFFISLVIT
DYYMLTVMAYDRYMAICNPLLYSSKMSKNICISLVTAPYVYGFANGLIQTILMLRLSFCGPNEINHFYCADPPLMVLACSDTYIKETAMFVVAGSNLTCSLTIILISYMF
IFISILRMHSTEGRRKAFSTCGSHLTAVTVFYGTLFCMYLRPPSESSVEQGKIVAVFYIFVSPMLNPLIYSLRNKDVKNAVKKIIRSNLQVK*
644 >lcl|XP_001375705.2|Plus1complement(94933..95895) NW_001582011 olfactory receptor 10C1-like LOC100024443 __SEG__ Chr8 {Monodelphis domestica} MLSSEPMMRENQTLCTTFIFVAFSSLGELQPVLFVVFLAIYTFTVLGNLVIIFLIWVSPSLHTPMYFFLTNLSFLEMCYITSVVPQLLVHLLVEPKTMSVSRCAAQMYIF
TILGLTECCLLAAMAYDRFVAICYPLRYTLLMGPRVCLQLAVASWTIGMVVEIAQTTWIFTLPFCGTGKIQHFFCDIMPVVKLACVNTSHYEIVMFFLSVLFIMSPCLLI
LCSYARILIAILRMPSASGRYKAFSTCSSHLLVVSLFYGTALFTYLQPKAAHTPDTDKATALMYTVVTPALNPVIYTLRNKEVKGAFWRIARRHPLNQAA*
645 >lcl|XP_001375716.1|Plus1complement(3284396..3285352) NW_001581929 putative olfactory receptor 52P1-like LOC100024457 __SEG__ Chr4 {Monodelphis domestica} MVGNATIPNFSSFFLVGIPGLEVFHCWFSIPVCLLYAMTLMGNGLIVLVIKEESSLHQPMFFFLCMLAFNDVAISSATAPRMLGIFWVDAHLIGFDVCLTQLYLIHTFSI
IGSALLVAMAFDRYVAICHPLHYATILTTPLVIRLGVISVARGAILILPCLLLIKRLRYCTQNVLRHTYCEHMAVVKLACTDTYINQSYGIFVALSVILLDIGLISMSYV
KILQAVFRLSSKEARSKALGTCAAHICTILLYYIPALFSFLTHRIGKRVPPSIHIIFASIYLLVPPAVNPLVYGVKTKQIRDRVVILFLRKKDKVSKH*
646 >lcl|XP_001375722.2|Plus1complement(108641..109603) NW_001582011 olfactory receptor 10C1-like LOC100024463 __SEG__ Chr8 {Monodelphis domestica} MLSSEPMMRENQTLCTTFIFVAFSSLGELQPVLFVVFLAIYTFTVLGNLVIIFLIWVSPSLHTPMYFFLTNLSFLEMCYITSVVPQLLVHLLVEPKTMSVSRCAAQMYIF
TILGLTECCLLAAMAYDRFVAICYPLRYTLLMGPRVCLQLAVASWTIGMVVEIAQTTWIFTLPFCGTGKIQHFFCDIMPVVKLACVDTSQNEIVLFSVSVLFIMSPCLLI
LCSYARILIAILRMPSAAGRHKAFSTCSSHLLVVSLFYGTALFTYLQPKAAHTPDTDKATALMYTVVTPALNPVIYTLRNKEVKGAFWRIARRHPLNQAA*
647 >lcl|XP_001375731.2|Plus1complement(3298728..3299681) NW_001581929 olfactory receptor 52L1-like LOC100024476 __SEG__ Chr4 {Monodelphis domestica} MTSLGNSSWGLSTFSFFLVGIPGLEESQHWIALPLGSLYLLALVGNVTILFIIWSDTSLHQPMYLFLAMLATIDLILASATAPKTLAVLVAHSCEIWYPTCLTQMFFIHA
FSSMESGVLVAMALDRYVAICHPLHHTTILTIGVIGRIGLVVLVRGLLLLTPFPILLHRLIFCQSVVISHAYCEHMAVVKLACSDATVNRAYGLVVALLVVGFDVFAIGI
SYSLILSAVLRVPGRDARLKAFGTCGSHICVILVFYVPGMFSFLTHRFGHNVPHHVHVLLATLYLLVPPALNPIVYGVKTQQIRQRVLRVFYINVRT*
648 >lcl|XP_001375735.2|Plus1complement(19370684..19371631) NW_001581971 olfactory receptor 5M10-like LOC100024481 __SEG__ Chr5 {Monodelphis domestica} MPHQNHTKVTEFILRGLTEDPELQKILFVVFLVIYIITLVGNLGLIMLIHNCPRLHTPMYFFLSHLSFVDLCYSSNITPQMLVHFLSERKAISYAGCFMQCLAFITLLIT
EFYILTSMAIDRYVAISSPLQYSTKMNQNVCLCLVMFPYVYGFLNGLSQTLLTFHLSFCGPNEINHFYCADPPLILLSCSDPYVKKMAMLIVAGFTLLSSLLTILCSYVF
IFAAILRIRSAEGRKKAFSTCGSHLTSVILFYGTLFCMYLRPPSEQSVEESKTIAVFYTFVSPMLNPLIYSLRNKDVIEAMKKLFQGNMFIKMAG*
649 >lcl|XP_001375759.2|Plus1complement(19396990..19397946) NW_001581971 olfactory receptor 5M10-like LOC100024515 __SEG__ Chr5 {Monodelphis domestica} MSSPNHTRVSEFILLGLTEDPKLQKILFVVFLVIYIITLVGNLGMIILIHNSPQLHNPMYFFLSHLSFVDLCYSSNVTPQMLVHFLSERKVISYAGCFTQCLSFIALVIT
EFYILASMAIDRYVAISSPLQYSTKMNQNVCLCLVIVPYVYGFLNGLSQALLTFHLSFCGPNEINHFYCADPPLILLACSDAYVKKMAMFIVAGFTLSSSLFTILCSYVF
IFAAILRIRSAEGRQKAFSTCASHLTAVTLFYGTLFCMYLRPPSEQSVEESKTIAVFYTFVSPMLNPLIYSLRNKDVIGAMKKMFQRKLFTKMAECIT*
650 >lcl|XP_001375773.1|Plus1complement(3315284..3316234) NW_001581929 olfactory receptor 52K1-like LOC100024534 __SEG__ Chr4 {Monodelphis domestica} MMPLNDTSFPSMFFLAGIPGLASAHTWISLPFFSMFFMAVTGNCLLLFLIFIDHNLHQPMFFFLSMLSFVDLVLSLSTLPKMLTIFWFDATAISFHACLIQMFFIHAFSA
MESGVLVAMALDRYVAICNPLRYSSILTPVVIAQIGGLVVFRGIGLTISFPSLARRLPYCRSHVIAYTYCEHMAVVKLACGDTTVDNINAFIVALFLGVGDVAFIAYSYG
RILQTVLNFPSREARVKAGSTCTAHVVVILFFYMPGFLSVIMQRFGPSTASAAKVIFANLYLLFPPALNPIIYGVKTKQIRDRLLMILNPKQIDPT*
651 >lcl|XP_001375778.2|Plus1181919..182854 NW_001582011 olfactory receptor 6C76-like LOC100024543 __SEG__ Chr8 {Monodelphis domestica} MRNQTSVSEFILLGLTDDPELQVLIFLFLFLTYILSVAGNLTIITLTLLDSRLKTPMYFFLRNFSFLEISFTSVSIPRFLVSILTGDRTISYNFCAAQLFFFILLGTTEF
FLLAAMSYDRYVAICKPLHYSTIMSSKVCSQLVISSWLAGFLIIFPPVIMGLQLDYCDSNVIDHFTCDSSPMLMISCTDTKVLEVMSFCLATFTLIFTLALVILSYAYII
RTILKLPSAQQRKKAFSTCSSHMIVVSISYGSCIFMYAKPSAKEGVAMTKGVAVLNISVAPMLNPFIYTLRNQQVKQVFKDMVRKMFNSNK*
652 >lcl|XP_001375786.2|Plus1complement(3334365..3335324) NW_001581929 olfactory receptor 52A1-like LOC100024554 __SEG__ Chr4 {Monodelphis domestica} MKNSNVTFLNPLYFTLLGVPGLESVQHWIGIPFCIMILLALMGNCTILSVIWRDPSLHQPMYLLLAMLAINDLGIFPVLFPKTLAILWFDIKEIEFNVCLTQMFFVHVLA
GFETGILVAMALDRYVAICRPLRYTAILTPHVLLGIAVMVVVRAVLLISFCPILIKLRLTSFHSTVVAHSYCEHMAVVKLAAGDTRVNKFYGLAVVMTFCWCDICFISTS
YILIFRAVMRLPGKEARVKAANTCTAHITIIVLSYSLALFSFLAHRYGHRVAPYVHILLANIYLLVPPVVNPIVYGVKTKEIRIRVITMFSLQRQKSKS*
653 >lcl|XP_001375790.1|Plus1complement(61105977..61108334) NW_001581968 toll-like receptor 2-like LOC100024558 __SEG__ Chr5 {Monodelphis domestica} MRQIRWSVWILCTIINFSEEDAPKQTSLSCDPAGGVCDGHSRSLDTIPSDLTEAVRQLDLSFNKISHIRELDLRNCVNLEALLLQSNRIRSIDPDSFQFLRNLKHLDLSS
NSLSYLSPSWFNSLSSLRVLYLHKNPYQRLGQSPLFSHLPSLRVLKVGSYDRFSELQKQDFEGLRELEDLEIEAAYFQKYEPGSLKSIHKINHLALSIRKPNLLPDILVD
LASSLQYLEFRKTNLGEFNFSMPPNTPSPLIEKIILREVIVTDKSFIDILKMFSYASELLEIVLEDCILNGLGLWEEDFISEIHHEVKVETIIIRRLRIGNFFLFRDLSP
VYSLLQGIKRITLTSSKVFLVPCDLSKSLKSLEYFDLSDSLMSEGALENSACEGAWPSLHTLNLSQNKFESLKTMGELLLTVKNLTHLDISKNNLDSMPDSCQWPGKLKY
LNISSTKTYTVTSCIPQTLEILDISNNQLSDFNLNLPHLKELYLSKNKLKTLPDAAHFPHLVVMNISQNTLYTFSKAQLESFQTTEILAAGGNNFICSCEFLSFVHHEQT
LLVKVLTDWPGGYLCDAPFQVRGQRVQDVQLSFSECYRVELVAAICSSLFLLALLAGVLCYQFHGIWYMKMMWAWLQAKRKPRRNPDREICYDAFVSYSEGDSHWVENFM
VQELENFDPPFRLCLHKRDFVPGKWIIDNIIDSIDKSHKTLFVLSESFVKSEWCKYELDFSHFRLFDENNDTAILILLEPIEKKTIPQRFCKLRKIMNTKTYLEWPRDEG
LQEEFWFNLRAAIKS*
654 >lcl|XP_001375794.2|Plus1206847..207791 NW_001582011 olfactory receptor 6C76-like LOC100024563 __SEG__ Chr8 {Monodelphis domestica} MVAMRNHTTVTTFILLGLTDDPDLQIVSCFFLFLIYILSIGGNLTIILLTLLDPHLKAPMYYFLRNFSFLEISFTSVCIPRFLVSTMTMDKRISYNACVTQLFFAIFLGS
SEFYLLAAMSYDRYVAICKPLHYASIINSRVCTKLILSSWLAGLLTISPGLIMGLQLDFCDANVIDHFACDYSPILQLSCTDTQVIELCGFFLALLTLLVTLTMVLLSYA
NIIRTILRFPSREQKKKAFSTCSSHIIVVSITYGSCIFMYIKPSAKERVALNKGVAILTTSVAPLLNPFIYTLRNKQVKQAFKTITRKMFFSVK*
655 >lcl|XP_001375807.2|Plus119449520..19450452 NW_001581971 olfactory receptor 1019-like LOC100024582 __SEG__ Chr5 {Monodelphis domestica} MDRGNHSVVTEFIFMGITQDPQLQIIFFAVFLAVYLINVVGNVGMIILIVMDAQLHTPMYFFLCNLSLVDLGYSSAIAPRMLADFLTQHKIISFSSCATQFAFFVGFVDA
ECYVLAAMAYDRFVAICRPLHYSTMMSNRVCLVLTVGSYFAGLVSLVAHTSLTFSLDYCGSNIINHFFCEIPPLLALSCSDTYVSEILLFSLCGFIEFSTILIIFISYTF
ILVAILRISSNEGRLKAFSTCGSHLTGVTLFYGTVMFMYLRPTSTYSLDQDKWASVFYTIIIPMLNPIIYSLRNKDVKAAFKRVIIRKSQ*
656 >lcl|XP_001375820.2|Plus1complement(3353418..3354362) NW_001581929 olfactory receptor 51I2-like LOC100024598 __SEG__ Chr4 {Monodelphis domestica} MGSSSTNSTGLPPFTLTGLPGLEDSQHWMFLLLGALYSVSIVGNSLILFIVKEEQSLHQPMYYFLSLLSVNDLGVSLSTLPSVLATFCFHAQEITFDACMAQMFFIHLFS
FMESGILLAMSFDRYVAICNPLRYSTILTDARVAQMSLFIGVRSFCMVFPLPFLLKRLPFCKANILSHAYCLHPDLIRLPCGDITINNIFGLCIVLSTFVLDSVLIFLSY
VLILRSVLAIASQEERLKILNTCVSHICAVLIFYMPMMGVSMVHRYGRYAPPYVFTLMSLVYLFVPPMLNPVIYSIKTKEIRQRLIRLFFVTKP*
657 >lcl|XP_001375823.2|Plus1complement(19463166..19464101) NW_001581971 olfactory receptor 10A7-like LOC100024602 __SEG__ Chr5 {Monodelphis domestica} MAEANITFVTEFFFLGLSSKPRDQFILFIMFLFFYLLTVLGNLIIITVIQIEPRLQTPMYFFLTNLSFLDICYTSTNVPQMLSNMVGKKKTISFTGCAIQMYFSLSFGMI
ECVLLGVMAYDRYVAICVPLHYTIIMNRRSCIHMAAISWASSFLSSMVINVLTLSLPYCGPNVLNHFFCEVPSVLRLACTDTSVTELVVFIFSIIIVFIPFLLIVISYAR
ILLSVLRMHSAEGRLKALSTCASHLTVVALFYGTAIFMYMRPQSKSSRSGGKIIAVFYTIITPMLNPLIYSLRNKDVKGALKKAISKHSLA*
658 >lcl|XP_001375848.2|Plus1complement(3394783..3395730) NW_001581929 olfactory receptor 52B2-like LOC100024641 __SEG__ Chr4 {Monodelphis domestica} MIKSNFTVFHPTVFVLLGIPGLESYHIWLSIPFCLMYMTAVLGNGVLILVVLVERSLHEPMYIFLSMLAGTDILLSTTTVPKALAIFWFRAGEIAFDACITQMFFIHVAF
VAESGILLAMAFDRYVAICTPLRYTTILTPAVIGKISLAIWGRSIGTIFPIIFLLKRLPYCRTNIIPHSYCEHIGVARLACADITINIWYGFSVPMASVLVDVALIGISY
TLILRAVFRLPSQDARHKALNTCGSHIGVILLFFIPSFFTFLTHRFGKNIPHHVHILLANLYVLIPPMLNPIIYGAKTKQIRDSMSRMFSIMTKG*
659 >lcl|XP_001375850.2|Plus119517540..19518484 NW_001581971 olfactory receptor 9G4-like LOC100024645 __SEG__ Chr5 {Monodelphis domestica} MSVEVGNRTTLNEFILVGFLADSQMQVVFFVVFLALYLVTLAGNMTLVVLIRSDSRLHTPMYFFIGNLSFLDFWYTSVYIPKILVTCISEDKRISLAGCGAQFFFSAFVA
YTECYLLAAMSYDRYVAICNPLLYSATMSKSLCVVLVAGSYIGGFLNGTVHTANTFRLKFCGKNIINHFFCDAPPLVKMSCTDTKVYEKVLLGVVGFTVLSNILVILISY
FNIVLAILRIRSASGRWKAFSTCASHMISVILFYGSILFIYSRPSSTYSLEKDKLASLFYTVVNPLLNPMIYSFRNKDVKEAFKKAIQSIQTPR*
660 >lcl|XP_001375851.1|Plus138620936..38622432 NW_001581982 histamine H1 receptor-like LOC100024646 __SEG__ Chr6 {Monodelphis domestica} MTPPPSSCLQEGTMCEVNRTADANKPHLVPLVVVLSSISLVTVGLNLLVLYAVRTEKKLHTVGNLYIVSLSVADLIVGAAVMPLNIVYLFKPLKRPLCLFWLSMDYVAST
ASIFSVFILCIDRYRSVQQPLKYLRYRTKTRATVTILITWFLASLWIIPILGWKRFWSGNDQSKLSNDSDTGDKCETDFYKVTWFKVMTAIINFYLPTLLMLFFYSKIYR
AVRQHCQHRELINGSFPSFSGGTVDHRKHKICLPKPEKNARLEPLKRKPEGSYYHVSSNTSMKTQDPAMELPPEKNTPKSSEEEDEEVMVEEPFFPTDIVQTQDGTEEAR
RYISIHQNQPEPKELLPATQCASETSEETICAEAPSRSRDSSAATDLATSMSAEDQAKDKATFGLDYLTFTWKRFRSHSRQYIKGLHMNRERKAAKQLGCIMAAFILCWI
PYFIFFMVIAYCAKCCNDHVQMFTMWLGYINSTLNPLIYPLCNENFKKAFKKIFRIGS*
661 >lcl|XP_001375863.2|Plus1complement(3414676..3415644) NW_001581929 olfactory receptor 52B2-like LOC100024663 __SEG__ Chr4 {Monodelphis domestica} MMNVNHTIFHPAVFVLLGIPGLERYHMWLSIPLCFIYASAVLGNSVLILVIVTERSLHEPMYMFLSMLAGTDILLSTTTVPKALAIFWFCARNITFDACVTQVFFVHVMF
VGESAILLAMAFDRYVAICDPLRYSMILTLPVVGRMALAIVVWSFCIIFPVIFLLKRLPFCRTNMIPHSYCEHIGVARLACADITVNIWYGFSVPIVMVITDVLLIAVSY
TLILRAIFRMPSQDARHKALSTCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHIHIILANLYVVVPPMLNPIVYGVKTKQIREAVAHFFMGIKKCFSSSSLD*
662 >lcl|XP_001375864.2|Plus119527402..19528430 NW_001581971 olfactory receptor 9G4-like LOC100024664 __SEG__ Chr5 {Monodelphis domestica} MYPKSKSYQLINSVSLVAAPLIQSGYNTMSMEVGNRTTLNEFILVGFSADSQMQLVFFVVFLALYLVTLAGNMTLVVLIRSDSHLHTPMYFFIGNLSFLDFWYTSVYIPK
ILATCISEDKRISLAGCGAQFFFSAFVAYTECYLLAAMSYDRYVAICNPLLYSATMSKSLCVGLVAGSYIGGFMNAIAHTANTFRLKFCGKNIINHFFCDAPPLVKMSCT
DTKVYEKVLLGMVGFTVLSSILAILISYFNILLAILRIRSASGRWKAFSTCASHMISVMLFYGSLLFTYSRPSSTYSLEKDKLASLFYTVVNPLLNPMIYSFRNKDVKEA
FKKAIQSIQTPR*
663 >lcl|XP_001375865.1|Plus1complement(1965322..1966449) NW_001581975 sphingosine 1-phosphate receptor 3-like LOC100024665 __SEG__ Chr6 {Monodelphis domestica} MAPPAGSNAFPENGTVSLHYNYVGKLEERLKDRESNELTDAIFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIANLALCDLLAGIAYKVNILMSGKKTLSLSLTVWFL
REGSMFIALSASTCSLLAIAIERHLTMIKMRPYDANKKYRVFLLIGMCWLISFSLGALPILGWNCLDNLPDCSTILPLYSKKYIAFCISIFITILVTIVILYARIYILVK
SSSRKVTQHNNSERSMALLRTVVIVVSIFIACWAPLFILFLIDVACKVKECAILFKAPWFIALAVLNSAMNPVIYTLASKEMRRAFFRLVCSCLLRNKMSPSSPSQPAPH
QSRTKSCSSTNGNNMPKPRENFPQISAAPGSIRKTEPLYNGILGQ*
664 >lcl|XP_001375867.2|Plus1329823..330761 NW_001582011 olfactory receptor 6C2-like LOC100024667 __SEG__ Chr8 {Monodelphis domestica} MRNHTGITLFFLRGLTDDPQLKVLLFIFLFLNYMLSIIGNLTIIALTLVDPHLKTPMYFFLRNFSFLEISFTTSCIPRYLYSISTGDNTVSYNACATQLFSVIFLGAAEF
FLLATMSYDRYVAICKPLHYTTIMNNKVCNRLLLSSWLSGLLIILPPLILGLQLEFCDSNVIDHFTCDAFPVLEISCTDTTFIEKIALIDAILTLIITLLFVIWSYASIV
RTILRFPSAQQRQKAFSTCSSHMIVVSISYGSCIFMYVKSSANEMVALNKVVSVLMTSVAPLMNPFIYTLRNKQVIQAFKDLVKKIAILLKQ*
665 >lcl|XP_001375877.2|Plus1complement(3437293..3438237) NW_001581929 olfactory receptor 52B2-like LOC100024684 __SEG__ Chr4 {Monodelphis domestica} MMNVNHTIFHPAVFVLLGIPGLERYHKWLSIPLCFMYTTAVLGNSVLILVIVTERSLHEPMYMFLSMLASTDILLSTTTVPKALAIFWFCARDITFDACVTQVFFVHLMF
VGESAILLAMAFDRFVAICDPLRYSVILTLPVVGRMALAIVVRSFCIMFPVIFLVRRLPFCRTNVIPHSYCEHIGVARLACADITVNIWYGFSVPMVIVITDVVLIAVSY
TLILRAIFRMPSQDARHKALSTCGSHFFVILIFYFPCFFSVLTHRFGHNIPRHAHILFANLYVVIPPMLNPIIYGVKTKEIREAVNHLFIRIKK*
666 >lcl|XP_001375881.2|Plus1complement(350406..351344) NW_001582011 olfactory receptor 6C2-like LOC100024690 __SEG__ Chr8 {Monodelphis domestica} MRNNTGITLFVLRGLTDDPQLKVLIFVFLFITYVLSILGNLIIIILTLIDAQLKTPMYFFLQNFSYLEVAFTTSYIPRYLYSLSTGDNTITYNACFAQIFFVILLGATEF
FLLATMSYDRYVAICKPLHYTTIMNKKVCNQLLLGSWLAGLMIVLPPISLGLQLEFCDSNVVDHFGCDAFPILKIASSDTQFIEKMALIFAILTLIITLFLVFVSYAHII
KTVLRFPSVQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEGVALNKVVTVLTTSIAPVMNPLIYALRNKQVIQAFKDSAKRFVFLSKQ*
667 >lcl|XP_001375892.2|Plus1complement(3450567..3451511) NW_001581929 olfactory receptor 52B2-like LOC100024707 __SEG__ Chr4 {Monodelphis domestica} MMDVNDTIFHPAVFVLLGIPGLERYHMLISIPLCFMYATAVLGNSVLILVIVTERSLHEPMYMFLSMLAGTDILLSTTTIPKALAIFWFCSRDITFDACVTQVFFVHVMF
AGESAILLAMAFDRYVAICDPLRYSMILTLPVVGRMALAIVVRSFCIIFPVIFLLKRLPFCRTNVIPHSYCEHIGVARLSCADITVNIWYGFSVPIVMVITDLVLIAVSY
TLILRAIFRMPSQDARHKALSTCGSHLCVIFIFYFPCFFSVLTHRFGHNFPRHAHILFANLYVVIPPMLNPIVYGVKTKEIREAVTHLFIRIKK*
668 >lcl|XP_001375896.2|Plus1complement(19551561..19552490) NW_001581971 olfactory receptor 1013-like LOC100024712 __SEG__ Chr5 {Monodelphis domestica} MEKFNHTVTEFILVGFTQDPAMQLVLFVFFLMVYSMTVVGNITLLVLICTDSQLHTPMYFFIGNLSFLDLWYSTVYTPKIMVTCVSKDKSISFAGCVAQFFFSGALAYSE
CYLLAAMAYDRYMAISQPLLYTQAMSPRVCIGLVAASYLGAFTNCAIITRETFIMTFCGDNVIDDFFCDLPPLVKLACDVKDSYHILLYFLLASNVITPTVFILASYLFI
ISAILRIRSTQGRQKAFSTCSSHLISVTLYYGSILYIYSRPSSSYSLNRDKIVSSFYTVVFPMLNPMIYSLRNKDVKEALKKLFMKMTS*
669 >lcl|XP_001375900.2|Plus1<397499..398227 NW_001582011 olfactory receptor 6C76-like LOC100024716 __SEG__ Chr8 {Monodelphis domestica} FTSVCILDFLVSIVTENKIFTYNSAWAQVFFLILLGATEFFLLAAMSYDRYVAICKPLHYTTIMSSKVCSQLVISSWLAGFLIIFPPVIMGLQLEFCDSNIIDHFTCDSS
PMLMISCTDTKVLEVMSFCLAVFTLMFTLVLVILSYSYILRTILRIPSAQQRKKAFSTCSSHMIVVSISYGSCIFMYVKPSAKEGVALNKGVAVLNTSVAPMLNPFIYTL
RNQQVKQAFKDIIRKIFFSNKW*
670 >lcl|XP_001375938.2|Plus1complement(19616966..19617898) NW_001581971 olfactory receptor 1013-like LOC100024791 __SEG__ Chr5 {Monodelphis domestica} MKKVNHTVSDFILVGFTKDPIIQLVLFVVFLLMYCTTVLGNITLITLICTDSRLYTAMYFFIGNLSFLDIWYSTVYTPKIMLTCISDDKSISFAGCLAQFFFSAGLAYSE
CYLLAAMAYDRYVAISKPLLYAQSMSPRLSSYLVAASYTGGFINSIIITSETFTLNFCGDNVIDDFFCDLPPLVKLACGVKDSYQTVLYFILASNVITPTLLILASYLFI
IAAILRIQSNQGRLKAFSTCGSHLTAVTLYYGSILFIYSRPSSSYSLERDKMVSLFYTVAMPMLNPMIYSFRNKDVKDALKKMRDRIRVS*
671 >lcl|XP_001375977.2|Plus119702435..19703379 NW_001581971 olfactory receptor 1009-like LOC100024846 __SEG__ Chr5 {Monodelphis domestica} MGSENYTRVTEFIFVGLKYDPKLQVILYLIVLLFYFINMTGNLGIIILIWFDARLHTPMYFFLSHLSFVDMSFSSIVIPKMLRDFFKERKTITFLGCALQQWFFGFFVAI
ECSLLASMAYDRYVAICNPLLYSIAMSQKHCNQLVAIPYAIGFMDAMIHTPAAFRLPFCGPNVINHFFCDIFPLLSLICTDTSMNKLLVFVIAGIIGVVSGLIILVSYIY
ILIAILKIQSAEGRKKAFSTCSSHLTAVTILYGTLFFVYVRPNSRFSMGTNKLVSVFYTSVTPMLNPLIYSLRNKEVKDAIYRTIAKRKFCIRI*
672 >lcl|XP_001375990.2|Plus1complement(19745863..19746792) NW_001581971 olfactory receptor 5AK2-like LOC100024868 __SEG__ Chr5 {Monodelphis domestica} MTHRNNTRITEFILLGFAVRQELQYVLFLVFLVIYMTSLVGNVGMILLIKFDARLHTPMYFFLQNLAVADLFYTSSITPKTLLNFLVSDKSISFSGCVMQLYVYGIFVTS
ELYLLAAMAVDRYVAICNPLRYSVVMSQRVCIFLVTGSFLMGSLNATTNIGFLFSLSFCNSNIINHFFCDLPPILTLSCSNIYFNAMLLIIFVGFNLSSTLLVVFFSYIY
ILAAILRIPSATGRRKAFSTCASHFIAVTIFYGTLSYMYLQPSSSETEENDKLSSVFYGIVIPMLNPLIYSLRNKEVKEAVKVLLKRGS*
673 >lcl|XP_001376040.2|Plus1complement(19817214..19818158) NW_001581971 olfactory receptor 998-like LOC100024951 __SEG__ Chr5 {Monodelphis domestica} MEAKNQTVVTEFVFVGFTEHLQQQVLLFLMFLFFYLITVFGNLGMIVLIWIDSQLHTPMYFFLSHLSFVDICSSSTIAPKMLADFFVEKKTISFLGCSAQMWFFGLFVTT
ECFLLAAMAYDRYIAICNSLLYTVVMSRSVCIHLVVGPYIMGLLNAMTNTVLTFQLPFCGQNVINHFFCDISPLLSLACTDTHLNELVLLIMAGGVGVFSGLTILISYIY
ILLAILRIRSAEGRSKAFSTCSSHLTAVSIMYGTLFFIYVRPSASFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKNAFRRTLERKKNSLGK*
674 >lcl|XP_001376053.1|Plus1263461..264594 NW_001581930 5-hydroxytryptamine receptor 1D-like LOC100024970 __SEG__ Chr4 {Monodelphis domestica} MPLQNQSAEDSPWSPPSKPLNSTEISEVWDAQTLQALKISLAVILAIITLATILSNTFVIITIFLTKKLHTPANYLIGSLAVTDLLVSILVMPISIAYTVTQTWTFGQIM
CDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTFGRAAAMIAMVWVISVCISIPPLFWRQAKAHEELADCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRI
YAAARTRILKPPSLYGKHFTTAHLITGSAGTSLCSINSSLQEGQPHPGGSPLFIGPVKIKLASSLLERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDA
CWLHPAIFDFFTWLGYLNSLINPIIYTWFNEEFKQAFQKLIRFRRGP*
675 >lcl|XP_001376059.2|Plus1complement(19858901..19859866) NW_001581971 olfactory receptor 998-like LOC100024976 __SEG__ Chr5 {Monodelphis domestica} MEAKNQTVVTEFVFVGFTEHLQQQVLLFLMFLFFYLITVFGNLGMIVLIWIDSQLHTPMYFFLSHLSFVDICSSSTIAPKMLADFFVEKKTISFLGCSAQMWFFGLFVTT
ECFLLAAMAYDRYIAICNPLLYTVVMSQSVCIHLVVGPYIMGLLNSMTHTVLTFQLPFCGQNVINHFFCDISPLLSLACTDTHLNELVLLIMAGGVGVFSGLTILISYIY
ILLAILRIRSAEGRSKAFSTCSSHLTAVSIMYGTLFFIYVRPSASFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKNTFRRTLERKKKILWVNKNELHS*
676 >lcl|XP_001376067.1|Plus1complement(33540457..33541863) NW_001581859 interferon-induced protein with tetratricopeptide repeats 1-like LOC100024986 __SEG__ Chr1 {Monodelphis domestica} MDENTMMDALTELRCHFTWDLLRVDNIDLTDLENRIQDEIECLDTNFRMSIHNTLAYVKLVRGQNEEALESLRKAEELIWEHYGDQAEIKSFVTWGNYAWIYYHMGEFPE
AQAYLEKVEAGCKKLLSPFRYKVELPEIDCEKGWALLKFGKEYYEEAKVSFEKALESEPDNPEFNTGFAICMFRLDLQEQYDKSISLEPLKKAVRINPEDAYLKVLLALK
LQACKQEEEGEKYLNEALNSMASKPYVLRYAAKFYCKKGYPDAGIDLLKNALRRTPTSNLLHSQMGFCYKAKVYQIKRATNFRPRGRDKQNLEKAIELSIFHFKTSIEYR
PTFELSYLELGDMYAETGDYNKAEESYQRVLNLKEIQDRTRQEVHYRFGRFNEFHRRSEVDALNHYLEALKIGKGKSLMGKGLPNSLEKFVKKRLRQNESDVETLSLLGF
IHKMKGETEKALEVYEAALGLDFSNSAF*
677 >lcl|XP_001376075.2|Plus120024204..20025145 NW_001581971 putative olfactory receptor 5AK3-like LOC100024996 __SEG__ Chr5 {Monodelphis domestica} MTQKNSTMITEFILLGFNIRQDLQNVLFLMFFFVYITSLVGNVGMILLIKFDSHLHTPMYFFLQHLAFVDLCYTSAITPKMLQNFLISHKSISFSGCLIQLLVYATFATA
DCYLLAAMALDRYVAICNPLHYPMVMCQRACIQLVVGSYVMGTLNASIHAVFTFSLFFCNSNIINHFFCDVPPLLALSCSRININVLLLIVCVGFNLISTVMVVFFSYVY
ILSAILRMRSATGKHKAFSTCASHLTAVTIFYGTLAYMYLQPSSSESEENDKIASLFYGIIIPMLNPLIYSLRNKEVKEALKMMGKTYLICKF*
678 >lcl|XP_001376107.2|Plus120071979..20072908 NW_001581971 putative olfactory receptor 5AK3-like LOC100025038 __SEG__ Chr5 {Monodelphis domestica} MIQGNGTRVTEFILVGFAVRQELQYVLFIVFLVIYMTSLVGNVGMILLIKGDARLHTPMYFFLQNLAFADLCYTSAITPKMLLNFLVLDKSISFAGCVMQLYVYGIFATS
ECYLLAAMAVDHYVAICNPLRYPVVMSQKVCILLVTGSYVMGFLNATTHTGFLFSLSFCNSNIINHFFCDAPPILVLSCSNIDVNVMLLVIFVGFNLSNTLLVVFFSYVY
ILAAILRMSSDSGRHKAFSTCASHLTAVTIFYGTLFYMYLQPSSSESQENDKVASVFYGIVIPMLNPLIYSLRNKEVKEAMNIITKKFS*
679 >lcl|XP_001376131.2|Plus120102757..20103683 NW_001581971 putative olfactory receptor 5AK3-like LOC100025071 __SEG__ Chr5 {Monodelphis domestica} MIHRNGTRVTEFILLGFAVQQELQYILFLVFLVIYMTSLVGNVGMILLIKGDARLHTPMYFFLQNLAFVDLCYTSAITPKMLLNFLVSDKSISFSGCVMQLYVYGIFATI
ECYLLAAMAIDRYVAICNPLRYPVVMSQKVCILLVTVSYVMGFLNATTHTSFLFSLSFCNNIINHFFCDVPPILALSCSNIDVNVMLLIVFVGFNLSSTLLVVFFSYVYI
LAAILRMSSASGRHKAFSTCASHLMAVIIFYGTLSYMYLQPSSSESQENDKIASVFYGIVIPMLNPLIYSLRNKEVKEAVKVLIKSCS*
680 >lcl|XP_001376179.1|Plus157483255..57484352 NW_001581879 5-hydroxytryptamine receptor 1E-like LOC100025139 __SEG__ Chr2 {Monodelphis domestica} MNFTNCTTEASVAIKSKSVTEKMLVSMTLVVITTMTTLLNSAVIIAICTTKKLHQPANYLICSLAVTDLLVAVLVMPLSITYIVMDSWTLGYFVCEVWLSVDMTCCTCSI
LHLCVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRLLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKTLYQKRGSSR
HLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFDKINTSVRIPPFDNDLDQAGDRQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSLYTVSSEVADFLT
WLGYVNSLINPLLYTSFNEDFKLAFKRLVRCREHS*
681 >lcl|XP_001376189.1|Plus1complement(30000343..30002925) NW_001581871 toll-like receptor 5 TLR5 __SEG__ Chr2 {Monodelphis domestica} MGHLLAFLLGLVFKATSVYGIPSCSADGQLAFYRFCNLTQVPQVPNTTTKLLLSFNYIRVVNATSFPLLDQLQFLELGTQNIPLTIEREAFRNLPNLLVLDIGNTKIQFL
HTDAFQGLFNLVQLQLYYCHLSDSILKDGYFRNLSSLAILDLSRNEIENLQLHPSFGNLESLKSIDLSLNHISLICKRDLEVLQGKRFSLFNLASNNLYSKVSVNWKECM
NPFKNMSFEILDVSSNGWTVDIVRDFCHAIQGTRISSLLLNYHIMGGGFGFHNLKEPDQDTFAALGMSSVIKMDISHGFIFSLNFHLFETLRELKVMNLSHNKVNKIANG
AFYGLDNLQILNLSYNLLGELYQSDFAGLSKVAYIDLQRNHIGIIEKQTFKHLKNLQTLDLRDNAIKTVYFLPSVHTAFLSGNKLVHIEENINITAGFLDLAENRLANLN
DLYILLQIPDLKFLILNKNRFSFCNQQYGPSKNHTLEQLYLSENMLQLIWEAGKCWDVFKRLSHLKILFLNNNYLNFLPPDVFSDLTALQILSLDGNKLISLSPGVLPEN
LRVLSLSQNHLLSPDPTVFASLSYLDITHNKYICECEARNFILWLNQTKVNMLGSPEDVYCTYPDSFSGVSLYSISTEGCDEEEALQFIHFSLFIFFTTTLTVFLTAVVT
FTRFRGCCFLLWRKMFLTLALEYHPQGVKEDQHKYDAYLCFSSKDFEWVQNAFLNHLDSQYSPKNRFNLCFEERDFLPGEDHINNIRDAICNSKKTICIVTRHFLKDGWC
IEAFNFAQSRYFSDLKDVLIMVVAGSLSQYQLMKYPPIRVFVQRQPYLKWPEDLQDVGWFLNKLSQRILNKKEEKKKSNNIPLQTVATIS*
682 >lcl|XP_001376195.1|Plus1complement(20284990..20286144) NW_001581971 apelin receptor-like LOC100025164 __SEG__ Chr5 {Monodelphis domestica} MEEGADFDSYYPGENQTVECEYTDWKSSGSLIPAIYILVFLLGTTGNGLVLWTILRGSRDKRRSADTFIASLAVADLTFVVTLPLWATYAYLDYTWPFGAFACKVSSYLI
FVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGVVATVGLWILAALLAMPAMVFRSVGELENNTKLVCYMDYSLVAASGSELAWEVGLGVSSTALGFVVPFTVMLT
CYFFIARTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWLPYHLVKTLYMLGSLLHWPCDFDLFLMNVYPYCTCVSYVNSCLNPFLYAFFDPRFREACRALLCCGQS
GCWGTAPGGGEKSASYSSGPSQGPSQNPGKGGEQPQEKSIPYSQETLVSDHILA*
683 >lcl|XP_001376218.1|Plus130524214..30526145 NW_001581871 uncharacterized protein C1orf65-like LOC100025202 __SEG__ Chr2 {Monodelphis domestica} MEGTGRFSPLPYLEVYDHEPLGGEPAPLPVAVPRGSPGGLKGEALTANKDAPAAALPGCQAFERTRGAAGTPGTAQQALHPPTPQPQRRLFPSSPRESRSLTDVGRRPPD
RARRQLPRSRRPDDDRDSAARASRLGRASYNLAWQQPQQQQQQQTLSNSGKKDMPAPTPRGDYTVPRGTLTLEREPSGDQWATTVRRCLGHWVPSSHSLEKSVLPSKEIR
VRASSLEPRGKTVNQLVEIGSQYSQTHGANKETQMESFQNLKDNQTESMIPPRDKKIVTLMMDRLKKARKIQELQHQAAEAWEEVKRCDQRFQVMLERERQHQLSQSKEQ
WERQKEERRARLSKEQQERLETWEKEMALRESKWKRQVQEQESQRREKLERAREQAEYRKHCQEQMLKEKEVMQRDRREQNIQQLQEKMVQACYKRQLKNLEGRKKLQEN
NLTASASHQVRKVLLDSQNKAEEILRRLSLEQRSQRSQEIHQRLIEERHKELKEKALKEEEHLLLAKWRAEETEEQRKLHKKMLVELGDLKIQQARDNVHKNIKDKADRI
REFNFLREKNHYFLKQKAEEEAKCHIEGIKEAIKKKEQKMSQISREKDATIEESRKIAQASLQMREKVKALQVSFDRMAWEAQFNASLHGGSH*
684 >lcl|XP_001376275.2|Plus1<1561100..1562074 NW_001582012 olfactory receptor 9K2-like LOC100025290 __SEG__ Chr8 {Monodelphis domestica} IVPCAPQQVSVMSDRGTDNHSEVTDFILIGFRIRPELHTLLFLLFLFLYSMIFLGNGGMITLILTDPRLNTPMYFFLGNLSFIDLSCSSAVALKAMANILSMRNTISFTG
CVTQLFLFALFMVTEGFVLSAMAYDRFIAICSPLLYTLRMSRRLCTQLVLSSYLCGWVTAVLQVSMTFSMSFCASRVIDDFYCDSHPMEKISCSDVFFHKIISLTLAGVI
IFPTIVVILVSYTYIVSAVLKIRSTEGRKKAFSTCSSHLGVVSLLYGTVFFVYVIPPNNPELRKIASVCYTLVTPMLNPLIYSLRNKDVKAALQRILGKKKALF*
685 >lcl|XP_001376320.2|Plus1complement(1636515..1637525) NW_001582012 olfactory receptor 9K2-like LOC100025353 __SEG__ Chr8 {Monodelphis domestica} MISGSKMRIHFLTLTCTSQQVPAMGERGIKNHSEVTEFILVGFRVHPELQILLFFIFLLIYSMVLLGNIGMIILIVTASRLNTPMYFFLGNLSLIDLSYSSVVAPKAIAN
LLSESKTISFVGCVAQLFFFALFIVTEGFLLAAMAYDRFIAICSPLLYSVRMSRRLCIQLVAGSYFFGCISSIIQAIITFTMSFCASHVIDFFYCDTRAIQKIACSNVFI
NEVISYTLAVLIILPTIIVIMVSYIYILSTILKMHSNEGQMKAFSTCGSHLMVVSLLYGTVSFMYLTPASNPELGKAASLCYTLVTPMLNPLIYSLRNKDVKEALKSMLW
RKKSFL*
686 >lcl|XP_001376330.2|Plus11767971..1768909 NW_001582012 olfactory receptor 6C75-like LOC100025368 __SEG__ Chr8 {Monodelphis domestica} MGNHTTVTMFILLGLTDDPQWKIALFLFLFLTYILSVAGNLTIILLTLLDPHLKTPMYFFLRNFSLLEISYTTVCIPKFLVSIATGDKTITYNCCLTQLFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTTIMSSKVCTQLVLSSWVSGFLIIFPGLIVGLQLDFCASNAIDHFYCDTAPMLQLSCTDTQFLELLSFILALVTLLFTLALVILSYSLIV
LTILRIHSASQRKKAFSTCSSHMIVLSLSYGSCIFMYIKPSAKERISLTKGISLLNTSVAPLLNPFIYTLRNQQVKQAFKDAIQKKVPFSRK*
687 >lcl|XP_001376339.1|Plus133266086..33266760 NW_001581978 suppressor of cytokine signaling 1-like LOC100025389 __SEG__ Chr6 {Monodelphis domestica} MVAHSKVAADNAVTADTRRRLDPSPSPPSHRAGREHPSPQPRPQHGLAPQHGAVALAATTQGQGDTHFRTFRSQADYFSITRASALLDACGFYWGPLSVNVAHEKLKGEP
VGTFLVRDSRQKNCFFAISVKMASGPTSIRVNFQAGRFNLDGSRETFDCLFKLLEHYLNSPRKMLVTPLRQLRVRPLQELCRKSIVATFGRDNLGKIPLNPVLKDYLKSF
PFQI*
688 >lcl|XP_001376349.1|Plus1complement(3142398..3143831) NW_001581878 zinc finger and BTB domain-containing protein 12-like LOC100025402 __SEG__ Chr2 {Monodelphis domestica} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGIGGGIGLTGLTSTKSLLPPARTPKPAPKPPPPPPPPPLLRPVKLEFPLDEDLELKAEEEEEDEEEDVSDICIVKVESALEVAQ
RLKPPGGIGGSLGLGGSLGLGGNLNLGGGLGLGGSSGLLINEVGETIDAPDDSTAPQGVVKACYSLTEDTEGEGLLLFPGGRVGEGITLGLGDEALAAATMSRSSGVSGS
YGGIRSPIPGGSPVGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDV
RFAHKPAIRRHLKEQHGKTTAENVLDASVSELNALLH*
689 >lcl|XP_001376363.2|Plus1complement(226023..228407) NW_001581936 kelch domain-containing protein 7A-like LOC100025422 __SEG__ Chr4 {Monodelphis domestica} MSDSRAEPGAWHSDMQFTGKLVLSATALLLGTLVYKLYKSRPARNPPAGGTAAPDAPAPEEPEVAGQAEPARTSPTAHRRRRRGSREEGAKGAPPPEGAGGAWDRRGLGG
TRPGAAPDREEPIPGEFPAGDRVEEKAVGPGKHDLPHLDDGARELENPPPGLVQAHSEAACPGDARPAPGLLLERAGGPREEEELWGAPCPGDMERSWVFSQAAGVSQER
RGLLRATSDLGLAVSQRAGEAGTSYVFSSQARAQVEENWLGEQTPGERARGQREASAGPGLRGKIYDYYVESTSRSISSPSGGPGGAVVPQGSPQLPTFGRLPSQPPADF
PDADCLTSPGRTHPAGAAEAVSESSSSSGNPFPPPGPGISRKESFLQIAENPEFQLPLDPAGASSSGALPLARRASTRSLDPNAAGAGLEPKVESVAGTNFFQLPLLPGA
AQNTRLDLGNCSEVLRLAKREKLDALKEAAYQVMSDNYLQVLQSANIYGHLSGAERELVLRRRLQGQKYLVVADVCPQEGTGRLCAYDQERDAWWPLASLPPEAISWGCS
LCSLFNYLFVVAGCPRAGGQASNRMFCYNPLTGIWREMCPLNQARPHCKLVVLDGYMYAIGGECLYTVERYDPRQDRWAFVAALPNDTFALAHTATVCDGEIYVTGGTLR
YLLLRYSGQEDRWRASPTGGGKDRTAEMVAVNGFLYRFDLNRSLGIGVYRCSARTRLWYECATYRVPYPAAFQCAVVDNLIHCVGRQFHLRFLADYVSPRFLSGDELQRF
PSPQGTLIPTVLALPALNMAQTRV*
690 >lcl|XP_001376369.2|Plus11853515..1854453 NW_001582012 olfactory receptor 6C70-like LOC100025428 __SEG__ Chr8 {Monodelphis domestica} MNNYTMLTEFILLGLTDDPLCLVVIFIFLFLTYILSMSGNITIIILTLLDSRLKTPMYFFLRNFSFLEILFTTVCIPRFLVSIITKDKTISYMGCLTQLFFFIFLGVTEF
YLLAAMSYDRYVAICKPLHYTTIMNNRVCYQLVLSSWITSFLIIFPPVIMGLKLEFCASNVIDHFICDSSPILQISCSDTHILELMSFTLAVITLMVTLVLVILSYTYII
RTILKFPSAQQRTKAFSTCSSHMIVVSISYGSCIFMYIKPSANERVALSKGIAVLNTSVAPLLNPFIYTLRNQQVKQAFKDIIQKTMFATKK*
691 >lcl|XP_001376390.1|Plus1complement(26709876..26711120) NW_001582017 somatostatin receptor type 3-like LOC100025457 __SEG__ Chr8 {Monodelphis domestica} MDITSFPSPISASSEPENASLTWPEDPFMGNLSTSPAGTGLDVSGVLIPLVYLAVCVVGLLGNSLVIYVVLRHTVSPSVTNVYILNLALADELFMLGLPFLAAQNALSYW
PFGSLMCRLVMAVDSINQFTSIFCLTVMSVDRYLAVVHPTRSSRWRTAPVARAVSAAVWVASAVVVLPVVVFSGVPRGMNTCHIQWPEPAAAWQTGFIVYTAALGFFGPL
LVICLCYLLIVVKVRSASRRVQVTSSKRRRSERRVTRMVVAVVALFVLCWLPFYVLNIVNVVCPLPEEPSLFGVYFLVVVLPYANSCANPIIYGFLSYRFKQGFRRVLLR
PSRRVQNQEPPVGPPEKTEEEEEEDEDDERVARKETNGRISQISQSGNGGRELPPCRPCGSEHKPLPEELTGGEKSSTLQTSYL*
692 >lcl|XP_001376415.1|Plus1complement(45397327..45398622) NW_001582021 OTU domain-containing protein 1-like LOC100025496 __SEG__ Chr8 {Monodelphis domestica} MQLYSPGFSHYPSGGPATAASSPPSTATAPFKVSLQAPDPAAEAAGGDCPPATPPAAESREAAAAGMPAFSCFEMVPPGAAAPAAAPGGSCKPPLPPPPPPPPPHYTSTV
QMSVRCLGPERVGARPPEPPRRCSSSAWILEELLKPGSEAGPRSDGPDRNFRLSEHQQALAAARPRGGVSESSSRSAWGEPQPREGSPRRWESAAPTSRARSEPAPEPPS
RSNAAPSSSPASGAPKDEKLALYLAEVEKQDKYLRQRSKYRFHIIPDGNCLYRAVSKAMYGDQSLHPELREQTVHYIADHLDHFGPLIEGDVGEFIIAAAQDGSWAGYPE
LLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELARSMAISLSKMYIEQNACS*
693 >lcl|XP_001376416.1|Plus1complement(2760102..2760713) NW_001587046 protein phosphatase inhibitor 2-like LOC100025497 __SEG__ ChrX {Monodelphis domestica} METFTTKHRPIKGILKKSSPGSPILSTMGTGAGAVRGEEFSKKSQKWEELDILATYHHKDKNYEPMNIEEQNPSSHGDPEDSEEEDDDDDDDIRYSAIPHAITPELLSQR
LENDQDIEYMLLFRESESSEDEEDHKRRFELKRKLHYREGLNIKFAQQLAMKEDDSQDQEMTDLSEVDNMAMEAWHTTAPNESIQDSEMNSDL*
694 >lcl|XP_001376423.2|Plus1774417..775568 NW_001581915 chemokine-like receptor 1-like LOC100025506 __SEG__ Chr3 {Monodelphis domestica} MNGCLNDVFYLQRMASDDYNFTDGYYDYDGDGFVIAPEESTPNDAGVARICLVVIYSLVCFLGLLGNGLVIVITALKMKKTVNTVWFLNLAVADFLFNVFLPIHIVNTAM
DYHWVFGKAMCKISHFVVVYNMYTSVFLLTTISFDRCISVVFPVWSQNHRSIRLASLACAAIWTLAFFLGSPSLIFRDTTIQQGKIVCFNNFSLLANVSHSHHLHSAQVS
ISYMRHVMVTVTRFLCGFFLPVFIITVCYLIIVCKLKRNRLAKSKKPFKIIVTIIITFFLCWCPYHTLYLLELHHASVPSSVFSLGLPLATALAISNSCMNPILYVFMGQ
DFKKFKVTIFSRLVNALSEDTTAHSSYMSHRSITKMSSMNERSSMNERETGML*
695 >lcl|XP_001376496.2|Plus1complement(20937674..20938633) NW_001581971 olfactory receptor 1052-like LOC100025625 __SEG__ Chr5 {Monodelphis domestica} MTPGEIALASGNFTPVTQFILLGFSEYQDLQMLFFLIFLLIYAMTVLGNVGMMTLIYIDARLHSPMYFFLSVLSFLDICYSSVVTPKLLVNFLANDKSISFTGCVVQLTF
FVIHVTTESFLLAAMAYDRFMAICQPLHYSSVMTKVTCLQLVAASYGFGGINSIIQTGNVFVLPFCGPNEITHYFCDIPPLLRLVCADTATAGNILYIFSALVTLLPAAV
IFISYGLVLVAIGRMGSSSGREKALSTCASHFLAIAIFYGTVVFTYVQPHGREGGKDGQIVSVFYTIIIPMLNPFIYSLRNKEVKDAFRRRLQANVFPR*
696 >lcl|XP_001376549.1|Plus1433653..436109 NW_001581987 NF-kappa-B-repressing factor-like LOC100025699 __SEG__ Chr6 {Monodelphis domestica} MAGERLLLGDDFLSPPTPPPLPPPLPLQPPPIPSPPPPLPPSPSPPLPELQPEPEPDPEPEPDPEPDPEQKLEESLAQWRYSHESDRQWGLRRQFICRHLHNYTGPGAIE
KLLSLSTAWTNHIFLGCKYGPQLMEKILQMAEGIDIGEMPSFKLVVPEPPKVQKRPLSPHADPSPPKKKAAPRFLVRPRFEPVHFVASSKEEERKKDPTDSRNEWGDPQV
DSIKWPVDSLKSYVRDRFRARFGKTRFSQTRFSFVERKPTTTRTFSSYGDPETYNLYSQSVDESSSAATFSHLVLATKQSFIERLSGAVQRNMPRKEVSHRSEKSSYTFI
LSRCFHACRTNPEYIYASLKEISPSDIPRSKKFLTDGYACEVRCQSVYLTTGYAASKNASRDRATEQAVKLLQKPVEVKIVKRKFKHTYHDDLVVFPAGLSSYDFPPALR
VPEDFLSTRNEFGQLNYDSAFPLSKRWNNFVLIENASDSIGILNKSASFNRMAIEYKYDIMPNNSWRCQVVLEGQCLAEGYGSKKTSKYAAADEALNILQKMKSNIAATQ
VQPVSYSTKDYGRRKDLRDRRVYGNSSNPVHTLNDTTQFNKMTVEYIFEKLTVLQWKCKVMLEKELITEAVGIRRGVKHETVEEVVKILKKTRPTAFNHLKRGAIEDMIT
RSEIRGRSGDDGYQQEIKEDNIGNQLLRKMGWMGGGLGKCGEGICEPISVKEQHKREGLGLDVEKPNKLYKRYIDQIIKNYAHSECHADLVFSTEFTSDERKQIHQMAQK
YGLKSKSHGMGHDRYLVVGRKKRKEDLLDQRKKEGQVGHYDFHMSQGN*
697 >lcl|XP_001376568.2|Plus121038653..21039594 NW_001581971 olfactory receptor 9I1-like LOC100025721 __SEG__ Chr5 {Monodelphis domestica} MEENGTSVKEFVLMGFTVGAKLQMVLFLTFLALYLITMGGNLGMIFLIQSSIHLQTPMYFFLSHLSFLDVCYSSVIIPQMLETLRPGGATIAYERCATQFFFFTLYASTE
CFLLAVMAYDRYVAVCNPLLYVTAMTPQTRVGLVMGAYSGAMVNTVIRTGLTFSISFCKSNHVNFFFCDLPPLLKLSCMETGPRELVIYLLAFTVITTSISIILISYLFI
IRAILRIRSAGGRAKTFSTCASHMTAVALFFGTLIFMYLRGNMGKSLGEDKIVSVFYTVAIPMLNPLIYSLRNKEVKEALKKVFNRVKISQAV*
698 >lcl|XP_001376580.1|Plus138151443..38152495 NW_001581960 probable G-protein coupled receptor 148-like LOC100025739 __SEG__ Chr4 {Monodelphis domestica} MDKETVLSHLEGKATPFQVEILNLAPSFYQLPGNSSLELEEAFWALLPSLRWFLVPLALLTAATLALSPLLLATILWKKKFRREPRYLLFANVMLSDLAYILFHVLISTS
NLLGWPLGRIVCGILTDVVFISYASTILSFTVMVADTYLAIMLPLRYLSLMSCATARKVVAMIWVVACFFPTFLVWFSKRQDSTLTQESSLCILQLTLSSNSDSNHMITV
AHIFIFCVLFVCAALIAYCYVKIYHTARTSGLCLNRYSRARGTLLIHTMLIVLYISPVVVFAVDIMLSRKYRIRNNSRLWLMAINSEILMMLPRALLPYLYGLRYRQLLQ
TLKGLVSKRRTSDIQTISFS*
699 >lcl|XP_001376584.2|Plus121053105..21054040 NW_001581971 olfactory receptor 9I1-like LOC100025743 __SEG__ Chr5 {Monodelphis domestica} MAIGNGTTVKEFILLGFTNHSELGTLLLLVFLTFYLLMLLGNLGMITLIWTNPGLHTPMYFLLRQLSFLDVCFSTTVLPQLLVTLANGRAVMSYEQCATQFFMFTFFGST
DCYLLALMAYDRYVAVCQPLLYVTIMTPRKRLKLVTGAYIGGLANAILRTSCTFSLSFCGDNQIDFIFCDLPPLLELSCGDTFLQELLILLFACFVILASLAMILVSYLF
IIRAILQIRSAGGRAKTFSTCASHMTAVGLFFGTLAFMYVRSKSGKSLEEDKVVSVFYTAVIPMLNPLIYSLRNKEVKEALKKLLNRLRLS*
700 >lcl|XP_001376692.2|Plus121168072..21169016 NW_001581971 olfactory receptor 9I1-like LOC100025897 __SEG__ Chr5 {Monodelphis domestica} MAEQNHTTVTEFILIGFTDHPKLVVILFLVFLSFYLITLMGNMGMVLLIRLDSRLHTPMYFFLSHLSLLDACYSSVIVPQILVTLVTGRTSISYNSCATQFFVFTVCAGT
ECFMLAVMAYDRYVAISNPLLYSSSMTLGTRWGLVAGAYGGGVSGAILRTACTFTLSFCGPNQINFFFCDLPPLLQLSCSDTTTSQILIIFFGNFVILANALVILVSYLF
IIRAILNVKSVGGRAKTFSTCASHLTAVMLFFGTLTFMYLRSNSGKSLEEDKVVSVFYTVVIPMLNPIIYSLRNKEVHAAFRKIINRFQVSQEM*
701 >lcl|XP_001376705.2|Plus121188706..21189650 NW_001581971 olfactory receptor 9I1-like LOC100025916 __SEG__ Chr5 {Monodelphis domestica} MAEQNHTTVTEFILIGFTDHPKLVVILFLVFLSFYLITLMGNMGMVLLIRLDSRLHTPMYFFLSHLSLLDACYSSVIVPQILVTLVTGRTRISYNSCATQFFFFTVCAST
ECFMLAVMAYDRYVAISNPLLYSSAMTLGTRWCLVAGAYGGGVSGAIIRTACTFTLSFCGPNQINFFFCDLPPLLHLSCSDTTTSQILIIFIGNIVILANALVILVSYLF
IIRAILNIKSVGGRAKTFSTCASHLTAVMLFFGTLTFMYLRSNSGKSLEEDKVVSVFYTVVIPMLNPIIYSLRNKEVNAAFRKIINRFQISQDM*
702 >lcl|XP_001376720.2|Plus121201129..21202073 NW_001581971 olfactory receptor 9I1-like LOC100025940 __SEG__ Chr5 {Monodelphis domestica} MAEQNHTTVTEFILIGFTDHPKLVVILFLVFLSFYLITLMGNMGMVLLIRLDSRLHTPMYFFLSHLSLLDACYSSVIVPQILVTLVTGRTSISYNSCATQFFFFTVCAAT
ECFMLAVMAYDRYIAVSNPLLYSSAMTLGTRWCLVAGAYGGGVSGAIIRTACTFTLSFCGPNQINFFFCDLPPLLQLSCSDTTTSQILIIFFGNFVILANALVILVSYLF
IIRATLNVKSVGGRAKTFSTCASHLTAVMLFFGTLIFMYLRSNSGKSLEEDKVVSVFYTVVIPMLNPIIYSLRNKEVNAAFRKIINRFQVSKEM*
703 >lcl|XP_001376747.2|Plus1complement(21231627..21232577) NW_001581971 olfactory receptor 10W1-like LOC100025981 __SEG__ Chr5 {Monodelphis domestica} MTWVNQSLSTEFVFLAYPTHPEQQILVFLGISLVYTMILTGNILIVAAIRMEARLHTPMYYLLGSLSIVEIFYTATVVPHILANTMKRHKTITLLGCATQMVFFIGLGSA
DCFLLAVMAYDRYVAICYPLQYPLIMTQKFCANLVVASVAIGFILSLQLVAFIFRLPFCHSKGIEHFFCDVPPVMRLTCSHSHLHELSVLVAGALAIAFPFLLIAVSYAL
ITMTILGIHSASGRQRAFSTCSSHLMVVLLQYGCCMFMYLRPNSSYSPKKDQLLSLIYTLGTPLLNPLIYTLRNSEVKGALRRVLTRIIFSKKSCT*
704 >lcl|XP_001376772.2|Plus1complement(21284245..21285195) NW_001581971 olfactory receptor 10W1-like LOC100026015 __SEG__ Chr5 {Monodelphis domestica} MTWVNQSLSTEFVFLAYPTHPEQQILVFLGISLVYTMILTGNILIVAAIRMEARLHTPMYYLLGSLSIVEIFYTATVVPHILANTMKRHKTITLLGCATQMVFFIGLGSA
DCFLLAVMAYDRYVAICYPLQYPLIMTQKLCANMVVACVAIGFILSLQQVALIFHLPFCHSKGIEHFFCDVPPVMRLTCSHSHLHQLSALIAGTLAIAVPFLLIAVSYAL
ITMTILGIHSASGRQRAFSTCSSHLMVVLLQYGCCMFMYLRPNSSYSPKKDQLLSLIYTLGTPLLNPLIYTLRNSEVKGALRRVLTRIIFSKKSCT*
705 >lcl|XP_001376786.2|Plus1complement(1052938..1053594) NW_001587033 olfactory receptor 51I1-like LOC100026036 __SEG__ ChrX {Monodelphis domestica} MGNSSTTNGTELPSFTLTGLPGLEASQHWMFLLLGALYTVSIVGTSLILFIVKEEQSLHQPTYYFLSLLSVNDLGVSLSTLPSVLATFCFHAQEITFDACKAQMVFIHLF
SFMESGIQLAMSFDRYVAICNPLRHSTILTDNRVAPMSLFIGIRSFCVVFPMPFCKANILSHAYCLHPDLIRLPCGDITINNIFGLCIVISTFEMDSALILLSYILFF*
706 >lcl|XP_001376796.2|Plus1complement(21341247..21342194) NW_001581971 olfactory receptor 10Q1-like LOC100026054 __SEG__ Chr5 {Monodelphis domestica} MPSSNILQLNQSGPIEFVFQVFSTSLTIQALLFCFFLLLYVMILCGNTAIVWAVFTHSSLHTPMYFFLSNLSFLEICYTTTLVPLMLSNIFDHRKPIPLAGCGVQMFFFV
TLGGTDCFLLAVMAYDRYVAICHPLHYTLIMTQRLCIQMVVGSLSLALFLALQLTSLVFTLPFCGYHREIKHFFCDVPPVLRLACADTHIHQAVLYVVSIIVLTIPFLLI
CISYVFITNTILHIRSAEGRKRAFSTCSSHLTVVLLQYGCCSLVYLRPPSNTQEDEDRQLALVYTFVTPLLNPLIYTLRNKDVKNALKKVVMSTR*
707 >lcl|XP_001376812.2|Plus1complement(21365760..21366707) NW_001581971 olfactory receptor 10Q1-like LOC100026078 __SEG__ Chr5 {Monodelphis domestica} MSSSDPLQLNQCLPTEFVFQVFTNSPTIQALLFCFFLLLYVMILCGNTAIVWAVFTHSSLHTPMYFFLSNLSFLEICYTTTLVPLMLSNIFDNRKPIPLAGCGVQMFFFV
TLGGTDCFLLAVMAYDRYVAICHPLHYTLIMTQRLCIQMVVGSLSLALFLALQLTSLVFTLPFCGYHREIKHFFCDVPPVLRLACADTHIHQAVVYVVSIIVLTIPFLLI
CISYVFITNTILHIRSAEGRKRAFSTCSSHLTVVLLQYGCCSLVYLRPPSNTQEDEDRQLALVYTFVTPLLNPLIYTLRNKDVKNALKKVMTSTR*
708 >lcl|XP_001376828.2|Plus1complement(21382712..21383674) NW_001581971 olfactory receptor 10Q1-like LOC100026098 __SEG__ Chr5 {Monodelphis domestica} MSSSGTFHLNQSGPIEFIFQMFTSSPKIQALLFSLFLFLYVMTLCGNTTIIWAVCSYTFLHTPMYFFLSNLSFLEICYTTTLVPLMLANIIGARKPISFAGCATQMFFFV
TLGSTDCFLLAVMAYDRYLAICHPLHYSLIMTQRLCTQMVAGSLSLALFLALPLTSLVFTLPFCGHFQEINHFFCDVPPILHLACADTHVPQAIVYVVSIIVLTIPFLLI
CISYIFITTTILRIPSAEGRQRAFSTCSSHLTVVLLQYGCGSLAYLRPPSSTPADEGRQLALVYTFVTPLLNPLIYTLRNKDVKNALKKAMSKKAATENL*
709 >lcl|XP_001376846.2|Plus1complement(21402035..21402979) NW_001581971 olfactory receptor 10Q1-like LOC100026123 __SEG__ Chr5 {Monodelphis domestica} MHFNHSGTTEFIFRMFTSSPKIQALLFSLFLFLYAMILCGNTAIIWAVCTHTYLHTPMYFFLSNLSFLEICYTTTLVPLLLANIIGARKPISFAGCATQMFFFVTLGSTD
CFLLTVMAYDRYVAICHPLHYSLIMTQQLCTNMVAGSLSLALFLALPLTSLVFTLPFCGHFQEINHFFCDVPPILHLACADTHVPQAVLYVVSILVLTIPFLLICISYIF
ITTTILRIPSAEGRQRAFSTCSSHLTVVLLQYGCGSLVYFRPPSSTPADEGRQLALVYTFVTPLLNPLIYTLRNKDVKNALKKAVSKKAATENL*
710 >lcl|XP_001376857.2|Plus1complement(21423153..21424103) NW_001581971 olfactory receptor 10Q1-like LOC100026143 __SEG__ Chr5 {Monodelphis domestica} MSSPRSFHLNQSSSTEFVFQLFTTSPRIQALLFFFFLLLYIMILCGNSAIIWAVWTHTSLNTPMYFFLSNLSLIEIGYTTTVIPLLLSNIFGAQKPIPLAGCGAQMFIFL
TFGGADCFLLTVMAYDRYMAICHPLHYTLIMTQKLCTQIVFGSLGLSVFLTLPLTALVCSLPFCGHHQINHFLCDVTPVLRLACGDIHIHQAVLYVVSIIVLTIPFTFIC
ISYIFIANTILRIRSTEGRQRAFSTCSSHLTVVLLQYGCASLVYFRPNSSTSEDEERQFSLVYTFFTPLLNPLIYTLRNKDIKDALKKVLSKKAPS*
711 >lcl|XP_001376887.2|Plus1<21499893..21500843 NW_001581971 olfactory receptor 5B12-like LOC100026185 __SEG__ Chr5 {Monodelphis domestica} FNIQKAVMDNSTEVNHFILVGLTDTPELQLPLFIVFTLIYLITVVGNLGIVVLIFWNSHLHTPMYFFLSNLSLVDFGYSSTITPKVMAGFLTGDKSISYNGCATQMFFFA
AFATIENYLLASMAYDRHAAVCMPLHYTTTMTSRVCAGLVVGAFIYGYLTSSIQIGNTFSLSFCGSNVVNHFFCDIPPLLALSCSDIHKKELVLFILAGFNASFAILVIL
FSYLFIFVAILRIRSVEGRQKAFSTCASHLSVVSIFYGTIIFMYLQPSSHHTMDTDKIASVFYTMIIPMLNPLVYSLRNKEVHNAFKKLTGGQNIH*
712 >lcl|XP_001376899.2|Plus1complement(21522234..21523172) NW_001581971 olfactory receptor 5B12-like LOC100026203 __SEG__ Chr5 {Monodelphis domestica} MASMENRTYVNEFILLGLTDATEVQVPFFILFTLIYLITLVGNLGMIALISCDSRLHTPMYFFLSNLSLVDFGYSSVITPKVMTGFLQENKVISYNGCAAQLFFFVAFGS
IENYLLAIMAYDRHAAVCRPLHYTTIMTSSVCAGLAIGSYICGFLHSTIHTIDTFSLSFCRSNVIHHFFCDIPPLLALSCSDTHMIQWVVFIIGGFSVFCALLVIMMSYL
FIFITILSIHSAEGRQKAFSTCASHLSAVCILYGTIIFMYFHPNSSHHINIDKMVSVFYTMVIPMLNPVVYSLRNKEVKNAFRKAMRGQRVS*
713 >lcl|XP_001376923.2|Plus1complement(21550259..21551194) NW_001581971 olfactory receptor 5B12-like LOC100026240 __SEG__ Chr5 {Monodelphis domestica} MISMENNSEVKEFILMGLTDVPKLKIPLSIIFTIIYLFTLVGNLGLIVLISWDSCLHTPMYFFLSNLSLVDFGYSSAVTPKVMAGLLIGDKIISYNGCAAQMFFFVAFAI
VESFLLVAMAYDRHAAICNPLHYTTTMTSKVCLGLAIGSYVCGFLQSCIHTGCTFRLSFCSSNVVHHFFCEIPALLALSCSDIHTNETILFTIAGLDVLFALLVILTSYL
FIFVAILRIRSSEGRKKAFSTCVSHLSAVSIFYGTIIFMYLQPNSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKNAFWKAIRQQTH*
714 >lcl|XP_001376938.2|Plus1complement(21567605..21568522) NW_001581971 olfactory receptor 5B12-like LOC100026262 __SEG__ Chr5 {Monodelphis domestica} MENNSEVKEFTLVGLTDVAKLQIPFFMIFTAIYLITLVGNLGMVVLISWDSHLHTPMYFFLSNLSLVDFGYSSAITPKVMAEFLTGDKIISYNGCAAQMFFSIAFPVIES
YLLASMAYDRHAAICHPLHYTTTMTVNVCASLAVGSYACGLLQSWILTDGTFRLSFCNSNVVHHFFCDMPALLALSCSDIHTSEMVLILLAGFNVVFGFLVILTSYLFIF
VAILRIRSSEGRQKAFSTCISHLSAVSIFYGTIVFMYLQPNSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKSAFRKIIGC*
715 >lcl|XP_001376947.2|Plus1complement(21587116..21588051) NW_001581971 olfactory receptor 5B2-like LOC100026276 __SEG__ Chr5 {Monodelphis domestica} MACNKNGTEVNEFVFVGLTDIPELQILLFIIFILIYLFTLIGNLGLVALIWVASTLHTPMYFFLSGLSLVDLGSSSAIIPKVIAGIITGDKTISYNSCASQMYFFVSFAT
VENYLLAAMAYDRHVAICKPLHYSTIMTSRMCVALTIGCYFCGFLNSSIHIGFIFSLSFCSCNVVNHFFCDVPPIITLSCSDIRFTELLVCIMGAFNMAFSIFVIVTSYL
SIFIAILRIRSTEGHQKAFFTCASHIFAVSLFYGATIFMYLQPSSVHSMDTDKMASVFYTMIIPMLNPLVYSLRNKDVKNAFRKAIRRKNH*
716 >lcl|XP_001376949.1|Plus152841599..52842642 NW_001581989 G-protein coupled receptor 183-like LOC100026279 __SEG__ Chr7 {Monodelphis domestica} MASSLVNQSNFPLNDSVCSIHHPSSVTRVALLLFYSVLLVISSFGNILAIYIASQKKKMNSTDLYLINLAVSDILFTLALPGRIAYYILDFNWPFGDWLCRVIAFVFYVN
TYGSVYLMTCISIDRYIAVIHTHQNHKFRHAGWAKYICITVWSLASLQTMPVLFMPLTKKMGDKLSCMEYASIEKILSLPLLLLGGCVLGFFGPVGIILFCYVKITLKLC
RIAQENSVMCKSDHQKKACLVILLVLMAVIICFSPYHFNISQFVIRELFSQSTCAEKKAFKVSLQVTVCFMNMNCCVDPIIYFFASQGYKKQFLRIFKPRISTAFSSTAK
TSSEINSNNHGADSVLG*
717 >lcl|XP_001376956.2|Plus1complement(21615095..21616030) NW_001581971 olfactory receptor 5B12-like LOC100026294 __SEG__ Chr5 {Monodelphis domestica} MACIENSTEVNEFILVGLTDIPELQVFLCIIFLLIYLFTLIGNLGLVALILEDSSLHTPMYIFLSGLSLIDLGASTTIIPKVIAGILTRDKTISYNSCATQMFFFANFAT
IENFLLASMAYDRYVAVCKPLHYSTIMTSKMCFGLIIGSYFCGLLNASIHIGFIFSLSFCGSNVVNHFFCDIPPILTLSCSDIHFTELLVCIIGAFNMSFAILVIVTSYL
SIFIAILRIRSTEGRQKAFFTCASHIFAVFLFFGATIYMYLQPSSVHSMDTDKMASVFYTMIIPMLNPLVYSLRNKDVKNAFRKATRGKNH*
718 >lcl|XP_001376966.2|Plus1complement(21639902..21640879) NW_001581971 olfactory receptor 5B12-like LOC100026316 __SEG__ Chr5 {Monodelphis domestica} MENDSEVNEFIFLGLTDAPELQIPLFLIFTLIYIITLVGNLGMVALIFWDSHLHTPMYFFLCNLSLVDFGYSSAITPKVMVGLLTGDKVITYNGCATQLFFFATFTTVES
FFLASMAYDRHVAVCKPLYYTMTMTSGVCIRLAVGSYICGFLTSSVSVGDTFSLSFCSSNIIHHFFCDIPPLLALSCSDIHINEWVLFILGGFNISFALMVIFTSYLFVL
IAILRIRSVEGRKKAFSTCASHLTAVSIFYGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPLVYTLRNKEVKNAFQKSISSSFLGITSLLFPTGHHVSQSS*
719 >lcl|XP_001376981.2|Plus1complement(21657359..21658315) NW_001581971 olfactory receptor 5B2-like LOC100026335 __SEG__ Chr5 {Monodelphis domestica} MTFMENLSEVNEFILVGLTDAPELQIPLFIMFTLIYLITLVGNLGIIVLISSDSHLHTPMYFFLSNLSLVDFGYSSAVTPKVMVGLLTGDKVISYNGCATQIFFFVSFAT
VESFLLASMSYDRHAAVCKPLHYTTTMTSTVCAHLASGAYICGFLNSSIVTGDTFSLSFCRSNVVHHFFCDIPPLLVITCSDIHSTEIVIFILGIFTVFFPFLVILTSYL
FIFIAILRIHSAEGCQKAFSTCTSHLTAVSIFYGTIIFMYFQPSSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKTAFQKVVRRQRLQLDHSLS*
720 >lcl|XP_001376997.2|Plus1complement(21672057..21673013) NW_001581971 olfactory receptor 5B12-like LOC100026354 __SEG__ Chr5 {Monodelphis domestica} MASMENKSEMNEFILVGLTDVPELQVPLFLMVTLIYLITLVGNLGIVALISWDSRLHTPMYFFLSNLSLVDFGYSSAVTPKVMAGLLTGDKVISYNGCAAQLFFFGAFAT
TESFLLASMAYDRHAAVCKPLHYTTTMTSTVCAYLLSGAYICGFLNSSIVTGNTFSLSFCRSNVVHHFFCDLPPLLVLSCSDIHIIELVIFISGLLSAFFPFLVIFTSYL
FIFITILKIRSAEGFQKAFSTCASHLTAVFIFYGTIIFMYFQPSSSHSMDSDKMVSVFYTMVIPMLNPLIYSLRNKEVKNAFRKAVRGQWLQLDYPFP*
721 >lcl|XP_001377034.2|Plus1complement(21751336..21752292) NW_001581971 olfactory receptor 5B12-like LOC100026408 __SEG__ Chr5 {Monodelphis domestica} MISTENSSEVNEFILIGLTDAPELQIPLFIIFILIYLITLVGNLGIIALISWDSSLHTPMYFFLSNLSLVDFGYSSTITPKVMTGLLTGDKAISHNGCATQLFFFGAFAT
IESFLLGSMAYDRYAAVCRPLHYTTTMTSTVCAYLVSGSYICGFLTSSIVIGNIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHIIESIIFILGSFNAIFPFFVIFTSYL
FIFITILKIHSAEGRQKAFSTCASHLTAVSIFYGTCTFMYFRRNSIHSMDSDKIVSVFYSMVIPMLNPLVYSLRNKDVKNSFRKAMRGQQLYLDHLFS*
722 >lcl|XP_001377049.2|Plus1complement(21775141..21776097) NW_001581971 olfactory receptor 5B12-like LOC100026427 __SEG__ Chr5 {Monodelphis domestica} MISMENSSEVNQFILIGLTDASELQIPLFIIFVLIYLITLVGNLGIVALISWDSCLHTPMYFFLSNLSLVDFGYSSAITPKVMTGLLTGDKAISHNGCATQLFFFGAFVI
IESFLLASMAYDRHAAVCRPLHYTTTMTSTVCAYLVSGSYICGFLTSSIVIGNIFTLSFCRSNVVHHFFCDIPPLLVLSCSEIHIIESIIFILGSFNAFFPFLVIFTSYL
FIFITILKIRSAEGRQKAFSTCASHLTAVSIFYGTCTFMYFRPSSSHSMDSDKIVSVFYSMVIPMLNPLVYSLRNKDVKNAFRKAMRGQQLYLDHLFS*
723 >lcl|XP_001377062.2|Plus1complement(21793605..21794549) NW_001581971 olfactory receptor 5B12-like LOC100026445 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNEFILIGLTDDPWLQIPLFIMVTLFYLITLVGNLGIVTLISWDSCLHTPMYFFLRKLSLVDLSLSSTVIPKVMTGLLTGDKAISYNGCATQLFFFGAFAAIES
YILAFMAYDRHAAVCRPLHYTTIMTSKMCTYMTTGAYIWGFLTSFIFVENVFSLSFCRSNVIHHFFCDSPPLLVLSCSEIHTTESIIFIFGSLNASFPFLVIFFSYLFIF
ITILKIRSADGRQKAFSTCASHLTAVFIFYGAIIFMYFRPSSSHSMDSDKMASVFYTMVIPMLNPLIYSLRNKEVKNAFRKAVRGQRLQFDQPF*
724 >lcl|XP_001377068.2|Plus1complement(21815924..21816871) NW_001581971 olfactory receptor 5B12-like LOC100026459 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNEFILIGLTDDPWLQIPLFIMVTLIYLITLVGNLGIVTLISWDSCLHTPMYFFLRNLSLVDFGLSSTVIPKVMTGLLTGDKVISYNGCATQLFFFVAFANIES
LLLGFMAYDRHAAVCRPLHYTTIMTSRMCTYIASGAHIWAFLTSTIFIENVFSLSFCRSNVIHHYFCDIPPLLVLSCSEIHITESMIFIFGSLNASFPFLVIFFSYLFIF
ITVLKIRSADGRQKAFSTCASHLTAVFLFYGTSIFMYFFPSSSHSMDSDKMVSVFYTMIIPMLNPLIYSLRNKEVKNSFKKAVKGQRLQLDHTFN*
725 >lcl|XP_001377076.2|Plus1complement(21835098..21836045) NW_001581971 olfactory receptor 5B12-like LOC100026475 __SEG__ Chr5 {Monodelphis domestica} MGNTSEVNAFIFVGLTDVPMLQVPLFIMVTLIYLITLVGNLGIVAVISHDSCLHTPMYFFLRNLSLVDFGLSSTVIPKVMTGLLTGDKVISYNGCATQLFFFLAFANIES
LLLAFMAYDRHAAVCRPLHYTTTMTSKVCVYLASGAHIWGFLTSSIFTGNIFSLSFCRSYVVHHFFCDIPPLLILSCTEIHTTESIIFTFGSFNASFSFLVIFFSYLLIF
ITILKIRSNDGRQKAFSTCASHLTAVFIFYGTSTFMYFQPSSSHSMDSDKMVSVFYTMVIPMLNPLIYSLRNKEVKNAFRKAVRGQSLQFDHPFN*
726 >lcl|XP_001377081.2|Plus142002888..42003961 NW_001581859 prolactin-releasing peptide receptor-like LOC100026484 __SEG__ Chr1 {Monodelphis domestica} MTPDNLTSQSLLSALHPRNASPQFAGLQFVQSFKPLIIPGYSLVVSVGVVGNYLLIYVICRTRRMHNVTNFLVGNLAFSDILMCATCVPLTLAYTFEPRGWVYGRFLCYF
VFLMQPVTVSVSVFTLTVIAVDRYHATAHPLRRRRLSVPACAGVLAAIWLLSCALAAPALLHTYHADFPELHFAICEEFWFHRERDRLAYAYSTLLLTYVLPLGVISVSY
LRISMRLRNRVLPGNATSQQQAEWDRARRRKTFRLLVLVVAAFGACWLPLHIFNLVKDLDISLIDKRYFNLLQLLCHWLAMTSACTNAFLYAWLHDSFRCELKKMFCWKR
WWRRRRRTTRVQPVDGPPACPLATVVL*
727 >lcl|XP_001377088.2|Plus1complement(21851537..21852481) NW_001581971 olfactory receptor 5B2-like LOC100026494 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNVFIFTGLTDDPELYIPLFIMVTLIYLITLVGNLGIVALISWDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTRDMVISYNGCATQLFFFGGFAAIES
YMLAFMAYDRHAAVCRPLHYTTIMTSKIGAYMASGGYIWGFLSSSIFIGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHITESIIFIIGSLNVSLPFLIIFFSYLFIF
ITVLKIHSANGRQKAFSTCASHLTAVFIFYGTVIFMYFRPSSSHSMDSDKMVSLFYTTVIPMLNPIIYSLRNKEVKNAFRKAVRGQRLQFDQPF*
728 >lcl|XP_001377102.2|Plus1complement(21888501..21889454) NW_001581971 olfactory receptor 5B2-like LOC100026523 __SEG__ Chr5 {Monodelphis domestica} MTFMENTSEVNEFILTGLTDDPGLYIPLFIMFTLIYLITLVGNLGIVALISWDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNGCATQMFFFGGFAA
IESYILAFMAYDRHAAVCRPLHYNTIMTSKMCAYMISGGHIWGLMSSSIFIGSIFSLSFCRSNVVHHFFCDSPPLLVLSCSEIHITESILFILGSLNISFPFLVIFFSYL
FIFITVLKIHSADGRQKAFSTCASHLTAVFIFYGTIIFMYFRPTSTHSMDSDKMASVFYTMVIPMLNPIIYSLRNKEVKNSFRKAMRGQQLQFDHSF*
729 >lcl|XP_001377126.2|Plus1complement(21909774..21910718) NW_001581971 olfactory receptor 5B2-like LOC100026565 __SEG__ Chr5 {Monodelphis domestica} MGNRSAVNEFILVGLTDAPGLQVLFFIMVTLIYLIILAGNLGIVALISHDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYDGCATQLFFFVAFAAIES
FLLAFMAYDRHAAVCRPLHYASTMTSKMYVFLASGAHIWGVLTASIFIGSIFSLSFCRSNIVHHFLCDIPPLLVLSCSEIHITESIIFILGSLNGSFTFLVIFVSYLFIF
ITVLKIRSADGRQKAFSTCASHLTAVFIFYGTCTFMYFRPSSSHSMDSDKMVSVFYTMVIPMLNPLIYSLRNKDVKNSFRKVMRRQQLQFDHPF*
730 >lcl|XP_001377128.1|Plus1complement(16174468..16175202) NW_001581841 beta-chimaerin-like LOC100026568 __SEG__ Chr1 {Monodelphis domestica} MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADQLLGGAEGAYILRESQRQPGCYTLALRFGNQTLNYRLFYN
GKHFVGEKRFESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKASVTSEEHHPAVEKISSLVRRAALAQNDNHCNYEKTHNFKE
PTLLNPSNRIIVRLHPSTLSKGKA*
731 >lcl|XP_001377137.2|Plus1complement(21937699..21938643) NW_001581971 olfactory receptor 5B2-like LOC100026580 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNVFILTGLTDDPGLYIPLFIMVTLIYLITLIGNLGLVALISWDSCLHTPMYFSLRNLSLVDFGLSSTIIPKVMAGLLTGDMVISYNGCATQLFFLGGFATIES
YMLAFMAYDRHAAVCRPLHYNTIMTSKMCAYVISGGHIWGFLSSSIFIGSIFSLSFCRSNVVNHFFCDSPPLLILSCSEIHITESIIFILGSLNISLPFLVIFFSYLFIF
ITVLKIHSANGRQKAFSTCASHLTAVFIFYGTIIFMYFRPSSSHSMDSDKMASVFYTMVIPMLNPLIYSLRNKEVKNSFRKAMRGHQLQFDHPF*
732 >lcl|XP_001377140.2|Plus1complement(61725227..61726864) NW_001581835 probable G-protein coupled receptor 135-like LOC100026586 __SEG__ Chr1 {Monodelphis domestica} MVWSPQSPMEEEPPPPTPTPPPPSSSRMALLSNLTSLGVARGGGNLRPEEALGSGASAGVGRGASFHAAVISFTTVAAVAAEARASRGGGGGSGLAGAEKAGTGSTIHSN
SSIPSSGSIHISSIPSGDPVPAGAGAKRLLLEPWVAVAVQALVLLLIFLLSSLGNCAVMGVIVKHRQLRTVTNAFILSLSLSDLLTALLCLPAAFLALFTRPGGGSNGPP
IARPWQRFCTASRFFGSCFGIVSILTMTLISLDRYYAIVRHPGEKIGWHRALQFLVAVWLVAVGISFPWDLIWDFKGNWDGDAQVGSRQSFHRCLYVSYPSRLGPTYNIW
LIVTCYLFPFGIMCFCLCRICRTVRLSEIRVRPVTTNAHLVRFYSEMRTATTVLIMIIFIIICWGPYCLLVLFTSAAGAMDAQRPPFHPGLDTAVIWMTWANGAINPLIY
AVRNPNIYILLRHKREEGYRTRNVATYLSSHRRNLESRSFANRLRERYAHRLGVCGRMSSSSNGEGGGDVAMWACRNPALLFCRDGLPDTASEVAMQSKTADTSL*
733 >lcl|XP_001377156.2|Plus1complement(21973046..21973990) NW_001581971 olfactory receptor 5B2-like LOC100026607 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNAFILTGLTEDPGLYIPLFIMFTLIYLITLVGNLGIVALISWDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNGCATQMFFFASFAGIES
FLLAFMAYDRHAAVCRPLHYTTIMTSKMCAYMVSGGHFWGFLSSSIIIGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSETHITESIIFILGSLNVSFIFLVIFFSYLFIF
ITVLKIRSADGRQKAFSTCASHLTAVFIFYGTVTFMYFQPSSSHSMDSDKMVSLFYTTVIPMLNPIIYSLRNKEVKNAFRKAMKGQRLQFDHPF*
734 >lcl|XP_001377169.2|Plus1complement(22006012..22006965) NW_001581971 olfactory receptor 5B12-like LOC100026624 __SEG__ Chr5 {Monodelphis domestica} MTFIENTSEVNAFILTGLTDDPGLHIPLFIMFTIIYLITLIGNLGMVALISWDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMIISYNGCATQVFFFAGFTG
IESFLLAFMAYDRHAAVCRPLHYTTIMTSKMCAYMLTGGHIWGFLSSTIFIENVFSLSFCRSNVIHHFFCDIPPLLVLSCSEIHITESIIFIFGSLNVSFPFLVIFFSYL
FIFITVLKIRSAGGCQKAFSTCASHLTAVFIFYGTIIFMYFRPTSTHSMDSDKIVSVFYTMIIPMLNPIIYSLRNKEVKNAFRKAVKERRLQFHHPF*
735 >lcl|XP_001377171.2|Plus1complement(45056947..45058059) NW_001581981 chemokine-binding protein 2-like LOC100026626 __SEG__ Chr6 {Monodelphis domestica} MAATFPPASSAPTSLENTSLYDYYYFENFPDTVCRKEAILSFGQVFLPIFYSLVFVLGLGGNLFFLIVLLYSARSRRVTEIYLLNLVVSNLLFTITLPFWGVSAAWHWGF
GEVLCKIICTLYTTSLYGSIFFLGCMSLDKYLDVVHAQTHHRQWTSAKSRLLTGGVWTVALVLSIPDLVFARLQEGPSGRQNCHLDFGENGPVWKLVLRFQQSALGFILP
LFTMAFFYTRIVCVLTVLRPRGRSRALWRAALLVVTFFALWGPYNITLFLHSLQDLQVLESCEVSKHLDYALQVTESIAFLHSCLSPFLYLFVHHRLKKHLKKVLEVIFK
RCRESAAHPSQASYSNSYSTDQEEMTSTGNLEQSLQDHRI*
736 >lcl|XP_001377185.1|Plus1complement(14459816..14460718) NW_001581956 OTU domain-containing protein 6B-like LOC100026646 __SEG__ Chr4 {Monodelphis domestica} MESVTAEELPEEEEEEEQEQLLKRHRKEKKELQAKIQSMKNAVPKNDKKRRKQLIEDVAKLEGEMEQKHREELEHLKLTSHAKNKIDSVVVNIACLDIENQQPRISKAQK
RREKKAALEKEREERIAEAEIENLSGARHLENQKLARILAARHLEIKQIPSDGHCMYRAIEDQLKEQECLLTVATLRSQTAEYMQNHVEDFLPFLTNPNTGDIYTPEEFG
KYCDDIVNTAAWGGQLELRALSHILQTPIEVIQADSPPIVVGEEYSNKPLTLIYMRHAYGLGEHYNSVKQLMDSATENGS*
737 >lcl|XP_001377188.2|Plus1complement(22041765..22042709) NW_001581971 olfactory receptor 5B2-like LOC100026650 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNAFILTGLTDDPGLYIPLFIMFTIIYLITLIGNLGIVALISRDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNGCATQLFFFASFAAIEC
YILAFMAYDRHAAVCRPLHYTTIMTSKMYAYMVSGGHFWGFMSSSIFTGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHITESIIFILGSLNVFFPFLVIFFSYLFIF
LTVLKIRSNDGRKKAFSTCTSHLTAVFIFYGTIMFMYFRPSSSHSMDSDKMVSVFYTMIIPMLNPIIYSLRNKDVKNAFRKAVRGQRLQFDHPF*
738 >lcl|XP_001377205.2|Plus1complement(22091136..22092080) NW_001581971 olfactory receptor 5B2-like LOC100026671 __SEG__ Chr5 {Monodelphis domestica} MENTSEVNAFILTGLTDDPGLCIPLFIMFTLIYLITLVGNLGIVALISWDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNGCATQLFFFAGFAAIEF
YVLAFMAYDRHAAVCRPLHYTTIMTSKMYAYMVSGGHFWGFLSSSIFTGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHITESINFILGSLNVFFPFLVIFFSYLFIF
LTVLKIRSNDGRQKAFSTCASHLTAVFIFYGTIIFMYFRPSSSHSMDSDKMVSVFYTMVIPMLNPLIYSLRNKEVKNSFRKALRGQQLRFDHPF*
739 >lcl|XP_001377218.2|Plus1complement(22118824..22119777) NW_001581971 olfactory receptor 5B2-like LOC100026694 __SEG__ Chr5 {Monodelphis domestica} MTFMENMSEVNAFILTGLTDDPGLHIPLFIIFTLIYLITLVGNLGIVALISHDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNACATQLFFFGGFAA
IEFYVLAFMAYDRHAAVCRPLHYTTIMTSKMYAYMVSGGHIWGFLSSSIFIGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHITESIIFVIASLNVYFPFLVIFFSYL
FIFITVLKIRSNDGRKKAFSTCASHLTAVSVFYGTIIFMYFRPSSSHSMDSDKIVSVFYTMVIPMLNPIIYSLRNKEVKNAFRKAVRGQWLQFHHLL*
740 >lcl|XP_001377235.2|Plus1complement(22186630..22187574) NW_001581971 olfactory receptor 5B2-like LOC100026715 __SEG__ Chr5 {Monodelphis domestica} MENRSEVNSFILLGLTEAPGFQGPLFIMVTLIYLITLVGNLGMVALISHDSCLHTPMYFFLRNLSVVDFGLSSTIIPKVMTGFLTGNKVISYNGCATQLFFFVAFVAIEG
FLLAFMAYDRHAAVCQPLHYATIMTPKMYVNLACGSHIWGFLYSSIIIGSIFSLSFCRSNIVHHFFCDIPPLLVLSCSEIHITESIIFILGSLNASFTFLVIFVSYLFIF
ITVLKIRSADGRQKAFSTCASHLTAVFIFYGTIIFIYFRPSSSHSMDSDKMASVFYTMVIPMLNPLIYSLRNKEVKNAFRKAMRRQRLQFDHPF*
741 >lcl|XP_001377243.2|Plus140929374..40931803 NW_001581837 protocadherin alpha-8-like LOC100026726 __SEG__ Chr1 {Monodelphis domestica} MFFSRVGGLGSRHLLFSFMLCTACEVGSSQVHYSVLEEAKHGTFVGRIAQDLGLEVGELVSKLFQVVSKGRRDYLEVNGQNGVLFVNSRIDREELCGRSLVCSIHLEVIV
DKPLQVFHVEVDIKDINDNPPVFPVKEQKLFISESRLPDSRFPLEGASDPDIGTNALLTYSLSTNDYFILDVKSKNEQDKLVELVLRKPLDREEVPEHHLILTVTDGGKP
ELTGTVQLLITVLDVNDNAPTFERSEYEVKILENAARGTLVIQLNASDADEGINGEIVYSFNSLASPLINDKFQINPDTGEISIQRYLDFEDINSYKFRVDATDKGNPPM
VGHCTIRVDVEDTNDNAPELSVTSLSLPVREDAPPGTVIALISVSDRDSGANGLVTCFLSPPSPFTLVSTFRNYYSLVLEGSVDRESMSVYELVVTARDGGSPALWTSAS
VMVGIADVNDNAPAFEQTSYTLFVKENNPPGSHIFTVSASDPDAEENALVSYSLVERQVGERPLSSYVSVHLESGKVYVLQPLDHEEIELLQFQVSARDSGVPSLSSNVS
LQVFVLDENDNPPVVLPPHSGVSPVTELVSQSVAVGHVVAKIRAVDADSGYNAWLSYELLPEVSVGHRPFRVGLYTGEISTTRTLDESDGPRQTLLVLVKDHGEPTLKAT
ATVTMSLAAIGQTFQGSSVTSRDFEKSGVGQKVLMNVNVYLIIAICSVSSLLVLSLLLYVAIRCSSPSQSFCGPGKSTPVCSNTVRSWSYSHQQRQKICSGEGPAKNDLM
AFSPNLPPCPSSQVAEQAEHMQNVGKVSINFYLCGHFLC*
742 >lcl|XP_001377254.2|Plus1complement(22201482..22202429) NW_001581971 olfactory receptor 5B12-like LOC100026738 __SEG__ Chr5 {Monodelphis domestica} MENISEVNEFILTGLTDDPELHIPIFIMVTLIYLITLVGNLGMVALISHDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNGCATQLFFFGGFAATES
YILAFMAYDRHAAVCRPLHYTTIMTSKMCAYMLSGGHIWGFLSSSIFIGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHITESIIFIFGSLNGSFPFLVIFFSYLFIF
ITVLKIRSADGRQKAFSTCASHLTAVFIFYGTIIFMYFRPSSSHSMDSDKIVSLFYTTVIPMLNPIIYSLRNKEVKNAFRKAVRGQRLQFDHPFN*
743 >lcl|XP_001377255.1|Plus140945806..40948220 NW_001581837 protocadherin alpha-3-like LOC100026744 __SEG__ Chr1 {Monodelphis domestica} MGFSQRGGLRLLQLSHWLLLFTFCEVGSGQVHYSVTEEAKHGTFVGRIAQDLGLEVGELVSRLFRVVSTNRRDYLEVNAQNGILFVNSRIDREELCDRNPVCGIHLEVIV
DKPLQVFHVEVEIKDINDNPPTFSLREKNLFIPESRVLDSLFPLEGASDADIGVNSVLTYRLSPNDYFTLDMQINDEQIKPLGLVLKKLLDREETPELHLLLTATDGGKP
ELTGTVQLQITVLDANDNAPKFDKKIYKVKLAENSLNGTLVIKLTASDMDEGTNSQIIYSFARDVSSNVLSKFSIDQMNGDVRVIGQIDFEESKSYQIQVEATDKGIPKM
VGHCTVLVEVMDTNDNVPEVAVKSLSLPVPEDSPTGTVIALISVSDKDSGTNGQVTCSLSPPGPFTLVSTFRNYYSLVLGSPVDRESVPVYELVVTARDGGSPTLWATAS
VSVAIADVNDNAPAFEQPSYTVFVKENNSPGSHIFTVSASDPDALENAIVSYSLVEKRVGERSLSSYVSVHSESGKVYALQPLDHEDLELLQFQVSVRDAGFPPLGSNVS
LQVFVLDENDNAPAVLPPHSGVNPMAELVSQSVNVGHVVAKIRAVDADSGYNAWLSYELLPEVGVERRPFRVGLYTGEISTTRVLEELDGPRQRLLVLVKDHGEPPLSAT
ATVSISLVDSGKALKASSGVSRSMASAGKVAAALDLNVYLIIAICSVSSLLVLSLLLYVVLRCSEPSQAVYGPGKPMLVCSSEVGSWSYSQQRRQKAFSGEGGAKSDLMA
FSPNLPPCSGPADSVQQQAMGQDHSAKVGFRNSY*
744 >lcl|XP_001377261.2|Plus1complement(22224275..22225219) NW_001581971 olfactory receptor 5B12-like LOC100026754 __SEG__ Chr5 {Monodelphis domestica} MENRSEVNEFILVGLTDAPVLQVLFFIMVTLIYLIILVGNLGIVALISRDSCLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGDMVISYNACATQMFFFVAFAAIES
FLLAFMAYDRHAAVCRPLHYTTIMTSKMCAYMLSGGHIWGFLSSSIVIGSIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHITESIVFILGSLNGSLSFLIIFFSYLLIF
NTVLKIRSADGRQKAFSTCASHLTAVFIFYGTCTFMYFRPTSSHSMDSDKMVSVFYTMVIPMLNPLIYSLRNKEVKNAFRKAMRRQRLQFDHPF*
745 >lcl|XP_001377274.2|Plus1complement(22246943..22247890) NW_001581971 olfactory receptor 5B2-like LOC100026770 __SEG__ Chr5 {Monodelphis domestica} MDNRSEVNTFILLGLIETPVFQVPLFIMVTLIYLITLVGNLGMVALISHDSCLHSPMYFFLRNLSLVDFGLSSTIIPKVITGLLTGNKFISYNGCTTQLFFFMTFATIES
FLLGIMAYDRHAAVCRPLYYTTIMTSKICVYLVSGAHIWGFLTSTIIIGNVFSLSFCRSNVIHHFYCDIPPLLVLSCSEIHMTETVVFIIGSLNASFPFLVIFFSYLLIF
ITVLKIRSADGRQKAFSTCASHLTAVFIFYGTVTFMYFQPSSSHSMDSDKMVSVFYTMIIPMLNPLIYSLRNKEVKNAFRKAMKRQCLQFDHPIN*
746 >lcl|XP_001377277.1|Plus140959947..40962379 NW_001581837 protocadherin alpha-8-like LOC100026777 __SEG__ Chr1 {Monodelphis domestica} MMFSQGGILGAQQLLLSLLLHTAWEVGSGQVHYSVLEETKHGTFVGRIAQDLGLEVGELVSKLFRVVSKGRRDYLEVNVQNGILFVNSRIDREELCGRSPVCSIHLELIV
DKPLQVFHVEVEIKDINDNAPSFPVKKQKLFISESRMPDARFPLEGASDLDTGTNALLTYRLSANDNFILEVKSKNDQNKLVELVLKKPLDREEVSEYHLILTATDGGKP
ELSGTLQVLITVLDVNDNAPTFDRSEYEVKILENAASGTLVIKLNASDADEGINREIVYSFNSPASPLINDKFYVNSETGEISIQGHLDFEDVNLYEIRIDATDKGSPPM
VGHCTVLVEVLDANDNIPDVVVTSLSLPVREDAPSGTVIALIGVSDRDSGANGLVTCSLSPPGPFTLVSTFRNYYSLVLEGSVDRESVPAYELVVTARDGGLPALWATAS
VSVVIGDVNDNAPAFEQSLYTVFVKENNPPGSHIFTVSASDPDAQENALVSYSLVERRVGERPLSSYVSVHSESGKVYALQPLDHEELELLHFQVNARDAGFPALGSNVS
LQVFVLDENDNSPVVLAPHSSGVPVTELVSQSVAAGHVVAKIRAVDADSGYNAWLSYELQPELGVGRSPFRVGLYTGEISLTRALEESDGPRQTLLVLVKDHGEPVLSTT
ATVCVSVVESGQKSNTFSGESRISGKSGVGKETALVDVNIYLIIAICSVSSLLVLSVLLYVALRCSAPPQASYGPGKPTLVCSNEMGSWSYSQQRRQICSGEGAGKNDLM
AFSPNLPPCPISGERGQKQEALLDSSEKVGDYWFLIFYFV*
747 >lcl|XP_001377278.2|Plus118112745..18113647 NW_001581841 protein phosphatase 1 regulatory subunit 3D-like LOC100026778 __SEG__ Chr1 {Monodelphis domestica} MSKGPGSLVMAPSPCLRQSLSRTAPRSVSSLTDLDRGMSQEPRPSKPFSAPGPQGHQQQSGPSSCDPCLRPIIHRRARSLPSSPERRKKVSGTAGSQCRPGCSRQNRVRF
ADALGLELTQVKVFNAGEDPSIPLHVLSRLSINSDLCCSSQDLEFTLQCLVPDFPQPVDCSDFSTRLQNQRVSLERVTSSDLGLSGTIRVLNVAFEKQVTVRYTYNSWRT
QQEVGTRWRSSAGDSDVFTFCFPVPPYLLGLNSEVQFAIRYRVGGDEYWDNNEGQNYSLRCQTHPLKMPQECEESWIHFI*
748 >lcl|XP_001377286.2|Plus1complement(22260591..22261535) NW_001581971 olfactory receptor 5B2-like LOC100026786 __SEG__ Chr5 {Monodelphis domestica} MDNRSEVNAFILLGLTEAPVFQVPLFIMVTLIYLITLVGNLGMVALISHDSYLHTPMYFFLRNLSLVDFGLSSTIIPKVMTGLLTGNKIISYNGCATQLFFFVTFATIES
LLLAFMAYDRHAAVCRPLHYTTIMTSKICVYLVSGAHIWGFLTSAIFIGNIFSLSFCRSNVVHHFFCDIPPLLVLSCSEIHTTETVVFIFGSLNASFPFLIIFFSYLLIF
ITVLKIRSADGRQKAFSTCGSHLTAVFLFYGTITFMYFQPSSSHSMDSDKMVSVFYTMIIPMLNPLIYSLRNKEVKNAFRKAMMGQRLQFGHSF*
749 >lcl|XP_001377288.1|Plus155925231..55926244 NW_001581989 2-oxoglutarate receptor 1-like LOC100026790 __SEG__ Chr7 {Monodelphis domestica} MNKELNNLSNTSDTHNYPAAFGNCTDEKILFKKHYLPIIYSIIFLVSFPGNALAISTYIFKMRPWRSSTIIMLNLACTDLLYLTSLPFLIHYYANDEDWIFGDFMCKFIR
FGFHFNLYSSILFLTCFSIFRYFVIIHPMSCFSIHKTRWAVVACTAVWITALVVVVPMSSLITSAQRKNRSSCLDLTSSDDLTTIKWYNVILTVLTFCLPLVVVTICYMM
IIYNLAQGPHTRSSQKQKARRLAILLLVVFYICFLPFHILRVVRIESRLLLISCHLENQIHVAYILSRPLAALNTFGNLLLYAVIGDNFQQAICSLVRCKPNGDPQETGK
SSSVNNP*
750 >lcl|XP_001377291.1|Plus140968216..40970621 NW_001581837 protocadherin alpha-7-like LOC100026799 __SEG__ Chr1 {Monodelphis domestica} MEFSGQDGLRLFQWLLLYSAWEIGSGQIHYSVPEEAKHGTFVGRIAQDLGLEVGELVSRLFRVVSPDRRDYLDVNLQNGILFVNSRIDREELCPHSPVCSIHLEVIVDKP
LQVFHVEVEIKDINDNPPVFSVTQKNLFISESSPLDSRFPLEGAADADIGVNAVLSYKLSPNDFFTLDLQNNDEQIKPLGLVLKQLLDREEIPELHLLLTATDGGKAELT
GTVQLQIIVLDVNDNAPKFDKKLYKVRLAENSLNGTMVLKVTASDMDEETNGQIIYSFAREVPLNVLSKFAIDPMDGDVRVIGHIDFEESKSYQIQVEATDQGIPKMVGH
CTILVEVMDTNDNAPEVTVKSLSLPVPEDSPSGTVIALVSVSDRDSGANGLVTCSLSPSGPFTLVSTFRNYYSLVLEGSVDRESVPAYELVVTARDGGSPALWATASVSV
AIADVNDNAPAFEKPVYTVFVKENNPPGCHIFTVSASDPDVQENSLVSYSLVERRVGERQLSSYVSVHSESGKVYALQPLDHEELELLQFQVSARDAGFPPLGSNVSLQV
FVLDENDNAPVVLPSHAGVSPMTELVSQSVAVGHVVAKIRAVDADSGYNAWLSYELLPEVSVGRRPFRVGLYTGEISTTLVLEELDGPRQMLLVVVKDHGEPPLSATATV
SISLVDSGKALKASSGVSRSVASAGKAAMALDVNVYLIIAICSVSSLLVLSLLLYVALRCSAPPQGVCGPGKPALVCSSEIGSWSYSQQRRQKVCSGEGGVKSDLMAFSP
NLPPCSGPVDSAEQEAVGQDNSGKVGFRDYY*
751 >lcl|XP_001377310.1|Plus1complement(71476295..71477596) NW_001581879 probable G-protein coupled receptor 63 GPR63 __SEG__ Chr2 {Monodelphis domestica} MSWVGHSILLNQIMVLSAVLTAAHPGTANTTFVIYENAYINFTTPPSVLYGGVDSPLRHGVDPTSTTTETSSLTANSTSASSTSEAFKSLSLPLQIILSAIMIFILLVSF
LGNFVVCLMVYQKAAMRSAINILLASLAFADMLLAVLNMPFALVTILTTQWIFGKVFCRVSAMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKMLIAVSWATS
FCVAFPLAVGNPDLQIPSRAPQCVFGYTTNPGYQAYVILVVLISFFIPFLMMLYSFMGILNTVRHNAVRIHSYPEGICLSQASKLGLMSLQRPFQMSIDMSFKTRAFTTI
LILFVVFIVCWAPFTTYSLVATFDSHFYYKHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDLMPKSFKFLPQLPGHTKRRIRPSAVYVCAEHRTVV*
752 >lcl|XP_001377316.2|Plus1complement(22304981..22305937) NW_001581971 olfactory receptor 5B12-like LOC100026829 __SEG__ Chr5 {Monodelphis domestica} MTSMENRSEVNEFILIGLTDAPELQIPLFIMITLIYLITLVGNLGIIALISLDPCLHTPMYFFLSNLSLVDFGYSSAVTPKVISGLLTGNKVISYNGCATQLFFAAAFAA
TEIFLLASMAYDRHAAVCKPLHYTTTMTSAVCAYLASGSHICGFLASCIIIGNTFSLSFCRSNVVHHFFCDLPALLPLSCSDIHITESVILIFGPLTAIFPFIVISTSYL
LIFITILKIHSVEGRQKAFSTCASHLTAVSIFYGTIIFMYFRPSSSHSMDSDKMASVFYSMVIPMLNPLVYSLRNKEVKNAFRKAMRGQWFKLDHSFP*
753 >lcl|XP_001377321.1|Plus140984797..40987268 NW_001581837 protocadherin alpha-7-like LOC100026837 __SEG__ Chr1 {Monodelphis domestica} MLFSERRGLVTWQLLLSFIIYTAWRVGNCQVHYSVPEEAKHGTFVGRIAQDLGLEVGELVPRLFRVGSKGRRDYLEVNVQNGILFVNSRIDREELCGRSPVCSIHLEVIV
DKPLQVFHVEVEIKDINDNPPVFSVTQKNLIIAESRLLDSQFPLEGASDADIGANALLTYRLSPNENFILDIKNNEEEIKLVLKKHLDREETPELHLLLTVTDGGKPELS
GTVQLLITVLDVNDNAPEFDKTVYKVKLEENAANGTPVIQLNATDLDEGSNSQITYSFTSDIFPDVEAKFHIDPVSGIIKVKGYVDFEEIKLYKIQVEATDKGVPHLAGH
CRVLVEILDINDNTPEIVVTSLSLPVREDAPPGTVIALISVSDRDSGPNGQVTCSLLPEGPFKLVSTFKNYYSLVLEGPIDRESVSAYELVVTARDSGLPALRSAAKVSV
GIGDVNDNAPAFEQPVYTVFVKENNPPGCLIFTVSASDSDSQENALVSYSLVERRVGERLLSSYVSVHSESGKVYALQPLDHEELELLQFQVSARDAGFPPLGSNVSLQV
FVLDENDNAPSVLPSHVGSGASGGPVNELVSQSVAVGHVVAKIRAVDGDSGYNAWLSYELLPKMGIGRNPFRVGLYTGEISTTRDLEESDSGKQTLLVLVKDHGEPMLSA
TATVIVSIVESGLSSKTFSGASKSATSTGSRKETILVDVNVYLIIAICSVSSLLVLSLLLYVSLRCAAPQRAVYGNGNPTMVCSSGMESWSNSQQRRQKGLSGEGAPKND
LMAFSPNFPLCPGSVHKGEQKEATANSSDKVGYLKYFVCFHNTSLGHMEFVFS*
754 >lcl|XP_001377351.2|Plus1complement(22393400..22394338) NW_001581971 olfactory receptor 5B12-like LOC100026879 __SEG__ Chr5 {Monodelphis domestica} MENGSEVKEFILVGLTDVPEFQVPLFIIFTIIYLITFVGNLGIVALIFCDSRLHTPMYFFLSNLSLVDFSYSSAIAPKVMSGLLPGNKLISFNGCATQMFFFTGLATVEN
YLLATMAYDRHAAVCKPLHYTTLMTPSLCAFLAIGSYFCGFLSSSIHTGNTFSIHFCKSNVVHHFFCDIPPLMVLSCSDTAINEMIVFFVVGFNVFFALFIILISYLFIF
IAILRMRSVEGRQKAFSTCASHLTAVSIFYGTVIFMYLQPSSSHSMDIDKIASVFYTMVIPMLNPLVYSLRNKEVKSAFKKIIDGTKLFRLS*
755 >lcl|XP_001377367.1|Plus141050624..41053104 NW_001581837 protocadherin alpha-C1 PCDHAC1 __SEG__ Chr1 {Monodelphis domestica} MLGWIVILCLWTGSCAAEHLEYSEFEETEHGKIVGNVATDLGLAADTLIFRKFRLLSSNGGEPYFGVELGSGSLFVREPADRERLCGAKPICILNYELVLKYPLELHRMS
VHILDLNDNPPRFPEGEVLLHLAEFLVPGARFTLPNAQDADEGTNGLLSYSLSPSEHFRLEMGTRSDSSEYPELVLEKSLDREQRDTHRLVLTARDGGQPDRSESVQVTV
TVVDTNDNAPVFQRSVYRASVSETAPNGTVLIRVQASDPDEGPNGEVRYIFSNSTPTELRLQFRVHSQSGEVSVVAPLGPADKLLELFIEARDEGAFSLASTAKLLVEVI
DVNDHAPEVRITSLSSPVSEDAPSGTAIALLSVRDEDRGPNGKVTCSIQSNGPFQLRPSFDNYYSLLTDGPLDREQTSEYQVTIVASDGGSPPLSTHRTVTVLVEDVNDH
APSFPLPQQEFFVAENNGAGASLGRVFAQDQDLNQNGLVSYLLRDLHSDRPLASSLVEVDRISGAITAKTSFDFEQLKGFHFVVEAMDGGIPARSTEVKVSVFIVDRNDN
PPAILYPLVKNGSVPVEIVPRQAKTGYLVTKVVAEDADSGPNAWLSYHVLQASDLSLFSVSPNTGELRTRRSILPTDAVKQKLVIMVQDHGDLPLSSSITLGVLLVDSPP
QVIPDFKDGWETRGQLSTPNLYLVIALACISFLFLVFLVFSVCIKWSQGQSCSCHSCCPSHCCSPESYQCRKKMPQNPGLTSATIDVTAVGRLSQTYLYQASLGLGSSNN
NLFLRGEYSTADLRNLVSGVGLNLPISCIQIRNRKGEHANDKAMVSQCYKKRFPFF*
756 >lcl|XP_001377378.2|Plus1complement(22428847..22429776) NW_001581971 olfactory receptor 5B12-like LOC100026919 __SEG__ Chr5 {Monodelphis domestica} MENGSEVKEFILVGLTDAPELQVPLFIIFTIIYLITLVGNLGMIVLILWDSRLHTPMYFFLSNLSLTDLGYSSAITPKVIAGFLPGNKIISYSECVAQMFFFVHFVTIES
YLLAVMAYDRQVAVCKPLHYTTTMTSSVCVRLVIGCCIFGFLCSSLHTGNTFTLYFCNSNVIHHFFCDVPPLFVLSCSLTYVHELVLFFGVSFNASLTLFFIVKSYFSIF
IAILRMRSAEGRQKAFSTCASHLIAVSLFYGTIIFMYLQPSSSHSMDTDKVASVFYTMVIPMLNPLVYSLRNKEVSNAFRKIMGRQNLS*
757 >lcl|XP_001377391.2|Plus1complement(22441361..22442290) NW_001581971 olfactory receptor 5B12-like LOC100026938 __SEG__ Chr5 {Monodelphis domestica} MENGSEVKEFILVGLTDAPELQVPLFIIFTVIYLITLVGNLGMIVLILWDSRLHTPMYLFLSNLSLSDLGYSSAITPKVMAGFFPGDKTISYNGCAAQMFFFLYFAVIES
YLLAAMAYDRQVAVCKPLHYATTMTPNVCARLVIGSYICGFLFSSLYTGNTFSLYFCNSNVIRHFFCDIPPLFAISCSLTYIHELIVFFAVTFNTSFALFFIVKSYFSIF
MAILRMRSAEGRQKAFSTCASHLTAVSLFYGTVLFMYLQPSSSHSMDTDKVASVFYTMVIPMLNPLVYSLRNKEVSSAFRKIMGRQSLR*
758 >lcl|XP_001377425.2|Plus1complement(22473022..22473966) NW_001581971 olfactory receptor 5B12-like LOC100026991 __SEG__ Chr5 {Monodelphis domestica} MENSSEVKEFILVGLTDAPELQVPLFIMFTVIYVITVVGNLGMVVIISWDSRLHTPMYFFLSNLSLVDFGYSTAITPKVMAGFLTGNKIISFNECAVQIFFFGAFATVEN
YLLAVMAYDRHAAVCKPLHYTTTMTSSVCASLVIGSYVCGFVNSSIHTGDIFSLHFCNSNVIPHFFCDIPPLLALSCSDTHITELVIFFVVGFNVFFAIFTILVSYLFIF
VAILRMRSAEGRQKAFSTCASHLTAVSIFYGTVIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKSAFTKIFQGAKSSLGLSF*
759 >lcl|XP_001377431.1|Plus141288860..41291247 NW_001581837 protocadherin beta-2-like LOC100027001 __SEG__ Chr1 {Monodelphis domestica} METGENTIRKQRQVLLFFVFLCMPKAGSEPRRFSVAEEMESGSFVGNVIKALGLEMGELSNRGARVVFEGVRQYLQFNRKTWDLLVKEKLDREELCGPTVSCVLPFQILL
ENPLQIFLAELLVEDINDHSPIFLDNEMLLKIPESSLPGKIIRLDGAQDLDVGINSLQNYTVSPNPHFQVQIRARSEGRKYPELVLNKALDREELPEIRLTLTALDGGSP
PRSGTAQIRVLIVDVNDNAPEFGRQNYEVRIPENSPPGSLVVEVHAADLDTGNYGEIFYTFSDASEDIRKTFKIDGSSGEISLIKTVDFEATQFYEIDIEATDGGGLSGK
CTVVIHVIDLNDNLPKLTISSITNPIPENSPETVVAVFRVSDLDSGENGRMVCSIQDDLPFSLKPSVENYYTLVTEGALDRERRAEYNITITVMDLGSPRLKTEHNITIW
ISDINDNPPVFTLTAYKLYLQENNSPALHIGSVSARDRDSGINAKVTYSLLPPENGDLPLFSYISINSDNGHLYALRSLDYETIQAFQFTVTATDGGSPSLSSQALVQVV
VQDMNNNSPFVLYPLQNGTAPCNDLVPRTAEPGYLVTKVVAVDKNWGQNSWLSYQLLKATDPGLFTVWAHNGEVRTARPISDRDAIKQRLLVLVKDNGQPPLSTAATLNV
LLVDGFSEPYMQFPDAPKEPIQTDSLTTYLVISLASVSFLFLVSVIMVIAIRLWNRKRDATDAAHFNPNGPFPSHLVDVSGTGTLSQSYQYEVCLTSGSETSEFKFLQPI
NPTLPQASGKDTIENPTLRNSFCFN*
760 >lcl|XP_001377451.2|Plus1complement(22496897..22497868) NW_001581971 olfactory receptor 5B12-like LOC100027031 __SEG__ Chr5 {Monodelphis domestica} MFTKSLKISMENSSEVKEFILVGLTDAPELQVPLFMMFMVIYVITVVGNLGMVVIISWDSRLHTPMYFFLSNLSLVDFGYSTAITPKVMAGFLTGNNIISYNGCAAQMFF
FAVFATAESYLLAVMAYDRHAAVCKPLHYTTTMTSSVCVRLVIGSYICGFVNSSIHTGDIFSLHFCNSNVIPHFFCDFPPLLALSCSDTHITELVIFFVVGFNVFFAIFT
ILVSYLFIFVAILRMRSAEGRQKAFSTCASHLTAVSIFYGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKSAFSKLSHGAKSSLGLSS*
761 >lcl|XP_001377454.1|Plus1433944..435062 NW_001587034 G-protein coupled receptor 12-like LOC100027035 __SEG__ ChrX {Monodelphis domestica} MVPPPTQSPLEAPLQMLLQASATPGSSPDPGTSPSAATDTSSPPPPDGSPWPPNGSWPVGRGRGLGGGEGVSPWDIALCAAGTVMAFENALVLAVLCCTPSLRAPTFMLI
GSLALADLLAGVGLVANFVARCVMDPVSDAVALCLAGLLLSAFSASACSLLAITVDRYLSLYSALTYQAERTLPFTCGLLAALWLTCLGIGALPAMGWHCLDAPATCSVL
SPLTKDQAAGLSVSYLFLFSFILHLYLQICRVAFRHAQQIAVQRHIVNNAGSPMPSAFCLVSGTRKGVSTLSLVLATFAFCWVPLAVYAMVADPTYPQVYTYYLALPAAC
HSAINPVVYGFRNPEIRRSLNVAYTTYLRSLFSRPRAATSNV*
762 >lcl|XP_001377464.1|Plus141300793..41303165 NW_001581837 protocadherin beta-2-like LOC100027053 __SEG__ Chr1 {Monodelphis domestica} MEREGAMILQQRQVIFLFILLGVSGAASELEQFSVVEEMERGSFVANVAKGLGLDAQELSNRGVRVAFKGNKEYLQLHPKTGDLFLREKLDREDLCGSIEPCVLPFQILL
ENPFQIIRAELIVEDINDHSPAFLDNEMILKIPENTFPGSVFVLENAQDLDVGSNSLQDYKISPNSHFHSQIQDSSKGRIYPELVLNKALDREELSEILLILTAVDGGVP
PRSGSAQVRVIIVDINDNAPIFIQSQYEVQISENISVGSKVVTVSATDLDIGNYGEISYTFLHASENIRKTFHLKEKLGELYLKEKVDFESIQSYTINIQATDGGGLSGE
CTVIVQVMDLNDNPPELTMSSLTSPIPENSPEIVFAVFSVSDLDSGENGRMVCSIQDDLPFSLKPSVENYYTLVTEGALDRERRAEYNITITVMDLGSPRLKTEHNITIW
ISDINDNPPVFTQTTYKLYLQENNSPALHIGSVSAKDRDSGINAKVTYSLLPPENGDLPLFSYISINSDNGHLYALRSLDYETIQVFQFTVTATDGGSPSLSSQALVQVV
VQDMNDNSPFVLYPLQNGTTPCNDLVPRTAEPGYLVTKVVAVDRDWGQNSWLSYQLLKATDPGLFTVWAHNGEVRTARPISDRDAIKQRLLVLVKDNGQPPLSTAATLNV
LLVDGFSEPYMQFPDAPKEPIQTDSLTTYLVISLASVSFLFLVSVIMVIAIRLWKRKRDATDAAHFNPNGPFPSHLVDVSGTGTLSQSYQYEVCLTTGSGTSEFKFLKPI
IPTLPPAEGNGKDSVENPHL*
763 >lcl|XP_001377471.2|Plus1complement(22515926..22516870) NW_001581971 olfactory receptor 5B12-like LOC100027064 __SEG__ Chr5 {Monodelphis domestica} MENGSEVKEFILVGLTDAHELQVPLFIIFTIIYLITLVGNLGMIALISCDPRLHTPMYFFLSHLSLVDFGYSSAITPKVMSTFLMEDKIISYGGCAAQFFFFVAFSTIES
YLLAAMAYDRHAAVCKPLHYTTTMTSSVCAGLTIGSYLCGFLNSSLHTRNAFSFDFCSSNVIHHFFCDFPALVALSCSDTYISELIVFFVVGFNALLTLFIILISYLFIF
IAILRMRSLEGRQKAFSTCASHLTAVSIFYGTVIFMYLQPSASHSMDTDKVVSVFYTIVIPMLNPLVYSLRNKDVKSAFIKLSQGAKSSLGLSF*
764 >lcl|XP_001377473.2|Plus1<45989352..45991205 NW_001581981 kelch-like protein 13-like LOC100027066 __SEG__ Chr6 {Monodelphis domestica} SGSSGSSGSGGGEMGVSAHLQSSKAGTTRFFRSNTHSSVVLRGFDQLRGEGLLCDVSLVPGDGDDAFPVHRAMMASASDYFKAMFTGGMKEQDLKCIKLHGVNKVGLKKI
IDFIYTAKLSLTMDNLQDTLEAASFLQVLPALDFCKVFLISGVSLENCVEVGRLANTYNLTEVDKYVNNFILRNFPALLHSGEFEKLPFERLAAALASNSLKHCGELELF
KAACRWLRHEEPRMELAPKLMKNIRFPLMSPQDLINYVQTVDFMRADNTCVNLLLEASNYQMMPYMQPVMQSERTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDEKANE
WKALAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRSNKWIQVAPLNEKRTFFHLSALKGHLYAVGGRNAAGELATVECYSPRMNEWSYVAKMSEPH
YGHAGTVYGGLMYISGGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGEKLYVIGGNHFRGTSDYDDVLSCEYYLPALDQWTPIAAMLRGQSDVGVAVFEDK
IYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTIFPPEENTGSPSRESPLSAP*
765 >lcl|XP_001377497.2|Plus1complement(1482996..1483928) NW_001581950 olfactory receptor 2G6-like LOC100027100 __SEG__ Chr4 {Monodelphis domestica} MKQNNNSQEGFLLLGFSDKPQLETILFVVILVFYILNLVGNTTIILVSGLDPKLHTPMYFFLTNLSFLDLCFTTSVAPQLLVTMRSKDKSMSYGGCIAQLYVAMGLGSTE
CILLAVMAYDRYAAVCRPLHYAVIMHPQLCLTLASIAWLSGLVTSLIQCSLTIQLPLCGHNRLDHIFCEVPVLIKLACVDTTFNEAQLFVASVVFLVVPVSLILISYGYI
TQAILKIKSSAGRRKAFGTCSSHLVVVIIFYGTIIFMYLQPVKSRSNDQGKFVSLFYTIVTPLLNPLIYTLRNKDVKGALKKLILGKVIG*
766 >lcl|XP_001377500.2|Plus1complement(22562126..22563064) NW_001581971 olfactory receptor 5B21-like LOC100027103 __SEG__ Chr5 {Monodelphis domestica} MGNSTEVTEFILLGLTDDPKLHLPLFLVFLFIYLFTLVGNLGMMVLIHSDSRLHTPMYFFLSNLSFVDLGYSSAVAPKVAAALFSGNRVISYSECAAQFFFFVGFATVEC
YLLASMAYDRHAAVCKPLHYTTTMTASVCICLVAGSYICGFLNASIHAGDTFSLSFCRSNVVHHFFCDIPPLLALSCSDTHISELVVFFVVGFNVFFTLLVILISYLFIF
IAILRMKSAEGRQKAISTCASHLTAVSIFYGTIIFMYLQPGSSHSMDSDKIASVFYTVVIPMLNPVIYSLRNKEVKNAFSKMIKQVRFSRNT*
767 >lcl|XP_001377511.2|Plus1complement(1512621..1513562) NW_001581950 olfactory receptor 14A16-like LOC100027122 __SEG__ Chr4 {Monodelphis domestica} MTNATLVTEFILMGFSEVRELQILHAVLFLLIYLVALLGNLLIIALTLLDKELHTPMYFFLKHLSFLDLCYISVTVPKFISNTLANISSISFLGCITQVFLVVSLACAEL
ALLTGMAYDRYVAICHPLHYAVTMNRRTCVKMAASSWLSGGLSGLLHTATSFSLPFCESTRIHQFFCEIPQILRLSCSESYSAEIGALAITSSLSFICFLSISVSYIHIF
STVLKIPSVVGRSKAFSTCMPHLIVVTIFLHSAAVAYLKPTSACPSFVDLLMSVFYTVLPPTLNPIIYSLRNKDMKSALRKLVKNHLNGPFEF*
768 >lcl|XP_001377546.1|Plus1complement(63880860..63881924) NW_001581835 cell cycle control protein 50B-like LOC100027175 __SEG__ Chr1 {Monodelphis domestica} MAWSATSPGANQPDNTAFTQQRLPAWQPLLSAGITLPLFFCVGLAFIGLGLGLYYSSNGIKEIEYDYTGEPGIGNCTACARVGERVAPPHPNCTCQWCFSLPELFQGPVF
LYYELSNFYQNNRRYVVSRDDEQLSGLASALRHPANECAPYQRTPTGLPIAPCGAIANSLFNDSFKLLYQRQPNGPYDEVPLDRTGIAWWTDYHVKFHNPAPINGSLKLA
FHGTAKPPNWPRPVYDLSPDPNNTGFVNQDFVVWMRTAALPTFRKLYARIRHVNYSAGLPRGTYCVNITYNYPVLAFGGQKRIIFSSISWMGGKNPFLGIAYLTFGSLCI
ITGFVMLIVYIRYQDENGDGDEDE*
769 >lcl|XP_001377553.2|Plus11552600..1553523 NW_001581950 olfactory receptor 14C36-like LOC100027183 __SEG__ Chr4 {Monodelphis domestica} MSNFTTATEFLLMGFSDIQELQILYSFLLFLIYSAGLMGNLLIVIITTFDRTLHTPMYFFLRNLSMLDACYLSITIPQAFFNSLVNNRVISVTGCAAQVFLVMFMVYVEL
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTITCLLTGLVYAGFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNNLSLIVSDVVVGAGCYAFIIASYVCIF
STVLKFPVKEDQKKAFSTCIPHITVVSLFIISGTYVYFHPPSDSGSLKDIILSVFYTVIPPFLNPIIYSLRNKQIKGAIRILMKRTL*
770 >lcl|XP_001377560.1|Plus1complement(5861276..5863129) NW_001581878 zinc finger and BTB domain-containing protein 22-like LOC100027196 __SEG__ Chr2 {Monodelphis domestica} MEPSPLSPQGAALPLSMSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASAATTAMATTAAVASGAGGSTGVGGTGPATTVTGSGRPHSSSRASENQSPSSSNYFSPRDSGDFSSSH
DAYSASSMGVAERRSGGGPLFSSSVMGSGSGASGKLLLEADELSDDGGDGVGVVVPGAGLRRPTYVAPSIMPQKHWVYVKRGGGCPAPAPLAPQDPDLEEEDEEEDLVLT
CEDDEDEELGGPAGGPPGGSSGPGLSISDVRTLTDPPDKGEEQVNFCESSEDFGPYESGTTGTGLDDPGGPAPSSFTSHQPRSLMPLDMQGNQLLVFPSSSQASAQPPGS
QAEHGAVTMAGSGGGNLGVSGSGGSSGGSGGGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCGKKFMWRDSFMR
HRGHCERRHRLGGGGTPGTTGLPKREPPGGGSGDEVGGTTSPPNRRVWSPQGTHKVEMGFNGSGGGH*
771 >lcl|XP_001377573.2|Plus11593560..1594501 NW_001581950 olfactory receptor 14C36-like LOC100027216 __SEG__ Chr4 {Monodelphis domestica} MYNYTTATEFLLLEFSDIRELQILYSLLLFLIYSAGLMGNLLIVIITTFDRRLHTPMYFFLRNLSIVDICYLSITAPQASVNSLVNNRIISVTGCAAQVFLMVFMVYVEL
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTIVCLLTGLAYAGFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLIVSDLVVGAGCYAFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHIIVVSLLVISGAYVYLQPPSESGSLKDIILSVFYAVIPPFLNPIIYSLRNKQIKDAIRILMRRTLSLRNEA*
772 >lcl|XP_001377582.1|Plus141370417..41372801 NW_001581837 protocadherin beta-3-like LOC100027226 __SEG__ Chr1 {Monodelphis domestica} MKPRGKSIPFQRQVLFLVLLCVCVSSLEPGSFSVAEEMESRSFVGNVAKVLGLKVEELSARGAQITSKGKKQHLQLNIQTGDLLLKEKLDREELCGPIDPCVLPFQILLE
NPFHVIPAELRVLDVNDHEPVFPDSEMLLKILENSPPESLFSLKNALDLDVGINNVQNYTVNPNSHFRVHTRTRSDGRKYPELVLGKTLDREEQPEFALTLTAVDGGSPP
KSGTAQIRVLVVDINDNSPVFAQSQYEVQIPEDSPIDSLVVTVSATDLDTGSNGEISYLLIQSSEEITQTFKINPLSGEIRLKRQVDFEIIQSYEVDIEATDGGGLSGKC
TVLIHVMDLNDNPPELTLSSLNSPIAEDSSDVVVAVFSISDPDSGDKGRIVCSIQDNIPFVLKSSLENFYTLVTDGVLDRESRDVYNITITVTDLGSPRLKTEQNITVLI
SDVNDNPPVFTQTAYTLYLQENNNPAFHIGGISASDRDWGSNAKITYSLLPPETEELPLFSYISINSDNGHLYALRSLDYETIQTFLFTVKAVDGGSPALSSQALVQLII
QDENDNSPFVLYPLQNGTAPCNDLVPRMAEPGYLVTKVVAVDRDSGQNSWLSYQLLKATDPGLFTVWSQNGEVHTVRPISDKDAIKQRLLVLVKDNGQPPLSTAATLNVL
LVDGFSEPYLQLPDIPKEQAQHDSLTIYLIISLVSVSFLFLFSVIMFIALRLWRKKDATDGNHFRPNSSFPGHLVDIRGTGTLSQNYHYEVCLTNDSGTSEFKFLKPIIS
SLPTEDSGRNSEESPPFQKNLGLS*
773 >lcl|XP_001377586.2|Plus11624914..1625855 NW_001581950 olfactory receptor 14C36-like LOC100027230 __SEG__ Chr4 {Monodelphis domestica} MSNFTSVTEFLLMEFSDIRELQIFYSFLLFLIYSAGLMGNLLIVIITTFDRRLHTPMYFFLRNLSMVDACYLSITAPQASVNSLVNNRIISVTGCAAQVFLVIFMGYVEF
ALLTVMARDRYVAICHPLHYTVIMSPRVCMQMTLTCLITGLMYAAFHTGYTFRLSFCRSNVVNQFFCDIPSLLRISCSDTFSNKLSLIVSDLVVGASSYAFIIASYVRIF
STVLKFPVKEDQKKAFSTCIPHITVVSLFIISGSYVYFQPPSDSGSFKDIILSVFYTVIPPFLNPIIYSLRNKQIKGAIRLLMTRTISLRNKA*
774 >lcl|XP_001377600.1|Plus141380388..41382778 NW_001581837 protocadherin beta-3 PCDHB3 __SEG__ Chr1 {Monodelphis domestica} MEPERKAIPLQRQVFFLFFLLWVSEAGGDLGRFTVAEETESGSFVTNVAMALGLQLGDLSARGARIASKGNKQHLQLNRETGDLNLKEKLDREELCGSTEPCLLPFQILL
ENPLKIVRAELRVEDINDHSPVFLESEMLLRIPENSIPGSVLPLKNAEDLDVGPNAVQNYTLSPNYHFHLQTHSRGEGRKFPELVLSKALDREEQAEFILILTAVDGGSP
PRSGTARVRIVVVDINDNAPLFVQPRYEVQVPENNSIGFLVVTVSARDLDAGNYGEILYSLFHSSEEISKTFEINPISGDIRLRKKLDFETIQRYEIDVEGTDGGGLSGK
CTVIIQVTDLNDNAPELAMSSLTSPIPENAPEMVVAVFSISDLDSGENGRLVCSIQEDIPFTLQPSIENFYTLITEGGLDRESKAQYNIMITVMDLGFPRLQTVHNITVF
ISDVNDNPPVFTQTAYIFYLEENNTPASHLGNVSANDRDSGTNAKVTYSLQPSKSENLSLSSYISINSDNGHLYALRSLDYEAIQTFQFIVKATDGGSPALSSQTLVQVV
VLDENDNSPFVLYPLQNGTAPCNDLVPRTAEPGYLVTKVVAVDGDSGQNSWLSYQLLKATDPGLFTIWAHNGEVHTVRPISDRDAIKQRLLILVKDNGQPPLSTAATLNV
LLVDGFSEPYVKRQESIKESTQIDSLTLYLIISLASVSFLFLISAILFTVLHLWKKKRDSSDMGHLRASAPFPSRLVDINSTGTLSHSYQYEVCLANDSGTNEFKFLKPI
IPSLHAHHDGKDSEENPTFRNSLDFS*
775 >lcl|XP_001377608.2|Plus11659226..1660161 NW_001581950 olfactory receptor 14C36-like LOC100027267 __SEG__ Chr4 {Monodelphis domestica} MSNYTTATEFLLMGFSDIRELQIFYSFLLFLIYSAGLMGNLLIVVITTFERRLHTPMYFFLRNLSMVDACYLSITAPQASVNSLVNNRVISVTGCAAQIFLMVFMGYVEF
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTFTCLITGFMYAGFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLIVSDVVIGAGCYAFITASYVHIF
STVLKFPVKEDQKKAFSTCIPHITVVSLFIFSTCFVYLQPPSESESLKDIILSVFHTTIPPFLNPIIYSLRNKQIKDAMGTLMKSTIFIKK*
776 >lcl|XP_001377646.2|Plus11730883..1731818 NW_001581950 olfactory receptor 14C36-like LOC100027318 __SEG__ Chr4 {Monodelphis domestica} MSNFTTATEFLLMGFSDVRELQILYSFLLFLIYSAGLMGNLLIVIITTFDRRLHTPMYFFLRNLAMVDACYISITVPQASVNSLVNNRIISFTGCAAQVFFVVFLACVEL
TLLTAMARDRYVAICHPLHYPVIMSPRVCLQMTLTCLITGLVYSAFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNNLSLIVSDVVVGAGCYAFIIASYVRIF
STVLKFPVKEDQKKAFSTCIPHITVVSLFVISGIYVYSQPPSDSGSLKDIILSVFYTIIPPFLNPIIYSLRNKQIKDAMGTLMKSTIFIKK*
777 >lcl|XP_001377656.1|Plus1complement(1129614..1131383) NW_001581909 ectoderm-neural cortex protein 1-like LOC100027335 __SEG__ Chr3 {Monodelphis domestica} MSVSSHETRKSRSSSGSMNIQIFHKPGHADSLLTHLNLLRQKCLFTDVVLKAGSGVFHCHRAVLASCSYYFEAMFGGGLKESREGLVDFGDRLHPEVLELLLDYAYSARV
LINEENAESLLEAGDMLQFHDIRDAAAAFLEKNLHPANCLNMLALSDAFNCERLFELSWRMALANFASLYKSEDFLKLPKVRLLELVQSEDLEVEEESLVYEAVVGWIKH
DLTARHDDLPELLRSVRLALLPEAYLKTQVAQEEVVTSHKLGGEIVADAVRCKMRLLQNDGLVTGFCARPRKVSQALLLLGGQTFMCDKIYTIDQTTNDIIPRTDIPSPR
KECSACAIGSKVYVTGGRGSENSASKDVWVYDTLHDEWAKAAPMLVARFGHGSAELAHSLYVVGGHTAVSGSFPASPSVSLKQVEHYDPQTNKWTLVAPLREGVSNAAVV
GAKKKLFVFGGTSVNQIHLPKVQCFDPCQNRWTAPTTCPQAWRYTAAAVLGSQVIVIGGDTEFSASSAYRFHSDTFQWSKFGDVTARRISCRAVTCGNRLFVVGGYCGTQ
RCKTLDCYDPTSDTWSSITTVPYSLIPTAFVSTWKYLSV*
778 >lcl|XP_001377660.2|Plus11774372..1775307 NW_001581950 olfactory receptor 14C36-like LOC100027339 __SEG__ Chr4 {Monodelphis domestica} MSNFTTASEFLLMGFSDIRELQILYSFLLFLIYSAGLMGNLLIVMITTFDRRLHTPMYFFLRNLAMVDACYLSITVPQASVNSLVNNRIISVTGCATQVFLVILMAYVEV
TLLTVMARDRYVAICHPLHYTVIMSPRVCLQMTITCLLTGLVYAGFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLFVSVLVVGTGCYGFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFVISGIYVYSQPPSDFESLKDIIPSVFYTVIPPFLNPIIYSLRNKQIKGAMGILMKRTIFIRK*
779 >lcl|XP_001377670.2|Plus11782691..1783626 NW_001581950 olfactory receptor 14C36-like LOC100027355 __SEG__ Chr4 {Monodelphis domestica} MSNFTTVTEFLLMGFSDIRELQIFYSFLLFLIYSAGLMGNLLIVMITTIDRRLHTPMYFFLRNLAMVDACYLSITVPQASFNSLVNNRTISVTGCAAQVFLVIFMACVEL
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTLTCLITGLVYSAFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLIAGELVVGAGCYAFIIASYVRIF
STVLKFPVKEDQKKAFSTCIPHITVVSLFLISGAYVYAQPPSDSESLKDIIPSVFYTVIPPFMNPIIYSLRNKQIKDAMGTLMKSTIFIKK*
780 >lcl|XP_001377687.2|Plus11790692..1791627 NW_001581950 olfactory receptor 14C36-like LOC100027380 __SEG__ Chr4 {Monodelphis domestica} MSNFTSETEFLLMGFSDIRELQIFYSFLLGLIYSAGLMGNLLIVIITTIDRRLHTPMYFFLRNLAMVDACYLSITVPQASFNSLVNNRTISVTGCATQVFLVIFMAYVEV
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTLTCLITGLVYSAFHASYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFTNKLSLLASALVVGAGCYGFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFVISGIYVYSQPPSDSESLKDIIPSVFYTVIPPFLNPIIYSLRNKQIKDAMGIVMKRTIFIRK*
781 >lcl|XP_001377693.1|Plus141439029..41441479 NW_001581837 protocadherin gamma-A2-like LOC100027391 __SEG__ Chr1 {Monodelphis domestica} MVSWQKHQDGRGRILLCFLLGLLWDTLTAQIRYSIPEEMEKGSFVGDIAKDLGLELQELSERGAHIVSRGKKQHFALSVRSGSLITVERIDREELCSQRVQCLLNFNILI
EHNLNIYSVEVEITDVNDNAPRFRAEELELKISETTTPGTQFILESAYDPDLGMNSVQGYELSPNHHFSLQVQSRPEGVKYPELVLERPLDWEEEPVHHFMLIAWDRGEP
VRSGTARIRVTVLDANDNAPVFTQPIYTVNVPENVPQGTVLLIVNATDADEGINSQVRYFLVKIPGKNSEIFQLNSVTGELLTLQNLDYEDAEFHEMEVEAQDGLGLRSR
AKIHVTVVDVNDNAPEVTITSVTSSIPENAPPGTIITLFHVHDRDSGKNGQVLCSIPDDLPFKLEKKVDNYHSLVTDRALDREQVSEYNITVTAVDFGGPPLSTDTHIFL
HVADINDNPPTFSQSAYSAYIQENNPRGASIYSLTAHDPDSQENALVTYSLVDSNLPLEAPPLSSYVSINSETGVLYALCSFDYEQSQELQLRVTARDSGDPPLSSNVSL
TLFILDQNDNAPEILYPAFPTDGSSGVELAPRSAEPGYLVTKVVAVDADSGQNAWLSYHLLKATEPRLFSVGLHSGEIRTVRAFLDKDALKQNLLVAVTDNGEPPLSATI
SVTVAVADSIPEILSDLSSHPAPESQDDSLLTFYLVIAVAVVSCLFFTFIVLLLALRLRKWWMLQVVQSAADHVGGVSSSQFLGIDGVRAFLQTYSHEVSLTMDSRKSQL
IFPQPNYADTLISQQSCEHKKESPFPAQSLLQGKDEQTSFQVNFVL*
782 >lcl|XP_001377699.2|Plus11798729..1799664 NW_001581950 olfactory receptor 14C36-like LOC100027398 __SEG__ Chr4 {Monodelphis domestica} MSNFTSATEFLLMGFSDIRELQILYSFLLFLIYCAGLMGNLLIVIITTIDRRLHTPMYFFLRNLAMLDACYLSITVPQASFNSLVNNRIISVTGCAAQVFLVLFMAYVEV
TLLTVMARDRYMAICHPLHYPVIMSPRVCLQMTLTCLLTGLVYAAFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLLASALLVGVGCYGFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFVISATYVYSQPPSDSESLKDIIPSVFYTVIPPFLNPIIYSLRNKQIKDAMRILIKRTMFIMK*
783 >lcl|XP_001377705.1|Plus141443709..41446156 NW_001581837 protocadherin gamma-A2-like LOC100027408 __SEG__ Chr1 {Monodelphis domestica} MIAEQKRKISMPPVLLCFLLGSLWETSAAQIRYSVPEEMKKGSFVGNIAKDLGLEVRMLSQLGARIVSRGKKQYFALNVRNGSLVIGERIDREELCTQSTQCLLNFNVLV
EDTLKIYSVEVEIIDINDNSPHFLLEELELKISETTALGTQHLLENAYDPDVGVNSLQGYELSSSDHFSLKVHSRAKGVKYPELILERALDREDEPIHHLMLTAWDGGEP
VRSGTARIRVTVLDANDNAPVFTQPIYTVNVPENVPQGTVLLIVNATDADEGINSQVRYFLVKIPGKNSEIFQLNSVTGELLTLQNLDYEDAEFHEMEVEAQDGLGLRSR
AKIHVTVVDVNDNAPEVTITSVTSSIPENAPPGTIITLFHVHDRDSGKNGQVLCSIPDDLPFKLEKKVDNYHSLVTDRALDREQVSEYNITVTAVDFGGPPLSTDTHIFL
HVADINDNPPTFSQSAYSAYIQENNPRGASIYSLTAHDPDSQENALVTYSLVDSNLPLEAPPLSSYVSINSETGVLYALCSFDYEQSQELQLRVTARDSGDPPLSSNVSL
TLFILDQNDNAPEILYPAFPTDGSSGVELAPRSAEPGYLVTKVVAVDADSGQNAWLSYHLLKATEPRLFSVGLHSGEIRTVRAFLDKDALKQNLLVAVTDNGEPPLSATI
SVTVAVADSIPEILSDLSSHPAPESQDDSLLTFYLVIAVAVVSCLFFTFIVLLLALRLRKWWMLQVVQSAADHVGGVSSSQFLGIDGVRAFLQTYSHEVSLTMDSRKSQL
FFPQPNYADTLISQQSCEQKESPFPAQSLLQGKDEQTSFQVNFVL*
784 >lcl|XP_001377719.1|Plus141448632..41451082 NW_001581837 protocadherin gamma-A2-like LOC100027427 __SEG__ Chr1 {Monodelphis domestica} MVSWQKHQDGRGRILLCFLLGLLWDTLTAQIRYSIPEEMEKGSFVGDIAKDLGLELQELSERGAHIVSRGKKQHFALNVRSGSLITVERIDREELCSQGAQCLLNFNVLI
EDNLNIYSVEVEITDINDNAPRFRAEKLELKISETTTPGTQLILESAYDPDVGVNSLQGYELSPNHHFSLRVQSGADGIKYPELVLDRALDREKEPTLQIVLSAWDGGEP
IRSGTARIRVTILDVNDNAPVFTQPIYSMNVPENVPQGTVLLTVNATDADEGINSQVRYFLVKIPGKNSEIFQLNSETGELLTLQNLDYEDERFYMMEAEAQDGLGLWGR
AKIHVTVVDVNDNAPEVTITSVTSSIPENAPPGTIITLFHVHDRDSGKNGQVLCSIPDDLPFKLEKKVDNYHSLVTDRALDREQVSEYNITVTAVDFGSPPLSTDTHILL
HVTDINDNPPTFSQSAYSAYIQENNPRGASIYSLTAQDPDSQENALVTYSLVDSNLPLEAPPLSSYVSINSETGVLYALCSFDYEQSQELQLRVTARDSGDPPLSSNVSL
TLFILDQNDNAPEILYPAFPTDGSSGVELAPRSAEPGYLVTKVVAVDADSGQNAWLSYHLLKATEPRLFSVGLHSGEIRTVRAFLDKDALKQNLLVAVTDNGEPPLSATI
SVTVAVADSIPEILSDLSSHPAPESQDDSLLTFYLVIAVAVVSCLFFTFIVLLLALRLRKWWMLQVVQSAADHVGGVSSSQFLGIDGVRAFLQTYSHEVSLTMDSRKSQL
FFPQPNYADTLISQQSCEHKKESLFPAQSLLQGKDEQTSFQVNFVL*
785 >lcl|XP_001377735.2|Plus11854291..1855217 NW_001581950 olfactory receptor 14C36-like LOC100027448 __SEG__ Chr4 {Monodelphis domestica} MSNYTTATEFLLMGFSDIRELQILYSFLLFLIYSAGLMGNLLIVIITTFDRRLHTPMYFFLRNLSMVDACYLSITAPQASINSLVNNRIISVTGCAAQVFLVIFLAYVEF
TLLTVMARDRYVAICQPLHYPVIMSPRVCLQMTLTCLLTGLVYAAFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLIVSELVIGAGCYAFIIASYVGIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFIFSTCFVYLQPPSESASLEGIILSVFYTVIPPFLNPIIYSLRNKQIKDAITILMKRIIR*
786 >lcl|XP_001377741.1|Plus1complement(46906763..46908130) NW_001581981 probable G-protein coupled receptor 22-like LOC100027455 __SEG__ Chr6 {Monodelphis domestica} METHVDLPVLETNDGPGAGATVDSPEDAGWAGGPFPGGFRASLAGVLLLELALGLGCNAAALLLHRARAGPRASASARLTLSLHVLDTLICALCVPLSVAVLLLPTTSPR
VPASARPASLLCRFHEAGVTFSGVATAAGVLAVSLDRYDMSARPARRRLTPARALLLLAVAWLLSLAAFFLPFVEAGLAPGVWDEASGADNRTGVSCVGTGGGWGVTGRG
APAGRGHLLVQIPAFVAALVGLLVTYARVLHALSAGLGARASRRRRRGKRRGHGCGSGAGAGEARGLSPMPPPAAPAPGPAPPPPALQTSVSVILALRRAVRRHRDRRAR
RRRVLRRSLLIVSSFVGCWAPLSVGNLLLLCMGPSERLARLRLCCLAAAYGTTVLHPLLYAFPRRTLSRALRNQARRHAVCALRPEPPAPAAAIVRNSWLGMRKGQGEAE
EAGDRALGLGEQPPD*
787 >lcl|XP_001377750.2|Plus11884791..1885726 NW_001581950 olfactory receptor 14C36-like LOC100027468 __SEG__ Chr4 {Monodelphis domestica} MSNFTTATEFLLMEFSDIRELQIFYSFLLFLIYSAGLMGNLLIVIITTFDRKLHTPMYFFLRNLAMLDACYLSITVPQASINSLVNNRTISVTGCAAQVFLVIFLAYVEV
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTLTCLLTGLVYAGFHTGYTFRLSFCQSNVVHQFFCDIPSLLRISCTDTFSNKLSLIVCELVIGAGCYAFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFLISGAYVYAQPPSDSESLKDIILSVFYTVIPPFLNPIIYSLRNKQIKDAMVLLMKKTIFIKK*
788 >lcl|XP_001377757.2|Plus141463584..41466052 NW_001581837 protocadherin gamma-A4-like LOC100027480 __SEG__ Chr1 {Monodelphis domestica} MADPQRFSCNTGRMLLCFLLGTLWEVGSGQIRYSVPEEMEKGSFVGDIAKDLGLEPRKLSESGARIVSRGKKQHFALNVRSGSLVTADRIDREKLCGKASMCTIKAEILL
EDKVKIYGVEVEIVDINDNVPSFGTKEREIKVSESAVPGTRFPLPEAFDLDVGVNSLQKYKLSPNHHFSLHVQSGRDNAKYPEMVLEQALDREEVSIHHLTLTASDGGNP
SRSAIVLILVTVLDANDNAPVFTQFQYSVSVPENVPVGTCLLRVNATDPDEGMNGDVSYYFRKITEKTSQLFELNSLTGDITVLGNLDYEECNFYDIDIEARDGAGLLDR
AMVLVTILDVNDNTPDVTITSVTSSISENSSAGSMIALFNVHDKDSGENGQVTCSIPEHLPFKLEESYGNYYSLVTNKALDREQVSMYNITVRATDRGNPPLSTDTHISL
HIEDINDNPPAFIQTVYSAYIMENNPRGTSIYSLTAHDSDIGENGHVSYSIAEDSVHGVPLSSIVSINSETGDLYALCSFDYEQFRELKLGVTARDSGDSPLSSNVSLTL
FILDQNDNVPEILYPAFPTDGSSGVELAPRSAEPGYLVTKVVAVDADSGQNAWLSYHLIKATEPGLFSIGLHSGEIRTVRPFLDKDTLKQNLIVAVTDNGELPLSATVTI
TIAVADSIPEILSELSNLEATDDLKDSSLTLYLVISVAAISCLFFTFIVILLALKLHQWRTSKLLEESSGHFGNMQSSQFVGIDGVRAFLQTHTQEVSLTTDSRKSQLIF
LGPDYTDTLPKNSDKKEPPLIPHESVLSNEDLSFLKVCLDFIFNIIYLSITT*
789 >lcl|XP_001377781.2|Plus11917243..1918184 NW_001581950 olfactory receptor 14C36-like LOC100027508 __SEG__ Chr4 {Monodelphis domestica} MSNFTSATEFLLMGFSDLRELQIFYSFLLFLIYCAGLMGNLLIVMITTFDRRLHTPMYFFLRNLAMVDACYLSITVPQASVNSLVNNRIISVTGCAAQVFLVVFMAYVEF
TLLTVMARDRYVAICHPLHYPVIMSPRVCMQMTLSCLITGFMYTAFHTGYTFRLSFCQSNVVHQFFCDIPSLLRISCSDTFSNKLFLIVSELVLGAGCYAFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFIISGSYVYFQPPSDSGSLKDIILCLFYTVIPPFLNPIIYSLRNKQIKEAMRILMTRTLSLRNKA*
790 >lcl|XP_001377784.2|Plus1complement(23117980..23118939) NW_001581971 olfactory receptor 5A1-like LOC100027512 __SEG__ Chr5 {Monodelphis domestica} MATGRNTTTVTKFILLGFIEHPELQVFLFMLFLGIYLMTLAWNLFLIIIIRIDSHLHSPMYFFLSNLSFVDIVYTSSIAPKMLYDFFKEQKTISFVGCAAQLFVFIEMGG
AECCLLAAMAYDRYIAIANPLLYAAVMPPSICVKMAVAAHVGGVFTGLVQTSSVFQLHFCGPDVINHFFCDIPPLLTLSCSSTLPSQVVNYTVVCMVGGTSATIVLVSYA
YIIATVMKIHSARGRAKAFNTCASHLIAVVLFYGSGLFAYLHPSSRSSLNQDKVVSMFYGAVIPMLNPIIYSLRNKEIKDALEKLKERRRQMSRCALFP*
791 >lcl|XP_001377799.2|Plus11950440..1951381 NW_001581950 olfactory receptor 14C36-like LOC100027530 __SEG__ Chr4 {Monodelphis domestica} MSNYTTVTQFLLMGFSELRQLQIFYSFLLFLIYSAGLMGNLLIVMITTFDRRLHTPMYFFLRNLSMVDACYLSITVPQASVNSLVNNRIISVTGCAAQVFLVLFMAYVEF
TLLTVMARDRYVAICQPLHYPVIMSPRVCMQMTLTCLLTGLMYAAFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLLASALVVGAGCYGFITASYVGIF
STVLKFPVKEDQKKAFSTCIPHITVVSLFIFSTCFVYLQPPSESASLEGIILSVFYTVIPPFLNPIIYSLRNKQIKDAITILMKRILSLSNKV*
792 >lcl|XP_001377813.1|Plus13234932..3235894 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100027547 __SEG__ Chr3 {Monodelphis domestica} MAESPPAEQLESFLDTTVQTSTAEAAGEFILRYWAEILSLVIALVGLVGNSIVLWLLGFRTRRSPFSVYILNLAAADALFLGSYFVLCMWRIVGDFDFVILMLLWLCLLG
LSYRVGLSLLAAISTERCLSVLFPLWYRCHRPKHTSVAVCSILWALQGLFWGVLVALYFLNKDQFYNYFYSFLPFVQFVWFLLLTCVLGVSSLTLVLRVQCSSQRRRPPR
LYLLVLLTVLVFLLCGLPWGIVDAVRFLYGFYVIPFGLTRLLACVNSSANPFIYFFLGSQWCRRGREPLRVVLQRALGEEQVGGDGGRGTSHPNTVDKLS*
793 >lcl|XP_001377816.2|Plus11973509..1974444 NW_001581950 olfactory receptor 14C36-like LOC100027550 __SEG__ Chr4 {Monodelphis domestica} MSNFTLVSEFLLMEFSDTRELQIVYALLFLLIFLATLLGNLLIVIVTTTDRQLHTPMYFFLRNLSLVDACYITVILPKASTNSLLNNRAISKSECVAQIFLVVFFVYTEL
ICLTIMARDRYVAICHPLHYAGIMSPRVCMQMTLACLLTGLLYAGFHTGYTFRLPFCWSNVIHQFFCDIPSLLKLSCSDTFRNEVLILASGLGVGGGCFAFITASYVCIF
STVLKIPGKEDQRKAFSTCVPHIIVVSVFLISGFYVYLRPSSVSASIEDMILSVFYCIVPPFLNPIIYSLRNKQIKEAVKTIIRRNIFSRR*
794 >lcl|XP_001377831.2|Plus1complement(1991016..1991948) NW_001581950 olfactory receptor 14A16-like LOC100027572 __SEG__ Chr4 {Monodelphis domestica} MANHTIITSFLLMSFSDIWELQLLHIVLFSLIYLAALMGNLLIILVTTIDQHLHTPMYFFLRHLSFLDLCYISVTVPKSVLASLTHNNTISILECAIQVCFVLLFVCAEL
ALLTVMAYDRYAAICCPLHYETLMSRGACLQMAAASWVSGSLSGIMHTVSTFSAPFCEAKVLGQFFCEIPHLLKLSCSQPNFAEIGTTVTTTVLGLGCFFYIVISYFYIF
STVLRMPSTEGRSKAFFTCLPHLLVTTVFFSTAFVAHIKPTSDTPSVLDLLVSVFYVVVPPTLNPAIYSLRNTVMKAALAKLVRQVFPCL*
795 >lcl|XP_001377834.2|Plus1complement(23206965..23207903) NW_001581971 olfactory receptor 5A1-like LOC100027575 __SEG__ Chr5 {Monodelphis domestica} MTIGRNETSVAMFTLQGISDEPELQVIFFLLFLGIYIMTLTWNLGLIILIRSDSHLHSPMYFFLSFLSFIDICYSSSISPRMLSDFFLEEKTISFLACAAQYFFAAWMAL
AECCLLAVMAYDRYVAIYSPLRYSIIMHLPICGKLVAGAYVAGCLGSLVQTTAGFQLHICGPKIINHFFCDIPKIIALSCSNPFINQFMVFLVALCIGLFSFLFIIMSYV
YITVTILKMPSAKGRAKAFNTCASHLTAVTLFFGTAFCVYLRPNSGHSAHLDKVLSVFYAILIPVLNPMIYSLRNKEIKDALKRLMNRGKLS*
796 >lcl|XP_001377838.1|Plus141499552..41502005 NW_001581837 protocadherin gamma-B1-like LOC100027584 __SEG__ Chr1 {Monodelphis domestica} MEMITEQRSQALFLFLGSLFCRALSEHINYSIPEEMAKGSVVGNIAKDLGLEIRDLPTRKLRVSAEREYFSVSEESGDLLVSDRVDREEICGRKLVCALEFEMVAENPLN
FYRITVVIEDINDNPPRFSRNIIDLEISEIALPGVTFTLESPQDPDVGVNSLQQYFLSLDPHFSLLPKENPDGSKYAELVLEKPLDREKQSSYSLILTAVDSGIPVRSGT
VEIRINVTDANDNWPVFSQEIYRVILQESLPPGSSVLQVTATDQDEGNNAEITYSLSTVETLKHLFKLDSRSGELTTKGILDFEKGEGYTLGVEAKDGGGHTAFCKIQIE
ILDENDNAPEVTFASVSNHIPENSMPGTVVALIKTVDPDSGINGEIFCRVKDNIPFKISSSTNNLYKLVTDGALDREEIPEYNITIIATDKGNPPLTTSKILTLHITDVN
DNPPVFLQSSYVVYVPENNPSGTSIACVSATDLDLEENGRVSYSIVSSDLEPLQLFSYVSVNSHSGHIFAQSSFDYEQVHTFELTIQARDAGFPSLNANVTMQVFIVDSN
DNAPNILYPALGPDRSALFDMVPRSAKPGYLVTKVVAVDADSGHNAWLAYRVLQATDQGLFSLGLRTGEVKTVRALAERDVSRHRLLVSVQDEGQPPLSATVLLHLVFAD
SLQEALPEMKEDLPPAPESQSELQFYLVVALALISVLFLITITLAIALQLRRSSNPSNLSCFRVDLCSKTGSNVPTNYSEGTLPYSYNLCAASEVGKMEYNFLKLTGEMA
PLQDLLSNDPSLILSTSDENKKIISDLVISSHVSFLIHFYFNVNISR*
797 >lcl|XP_001377860.2|Plus1complement(2032259..2033203) NW_001581950 olfactory receptor 14C36-like LOC100027611 __SEG__ Chr4 {Monodelphis domestica} MSNFTVVTEFLLMGFSDIRELQIIFSFFFLFLIYSTGLMGNLLIVIIIIFDRRLHTPMYFFLRNLSILDACYLSIIAPQASFNSLMNDWAISVTGCAAQVFLVVFMAYVE
FTLLTIMARDRYVAICHPLHYPVIMSPRVCMQMTIVCLLTGLVYAGFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTSGNKLSLLLSALLVVIGCFAFITASYIHI
ISTVLKFPVKEDQKKAFSTCIPHISVVSLFVFSVIYVYFQPPSDSGSLKDIILSVFYAIIPPFLNPIIYSLRNKQIKDAIIILMKRTLSLKNNT*
798 >lcl|XP_001377866.2|Plus141512713..41515157 NW_001581837 protocadherin gamma-B4-like LOC100027619 __SEG__ Chr1 {Monodelphis domestica} MEKNSGRALKSQVLFSFFLSLFCLALPEPIRYSIPEEMVKGSVVGNLSKHLGLEFRDLQSRKLRISGEREYFAVSTETGELVIKERIDREQLCGKKPVCVLDFETVAENP
LNFFHITVEIEDINDHSPQFSQDTFDLQISESTLPGARFILVSAQDADVGSNSLREYQLSPSTDFSLVNRHNKDGNKYPELVLEKSLDRETQNSHQLFLTAVDGGDPARS
STAQIRINVTDANDNAPVFSQDVYRVSLPENLPRGSPVLKVTATDKDELVNAEITFSFRSTGQDFWYVFDLDANSGEITTAESIDFEKNKDYSLVLEARDGGGLVTQCTI
EIEVLDVNDNAPEVLLQSIPSVIPEDILPRTVIALIKTRDKDSGHNGEVSCEIKGKVPFKILSSSKNSYKLMTDGPLDRERIPEYNITVIATDKGNPSLSTSKILTLVVG
DVNDNPPVFLLPSYVIYVPENNPSGASIGSVSASDPDVGENGLVSYSIVRSDLDLVPGSSYVSVSDHNGDIFSQRSFDYEQVRTFEVILQACDSGSPALCTNTTLQVFVL
DGNDNSPNILYPTLSPDSSVLFDMVPRLAEPGYLITKVVAVDADSGHNAWLAYHVLQATDPGLFSLGLRTGEVRTARALTGRDSARHRLLVSVQDDGQPPLSATVALHLV
FADSLQEALPEMREERTDTLDPNSELQFYLVIALALVSVLFLVTVILVIALRLRKSSNLDEWGCFRPNLCSKSGSGPPANYSEGTLPYSYNLCVATDQGKPVFNVPKCNG
PLNPGQDLLSFDSSRSSYPPFGISDSASYPVKLDMVSFPLIIFH*
799 >lcl|XP_001377878.2|Plus1complement(2109311..2110252) NW_001581950 olfactory receptor 14C36-like LOC100027639 __SEG__ Chr4 {Monodelphis domestica} MSNFTLVTEFVLMGFSDIRELQIIFSLLLFLIYSTGLMGNLLIVIIIIFDRRLHTPMYFFLRNLSIVDACYLSIIAPQASFNSLMNDWAISVTGCATQIFLVVFLSYVEF
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTLTCLLTGLMYAAFHTGYTFHLSFCQSNVVHQFFCDIPSLLRISCSDTSGNKLSMLLSALLVVVSCFAFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFVISGIYVYSQPPSDSGSLKDIILSVFYAVIPPFMNPIIYSLRNKQIKDAMGILMKRTLSLRNNR*
800 >lcl|XP_001377883.2|Plus1complement(23243246..23244184) NW_001581971 olfactory receptor 5A1-like LOC100027644 __SEG__ Chr5 {Monodelphis domestica} MTIGRNKTSVTIFTLQGISDEPELQVIFFVLFLGIYIMTLTWNLGLIILIRSDSHLHSPMYFFLSFLSFIDICYSSSITPRMLSDFILVEKTISFLACATQYFFLAWMGL
AECCLLAVMAYDRYVAIYSPLRYSTIMHLPICGKLVAGAYVAGCLGSLVQTTAGFHIHFCGPKIINHFFCDIPKIIALSCSNPFINQFMVFLVALCIGLFSFLFIIMSYV
YITVTILKMPSAKGRAKAFNTCASHLTAVNLFFGTAFCVYLRPNSGHSPHLDKVLSVFYAILIPVLNPMIYSLRNKEIKDALKRLMNRGKLS*
801 >lcl|XP_001377890.1|Plus13400986..3401966 NW_001581916 mas-related G-protein coupled receptor member D-like LOC100027654 __SEG__ Chr3 {Monodelphis domestica} MAESPPAEQLESVLHTTVETSTNWSLDPPTEAARKSVSLHWAEILSLVVALVGLVGNSIVLWLLGFRTQRSPFSVYILNLAAADALFLGSYFGLRMWVIVGDLDLVILDQ
LGRCLLGLSYRMGLSLLAAISTERCLSVLFPLWYRCHRPKHTSAAVCAILWALQGLFSGVFGALYFLNKDDLDDFYFVFDLVQFSWFLLLTCVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLTVLVFLLCGLPLGVFYAVWSFKGFPIMFYGLSRLLACVNSSANPFIYFFLGSQWRRRGREPLRVVLQRALGEEQVGSVGGRDTSHPNTLDELS*
802 >lcl|XP_001377909.2|Plus1complement(23276924..23277856) NW_001581971 olfactory receptor 5A1-like LOC100027680 __SEG__ Chr5 {Monodelphis domestica} MERNETSVIVFILQGISDQPEMQVIFFVLFLGIYVMALTWNLGLIILIRSDPHLHSPMYFFLNFLSFIDICYSSSISPRMLSDFFLEEKTISFLACAAQFFFAAWMALVE
CCLLAIMAYDRYVAIYSPLRYSTIMHLPICGKLVAGAYVVGGLGSLVQTTAGFHLHFCGPKRINHFFCDLPQIIALSCSNPFINQIMVFLVALCIALLSFLFIIMSYVYI
TVTILKMPSAKGRAKAFNTCASHLTAVTLFFGTSFCVYLSPNSGHSQHLDKVLSVFYAILIPVLNPLIYSLRNKEIKDALKRLLKRENFP*
803 >lcl|XP_001377932.2|Plus141543067..41545502 NW_001581837 protocadherin gamma-B5-like LOC100027717 __SEG__ Chr1 {Monodelphis domestica} MGRKPVLKAQVLRWQVLYPFFASLFCRTLSEHIRYSIPEEMEKGSVVGNLAKDLGLNVWDLPARKLRVNGQKQHFTVSTQSGELLVSDRIDREHLCGKKPVCALTLETVA
ENPLNVFHVIMEIQDINDNPPHFPQNGINLQISELSLKGSRFGLGSAVDPDVGVNSLQSYQLSSNEHFSLVVKESPDGRKYPELVMEKPLDREKQSSHHLVLMALDGGDP
VLSGTAQIRINVTDANDNPPVFSQDFYRVSLRENLPPGSSVLRVKATDKDEGINAEITYFLKTTGDNALNIFNVDPQNGEIKTQDHLDFEDTESFTLGVEARDGGGMAAE
CKVILEILDENDNNPEVTFTSVSSTIAEDSVPGTVIALFKTEDRDSGVNGEVTCYVEGNAPFRLESSSKNYYYKLLTDGPLDREQIPEYNITVTATDKGNPPLSTSKTLT
LNIADVNDNHPVFLQPSYVVYVPENNPSAASIARVSASDSDLEGNGRVSYSIVSSDLAPLPLSSYVSVNGHSGDIFAQRSFDYEQVRTFELTLQACDSGSPALCANVTLR
VFVLDRNDNAPNILYPALGPDRSALFDMVPRSAEPGYLVSKVVAVDADSGHNAWLAYRVLQATDPGLFSLGLRTGEIRTARALTDRDAARHRLLVSVQDGGQPPLSATVA
LHLVFADSLQEALPEMKEERSSTSEFQSEIQFYLVIALTIISILFLITVISAIILRFRRSSNPKILGCFSPDLYSKPTIPPCYEDGTLPYSNQLRLPSELGKYEFTFMKS
NDQCSVGQNFLSNSPFDALASYSSEMPNDLQSNPAGNEKVS*
804 >lcl|XP_001377950.1|Plus1complement(84134396..84135586) NW_001581900 [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial PDK1 __SEG__ Chr3 {Monodelphis domestica} MRLVRYLRRAVTASPGPGPGPSPNPGPGAGPERSVPGPVDFYSRFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQS
LQELLYFKNKSAEDAKAVYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSSTHRKHIGSINPNCNVVE
VIKDGYENAKRLCDLYYVNSPELELEELNAKSPGQPMQVVYVPSHLYHMVFELFKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQ
GDLKLYSLEGYGTDAVIYIKALSTESVERLPVYNKAAWKHYNTNHEADDWCVPSSEPKDMTTFRSV*
805 >lcl|XP_001377952.2|Plus13464077..3465057 NW_001581916 mas-related G-protein coupled receptor member D-like LOC100027743 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQLESVHDTTVQTSTNWSLDPRTEAAGESVSLHWAEIPSLVIALVGLVGNSIVLWLLGFRTRRSPFSVYILNLAAADALFLGSYFGLRMWVIVGDLNLVILDQ
LGRCLLGLSYRMGLSLLAAISTERCLSVLFPLWYRCHRPKHMSAAVCAILWALQGLFSGVFGALYFLNKDDLDDFYFVFDLVQFSWFLLLTCVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLTVLVFLLCGLPLGVFYAVQFLYDFYIIPLGLTRLLACVNSSANPFIYFFLGSQWRRRGREPLRVVLQRALGEEQVELGGERGTSHPNSLDKLS*
806 >lcl|XP_001377974.2|Plus123418979..23419917 NW_001581971 olfactory receptor 5A1-like LOC100027771 __SEG__ Chr5 {Monodelphis domestica} MDMGRNETYVTMFILLGFSDQPDLQIILFVIFLVLYLMTVAWNLVLIILIRSDSHLHSPMYFFLSFLAFIDICYSSAITPKMLSDFFHEEKTISFLGCATQYFFMALMGL
TECLLLTIMAYDRYVAICSPLRYPTIMDLQVCKKMVAGAYIGGFFSSLIETVAGFHHHFCGPNIINHFFCDVPQIMALSCSNTFIGQIMLLVMVVLVGFFSFPIIIMSYG
YITVTVLKMPSAKGRMKAFNTCASHLTVVTLFYGTAFVVYFQSGSGHSPNVDKMLSVFYVILIPMLNPQIYSLRNKEIKDALKRLVKKDISP*
807 >lcl|XP_001377979.2|Plus13547348..3548247 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100027777 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQLDSVLDTTVLTSTNWSLDPLTEAARKSVSLSWTEILSLVIALVGLVRNSIVLWLLGFRTRRSPFSVYILNLAAADALFLGSHFVLCMWVIVGDLNLLVLML
LGPCLLNMSYCMGLSLLAAISTEHCLSVLFPLWYRCHRPKHMSAAVCAFLWALPGLYWGVYVALYFPNKNTFYDLYFDLNLVQFGWFSLLTCVLGVSSLMLVLRVQCSSQ
RMRPPRLYFLVLLTVLVFLLCGLPWGFFYAVWIFSRFPLMFYELSRLLACVNSSANPFIYFFLSSQWRRRGREPLRVVF*
808 >lcl|XP_001377980.1|Plus1complement(344907..346700) NW_001581921 hypermethylated in cancer 2 protein HIC2 __SEG__ Chr3 {Monodelphis domestica} MELPNYAKQLLVQLNQQRAKGFLCDVIIVVENALFRAHKNVLAASSVYFKSLVLHDNLIHLDTDMISPTAFRQVLDFMYTGRVLPAESPAEPNFHTLLNAANYLQLPELA
ALCRRKLKRPGKSFGSGRAGLPGVGRPGRGQRLSTASVIQARYPASEGRKAALAPKELPQSKGSDDELFLGGQENSHPLSRMGCKNGGGGDGASCGGSSGHSGGSEQELG
LDLSKKSPPLPPSAPGPLLGPDDLAQLSDSQHDSPAPASTNSASYPEPSGPLEDPMEVEGSGGPEENHLGLLEGPGAPPRKSLRHLARKKEWSKAEAVACASFERKEAAG
GKSCCPGDEDELDDGLPNGILGSSAGPYGEPPYPCKEELENGKELSDDSGQSDGEGPGGPAGAGPGGAGANYVYRQEGFEAVPYGDNLYVCIPCGKGFPSSEQLNAHVET
HTEEELFIKEEGGYGAGPAPEDEAEDLSAPSPAYASAAAAANEQRPFKCSGCDKSYKDPATLRQHEKTHWLTRPFPCSICGKMFTQRGTMTRHMRSHLGLKPFACDECGM
RFTRQYRLTEHMRVHSGEKPYECHLCGGKFTQQRNLISHLRMHTSPS*
809 >lcl|XP_001377982.2|Plus152075477..52076415 NW_001581970 olfactory receptor 5P3-like LOC100027780 __SEG__ Chr5 {Monodelphis domestica} MSFKNHTDVTEFIILGLTAAPTLQAILFVIFLGVYIFTLIGNLSIIILIRNSSQLHTPMYLFLSHLAFVDIGYSSSVTPIMLMNFLGEIPSLPLAGCAFQLCSVVTFGTA
ECFLLSVMAYDRYVAICNPLLYSTNMSTRVCTLLVIASYLGGCLNAWAFTGCLLSLTFCGPNKVNHFFCDYSPLLKLSCSHDFLAEIIPAVTSGSIIVVTVLIIVISYAY
ILFSVLKMHSTEGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVMIPMLNPLIYSLRNKEVKGAIRKMINRKHLLS*
810 >lcl|XP_001377990.2|Plus1complement(23452785..23453744) NW_001581971 olfactory receptor 5A2-like LOC100027795 __SEG__ Chr5 {Monodelphis domestica} MAGSRNTTTVTVFILLGFSDHPKIQIALFVVFLGIYFTTLTWNLGLIALIRMDSHLHTPMYFFLSNLSFVDICYSSSTTPKMLADTIANQKSISFLGCAVQYFVFCGMGL
TECFLLAAMAYDRYAAVCNPLLYTAIMSHTLCVKMVGGAFIGGFVSSLIETYSIYSHQFCGPNIINHFFCDLPPVLALSCSDIFLSQIVNFLVGVIVGIMSVLVVLISYG
YIVAAVLKISSTKGRSKAFSTCASHLTAVTLFYGSGLFMYMRPQSSYALSRDKMVSVFYAVVIPMVNPMIYSLRNKEIKNAMKKVIGSKCIISHHLTYF*
811 >lcl|XP_001378000.1|Plus1complement(44451190..44452947) NW_001581871 muscarinic acetylcholine receptor M3-like LOC100027809 __SEG__ Chr2 {Monodelphis domestica} MTLHSNNTTSSSFANISSSWNQGTSSPGLPPRYGSYNVSQASEAFSNNVTNHDPLGGHTVWQVVFIALLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADL
IIGVISMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRVGMMIGLAWIISFILWAPAILFWQYFVGKRTVPSGECFIQF
LSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGSEAEAAHFVNPTGSSRSCSSYELQQQTLKRSTRRKYSRCHFWFTTKSWKPSAEQMDQEHSSSD
SWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSEDLQGSEEDLRKADLERKPNKLQAQKSMEDGGSFRKNFAKLPIQLESSGDTAKSTEAIS
SVAKTTAALPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCNSCIPKTYWNLGYWLCYINSTVNPMCYALCNKTFRTTF
KMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPQEAS*
812 >lcl|XP_001378006.2|Plus123491531..23492466 NW_001581971 olfactory receptor 4D6-like LOC100027817 __SEG__ Chr5 {Monodelphis domestica} MDLRNYTRVTEFVFLELTQFRELETFLFVVFLAVYITMVLGNVLIVVTVTCESRLHTPMYFLLRNKSILDIFFSSITVPKFLVDLLSERKVISYSGCMTQIFFFHFAGGA
DIFFLSVMAYDRYLAISKPLHYISIMRKEMWVGLILASWVGGGLHSIVQVILILPLHFCGPNVLDAFYCDVPQVVKLACSDTFALELLLISNNGLVTLLWFLLLLGSYTA
ILVMLRSQTGEGRTKVLSTCTSHIIVVTLHFVPCVYIYCRPFTTLPMDTAVSINNTVITPMLNPIIYTLRNQEMKLAMRRLKRRLVSTESG*
813 >lcl|XP_001378027.2|Plus13709685..3710665 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100027842 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQLESVHDTTVQTSANSSLDPPTEAAGESVPLHWTEILSLVIALVGLVGNSIVLWLLGFRTGRSPFSVYILNLAAADALFLGSYFVLYMWGMVGDLNLLVLKL
LLFCILHMSYCVGLSLLTVISTERCLSVLFPLWYRCHRPKHTSAAVCAFLWALQGLFWGVLGALYFLKEDTFKDLYFVLYLVQFSWFVLLTCVLGVSCLTLVLRVQCSSQ
CRRPPRLYFLVLLTVLLYLLCGLPLGVIEAVWFFSSSSLMSYELSSLLACVNSCANPFIYFFLGSQWCRRGREPLRVVLQRALGEEQVGGSGEGNTSHPNTLHELS*
814 >lcl|XP_001378033.2|Plus1complement(52171264..52172202) NW_001581970 olfactory receptor 480-like LOC100027853 __SEG__ Chr5 {Monodelphis domestica} MFGNNCTSVTEFIILGLTDDPVLCVILFVIFLGVYIVTVVGNLSIIIVIRKSSQLQTPMYLFLSHLAFLDFGVSSFVTPVMLMSYLEDTTVISFGGCLAQLCCGCAFGTT
ECFLLAVMAYDRYVAICSPLLYSTNMSTRVCTLLLTTCYLGGCINACIFTGCLLNRSFCGSNEINHFFCDYSPLLELSYSQDEIAEVLPAVSDASILMVTVLVIVISYVY
ILFSVLKISSTEGRSKAFSTCTSHLTAVTLFYGSLTFIYAMPKSTYSTDQNKVVSLFYSVMIPMLNPLIYSLRNNEIKGALRKLMIRRHLFS*
815 >lcl|XP_001378042.1|Plus1complement(13883513..13885306) NW_001581926 protein SPT2 homolog LOC100027866 __SEG__ Chr4 {Monodelphis domestica} MDFQDILRVASEQQGLNIIPKRYSLAVGPPKRDPKVKGVQSAAVQAFLKRKEEELRKKALEEKRKKDELVKKRTELKHDKKARAMAKRTKDNYFGCDGIPLEEKAKKKHR
SEGPEGQEADQECSNEEDSEPPSEYRRTELKQETPLKTISKPRAPPPMNFTDLLRLAEKKQYEPLEIKVVKKIEERPRTAKELREKEFLERKHKNIERGKEKKMLEREKR
LVPPTMSKKAPSSKENVSERHGGPEDKHSSSRGSHLPHIGAEKKSRSFAASEKRTKAGSGETLQHSPSESPSLLLNGAGKSRSSSHFMGTGVSKTMLPGTQKSTEHRPSK
SPSSHPSHSKPGVVSTPHEKTRNSSAKQPGNNSKSTSGRPGVGTAPPVQSPSPRKHSGGSSSGPEQQTSGSKRLVGGSGPGGQPVSGASGRGRSTSGSGRPAGGGSGRTV
SGSGTSVRPRCTVVSETIFSKNIINRPSNGMRPPPPGYRPAVYPQGTQRPPFPPLARKRYLEDEDEEYDSEMEDFIDDDDGEPEEEISKHIREIFGYDRNKYKDESDYAL
RYMESSWTEQQKEEARSLRLGMQEDLEEMRREEKELKRQKGKKTKLR*
816 >lcl|XP_001378044.2|Plus1complement(52196498..52197436) NW_001581970 olfactory receptor 480-like LOC100027869 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTAVTELIILGLTDDPVLCIILFVIFLGVYVVTVVGNLSIIILIKNSSQLHTPMYLFLSHLAFVDILISSSITPLMLVNYIEDITLIPLGGCLAQMFCGCTFGIS
ECFLLAVMAYDRYVAICSPLLYSTNMSTRVCSLLLTTSYLGSYINACIFTGCLLNRSFCGSNEINHFFCDYSPLLKISYSQDDLAEVLPAASLATILMITVLVIVISYVY
ILFSVLKISSTKGRSKAFSTCTSHLTAVTLFYGTLTFIYAMPKSTYSTDQNKMVSVFYSVMIPMLNPLIYSLRNNEVKGALKKLMSRKYFFS*
817 >lcl|XP_001378051.1|Plus1complement(51921201..51922517) NW_001581859 alpha-2A adrenergic receptor ADRA2A __SEG__ Chr1 {Monodelphis domestica} MLHQEHPLAEGSFAPMGSLQPDSGNGSLNGTEPGGGSRETPYSLQVTLTLVSLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVM
GYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIFTVWVISAVISFPPLISIEKKGGDKQVEPLCDINDQKWYIISSSIGSFFAPC
LIMILVYVRIYQIAKRRTRVPPSRRSDGCEGAERRPNGLADPGRGEGQPLPAKLNGTGDPVPAEREVNGLDLEESSSSEHPEQTPGPPGPRKGERGLRGKNKTKMSQVKP
GDSLPRRGGEEERGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVCCSVPPTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRVDRKRIV*
818 >lcl|XP_001378052.1|Plus13819305..3820285 NW_001581916 mas-related G-protein coupled receptor member X4-like LOC100027880 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQLESVLDTTGQLSTNWSLDPPTEAARKSVSLSWMDIPSLVIALVGPVGNSIVLWLLGFRTRRSPFSVYILNLAAADALFLGSYFGLRMSVIVGDLDLLILVL
LRCCLLDLPYWVGLSLLAAISTERCLSVLFPIWYRCHRPKHTSAAVCAILWALPGLFSAAFVAHYFLKKDSFYDLFFNHYLFLFCWFLLLTCVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLSVLVFLLCGLPLGVMDAVWFLYDFYIIPYELTRLLACVNSSANPFIYFFLGSQRLRRGREPLRVVLQRALGEEQVGGDGEGDTSHPNTVDELS*
819 >lcl|XP_001378054.2|Plus1complement(52231066..52232004) NW_001581970 olfactory receptor 480-like LOC100027884 __SEG__ Chr5 {Monodelphis domestica} MSSNNCTAVTDFIILGLTDDPILCVILFVIFLGVFIVTVVGNLSIIIVIKNSSQLHTPMYLFLSHLAFVDILISSSVTPLMLMNYLEDITLIPLGGCLAQMFCGCTFGTS
ECFLLAVMAYDRYVAICSPLLYSTNMSTRVCTLLLTTSYLGSCINACIFTGCLLNRSFCGSNKINHFFCDYSPLLKLSYSQDDLAEVLPAASAATILMVTVLVIIISYVY
ILFSVLKISSTKGRSKAFSTCTSHLTAVTLYYGTLTFIYAMPKSTYSTDQNKVVSVFYIVMIPMLNPLIYSLRNNEVKGAMKKLMNRKYFFS*
820 >lcl|XP_001378061.1|Plus13880384..3881364 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100027893 __SEG__ Chr3 {Monodelphis domestica} MAESPTDEQLESVLDITGQKGTNWSLDPPNEAPREFVLDYWIIILSLVIAVVGLVGNSIVLWLLGFRSQRSPFSVYILNLAASDALFLGSYFMLHMLAIFGDVNHFVLAL
LFPCILNLSYCVGLGLLTAISTERCLSVLFPIWYKCHRPNHMSAAVCAILWALQGLFWGVFVALYFLNKDTFDNLYFDLYLVQFGWFLLLTCVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLTVLVFLLCGLPWGIIDAVRYFSSFPLMSYELSRLLACVNSSANPFIYFFLGSQWCRRGREPLRVVLQRALGEEQVGGDGARDTSHPDTLDELS*
821 >lcl|XP_001378063.2|Plus1complement(52263935..52264873) NW_001581970 olfactory receptor 480-like LOC100027897 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTPVTDFIILGLTDDPVLCDILFVIFLGVYVVTVVGNLSIIILIKNSSQLHTPMYLFLSHLAFVDILISSSVTPLMLMNYIEDIILIPLGGCLAQMFCGCTFGTS
ECFLLAVMAYDRYVAICSPLLYSTNMSTSVCTMLLTTSYLGSCINACIFTGCLLNRSFCGSNEINHFFCDYSPLLKLSYSQDDLAEVLPAASAATILMVTVLVIVISYVY
ILFSVLKISSTKGRSKAFSTCTSHLTAVILFYGTLTFIYAMPKSSYSTDQNKVVSVFYSVMIPMLNPLIYSLRNNEVKGAMKKLMSRKYFLS*
822 >lcl|XP_001378070.1|Plus13919693..3920805 NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100027908 __SEG__ Chr3 {Monodelphis domestica} MTESPTAEQLESVLNTRVQRSTAEAPGEFILSYWMDILSLFLALVGLVGNGIILWLLGFRTWRSPFSVYILNLAAADALFLGSCFGWSMWEIVGDLDFLILDLPEPCKLG
LPYWVGLSLLAEISTERCLSVLFPLWYRCHRPKHMSAVVCAILWALQGLFWGEYVALYFLNKNLLSDFNFFLFLVQFGWFVLLTPVLCLSSLTLVLRVQCSSQRRRPPRL
YLLVLLTVLVFLLCGLPRWFSNAVLFFSGSPLMPYRLSRLLACVNSGANPFIYFFLGSQWCRRGREPLRVVLQRALGEEQVWGFVQGKLPIPTLWMNYPEDENKMFRPGS
PCNDPPFLHPCGGQEPPSHLSRRGDKIPPHPLWWFLGFEL*
823 >lcl|XP_001378073.2|Plus1complement(52279949..52280878) NW_001581970 olfactory receptor 5P3-like LOC100027912 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTAVTEFIILGLTDDPVLCVILFMIFLGVYVVTVVGNLSIIIVIRKSSQLHTPMYLFLSHLAFLDLGFSSFVTPLMLMSYVREITLISFGGCLAQLCFMSTFGST
ECYLLAVMAYDRYVAICNPLLYSTNMSTSICTLLLITSYLGGCINSWTFIGCLLNRSFCGPNKINHFFCDYSPLLKISYSQDDLAEVLPAASAATLLMITVLVIVISYVY
ILFSVLTINSTKGRSKAFSTCTSHLTAVTLFYGSLTFIYAMPKSTYSTDQNKVVSIFYTVMIPMLNPLIYSLRNNEVKGALRKLLRRKI*
824 >lcl|XP_001378083.2|Plus13953943..3954902 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100027925 __SEG__ Chr3 {Monodelphis domestica} MTNYTTSAMMEFFPSTVLIYIKAEAPREFVLSYWMEILSLVFALVGLVGNSIVLWLLGFRTQRSPFSVYILNLAAADALLLGNYFGYFMCKIVGNLKSLVLKLLWRCILN
LSYSVGLSLLAVISTERCLSVLFPIWYRHHRPKHTSACVCAILWALQGLFWGVFVALHFLIMDHLSDLYFVLYLVQFGWFLLLTCVLCVSSLTLVLRVQCSSKCRHPPRF
YLLVLLTALVFLLCGLPLGIFYVVRFFSGSRLIPYKLCRLLACVNSSSNPFIYFFLGSQWCKRGREPLRVVLQRALGEEQVLGDGTRDTSQPDTLDELS*
825 >lcl|XP_001378085.1|Plus1complement(13950080..13951141) NW_001581926 tsukushin-like LOC100027927 __SEG__ Chr4 {Monodelphis domestica} MLWSLWLPLLWLASCAGAIRPCFPGCHCEVETFGLFDSFSLTRVDCSGLGSHIVPVPIPLDTTYLDLSSNRLETVNESMLTGPGYTTLVGLDLSYNHIAQISSSTFSRLR
YLESLDLSHNALVALPEESFASSPLSEVDLSSNRLAEISLDAFASRGHGKPLNVDLSHNLLARVIRPPLDRGLPNIQSLNLSWNQLQEVPDLQGLPLRYLNLDGNLVSRV
RAGAFSGLKDLIHLSLSGLRRPVELASLAFRDLPSLQVLDLSGNPSLRSAKAEVFSSLNSLQELNLSGTGLAALPDGLLKYLPAVKSITLGKDVWCVKVVKEGQYRRETG
RTRKEVLYCHDGHGAVAQAPFAL*
826 >lcl|XP_001378089.2|Plus1complement(52297088..52298026) NW_001581970 olfactory receptor 480-like LOC100027931 __SEG__ Chr5 {Monodelphis domestica} MFGNNCTAVTEFIILGLTDDPSLRIILFVIFLGVYIVTVVGNLSIIILIRKSSQLQTPMYLFLSHLAFLDLGFSSFVTPQMLTSYVREITLISFGGCLTQFCFTSTFGST
ECFLLAVMAYDRYVAICSPLLYSTNMSTRVCTLLLTTSYLSGFINAWTFTGCLLNRSFCGPNKISHFFCDYSPLLKLSYYQDDLAEVLPAVSAGLVLMITAFIIIISYVY
IVFSVLKISSSKGKSKAFSTCTSHLTAVTLYYGTITFMYAMPKSTYSTEQNKIVSLFYSMMIPMLNPIIYSLRNNEVKGALRKLMLRRHFFS*
827 >lcl|XP_001378096.1|Plus181698716..81699702 NW_001581968 serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like LOC100027943 __SEG__ Chr5 {Monodelphis domestica} MAEEKFIKELNQWMKRLKDCHIFTEKQVHTLCEKAKEILMKESNVKEVSSPVTVCGDVHGQFQDVLEIFRIGGKLPDKKYLFMGDYVDRGFSSVETMTFLLSLKVQYPEF
ITLLRGNHECREITQVYGFYDECQKKYGNANVWKYFTDLFDYLPITALVDKQVFCLHGGLSPSIDTLDHIRGLNRFKEIPQTGPMCDLLWSDPADIKEWEPSPRGAGYIF
GADVSEIFSQANGLALISRGHQLVESGFSFSHNGRVLTIFSAPNYCYRFGNQAAIMELESPTKYSFIQFEQVPHVKCSVFSLLPDSYRQPWNKHWKNFGHYFQNLLRK*
828 >lcl|XP_001378097.2|Plus1complement(52319951..52320889) NW_001581970 olfactory receptor 480-like LOC100027944 __SEG__ Chr5 {Monodelphis domestica} MFGNNCTAVTEFIILGLTDDPSLRIILFVIFLGVYIVTVVGNLSIIILIRKSSQLQTPMYLFLSHLAFLDLGFSSFVTPLMLTSYVREITLISFGGCLTQFCFTSTFGST
ECFLLAVMAYDRYVAICSPLLYSTNMSTRVCTLLLTTSYLSGFINAWTFTGCLLNRSFCGPNKISHFFCDYSPLLKLSYYQDDLAEVLPAVSAGLVLMITAFIIIISYVY
IVFSVLKISSSKGKSKAFSTCTSHLTAVTLYYGTITFMYAMPKSTYSTEQNKIVSLFYSMMIPMLNPIIYSLRNNEVKGALRKLMLRRHFFS*
829 >lcl|XP_001378108.2|Plus1complement(52339359..52340297) NW_001581970 olfactory receptor 480-like LOC100027959 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTVVTDFIILGLTDDPILCVILFVIFLGVYVVTVVGNLSIIIVIRNSSQLHIPMYLFLSHLAFVDILISSSITPLMLMNYLEDITLIPLGGCLAQMCCGCSLGPT
SCFLLAVMAYDRYVAICSPLLYSTNMSARVCTLLLTTSYLAGCINGCIFTGCLLNRSFCGSNKINHFFCDYSPLMKLSYSQDDLTEILPIISSASILMITVLVIIISYVY
ILFSVLKISSTEGRSKAFSTCTSHLTAVTLFYGTLTFIYAMPKSSYSTDQNKVVSVFYSVMIPMLNPLIYSLRNNEVKGALRKLLSRKQLFS*
830 >lcl|XP_001378109.2|Plus123834290..23835222 NW_001581971 olfactory receptor 4D9-like LOC100027960 __SEG__ Chr5 {Monodelphis domestica} MELGNHTRVKEFLFLGLSQSPKLSIVLFILLYLVYVTTLLGNLLIMVTVTCESRLHMPMYFLLRNLSVVDICFSSITAPKVLLDLLVKKKTISFNGCMTQIFFFHFLGGV
DIFTLSVMAYDRYLAISKPLHYVTLMSKGRCFGLLVASWVGGFIHSIVQISLLLPLPFSGPNVIDGFYCDVPQVLKLANTDTFTLELLMISNNGLVTTLWFFLLIVSYTV
IMVMLRSHTGEGKRKAISTCSSHITVITLHFVPCIYVYARPFTPLPSDKAISVTFTVISPLLNPMIYTLRNQEMKSAMRRLQRRLVSSER*
831 >lcl|XP_001378115.1|Plus1complement(23589717..23590685) NW_001581841 melanocortin receptor 3-like LOC100027970 __SEG__ Chr1 {Monodelphis domestica} MNATGSLLSSQNLLSKGTEEVNATILFSNQSSPGFCEQVFIKSEVFLTLGIISLLENILVILAVLKNGNLHSPMYFFLCSLAVADMLVSVSNALETVMIALLTNDYLSFD
DQLIQHMDNVFDSMICISLVASICNLLVIAIDRYITIFYALRYHSIMTVKKAITLIGAIWICCFICGIMFIVYSESKTVIVCLVTMFFAMLLLMATLYVHMFLFARLHIK
RIAALPADGAMHQHTCMKGAVTITILLGVFIFCWAPFFLHLILIITCPTNPHCICYTSHFNTYLVLIMCNSVIDPLIYAFRSLEMRKTFKEIICCCSGINSG*
832 >lcl|XP_001378120.2|Plus1complement(52358041..52358979) NW_001581970 olfactory receptor 480-like LOC100027977 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTAVNEFIILGLTDDPTLRVILFVLFLGVYAATLLGNLSIIILIRNSPQLHTPMYLFLSHLAFVDAAYSSSVTPVMLKNFLEDKSTIPLGGCVAQFFCGCTFGTA
ECFLLAVMAYDRYVAICSPLLYSTQMSTSVCTLLGITSYLGGCTNACILIGCLLNRSFCGPNKINHFFCDYAPLLKLSSYQDDLAEILPAASSGSIIVITVLIIIISYVY
ILFSVLNISSTEGRSKAFSTCTSHLTAVTLFYGTLTFIYVMPKSIYSTDQNKVVSVFYIVMIPMLNPLIYSLRNNEVKGALRKMMSRKHLFS*
833 >lcl|XP_001378121.2|Plus123849890..23850837 NW_001581971 olfactory receptor 4D9-like LOC100027978 __SEG__ Chr5 {Monodelphis domestica} MELGNHTRVKEFIFLGLTQSPELSIILFLLLFLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLRNLSIVDICFSSITTPKILLDLLVKRKTISFNGCMTQIFFFHLIGGV
DIFTLSVMAYDRYLAISKPLHYVTLMSKGRCFGLLVASWVGGFIHSIVQISLLLPLPFSGPNVIDGFYCDVPQVLKLANTDTFTLELLMISNNGLVTTLWFFLLIASYTV
IMVMLRSHTGEGKRKAISTCSSHITVVTVHLVPCIYVYARPFSALPSDRVISVTFTVISPLLNPMIYTLRNQEMKSAMRRLQKQLVPSTKELPLF*
834 >lcl|XP_001378124.1|Plus159227333..59229261 NW_001582021 frizzled-1-like LOC100027981 __SEG__ Chr8 {Monodelphis domestica} MAELGAPRTVATGGERRQLCAAALGRLPLPLLLLLLLLLLSALPSGVRTQAAGQGQGQGPGPAGQPPQPPPPQQPQAGGQQPQPQPQQQYHGERGISIPDHGYCQPISIP
LCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLRCEKFPVHGAGELCVGQNT
SDKGTPTPSLLPEFWTSNPQHGSGAGAGGGRGGGGIGSGGASSSERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTL
FTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNEKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQ
YFHLAAWAVPAIKTITILALGQVDGDILSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACY
FYEQAFREQWERSWVAQSCKSYAIPCPHHQGGGGGPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV*
835 >lcl|XP_001378134.2|Plus1complement(52374886..52375824) NW_001581970 olfactory receptor 480-like LOC100027994 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTAVNEFIILGLTDDPTLRVILFVLFLGVYAATLLGNLSIIILIRNSPQLHTPMYLFLSHLAFVDAAYSSSVTPVMLKNFLEDKSTIPLGGCVAQLFCGCTFGTV
ECFLLAVMAYDRYVAICSPLLYSTQMSTSVCTLLGISSYLGGCINAFIVFGCLLNRSFCGPNKINHFFCDYAPLLKLSSYQDDLAEILPAASSGAIIVITVLIIIISYVY
ILFSVLNISSTEGRSKAFSTCTSHLTAVTLFYGTLTFIYVMPKSIYSTDQNKVVSVFYIVMIPMLNPLIYSLRNNEVKGALRKIMSRKHLFS*
836 >lcl|XP_001378135.2|Plus123875732..23876679 NW_001581971 olfactory receptor 4D9-like LOC100027995 __SEG__ Chr5 {Monodelphis domestica} MELGNHTRVKEFIFLGLTQSPELSIILFLLLFLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLRNLSVVDICFSSITAPKVLLDLLAERKTISFNGCISQMFFFHLLGGV
DVFSLSVMAYDRYLAISKPLHYVTLMSKGRCFGLLVASWVGGFIHSIVQISLLLPLPFSGPNVIDGFYCDVPQVLKLANTDTFTLELLMISNNGLLATVWFFLLIVSYTV
IMVMLRSHTGEGKRKAISTCSSHITVVTIHFVPCIYVYARPFSALPSDRVISVTFTVISPLLNPLIYTLRNQEMKSAMRRLQKQLVPFTKELPLF*
837 >lcl|XP_001378142.1|Plus1complement(4106141..4107121) NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100028004 __SEG__ Chr3 {Monodelphis domestica} MAKSTTPEQLESVLDTTVQMSANSSLDPVAEAYGEFTLIYGIEILSLVIALVGLVGNSIVLWLLGFRTRRSPFSVYILNLAVADSLFLGSYFGLRMWRIVGNLNSLFLKL
LWLCLLGLPYSVGLSLLAAISTELCLSVLFPICYTCHRPKCMSAAVCAILWALPGLYWGAFVALYFLKNDHFYDLYFLLPLVQYGWFLLLTCVLCVSCLTLVLRVQCSSQ
RRCPPRLYLLVLLTVLVFLLCGLPRGILEALWIFTDFPIMPYRISRLLACVNSSANPFIYFFLGSQWCRRGREPLRVVLQRALGEEQVGSGGGRETSHPNTMDKLS*
838 >lcl|XP_001378144.2|Plus123889685..23890632 NW_001581971 olfactory receptor 4D9-like LOC100028007 __SEG__ Chr5 {Monodelphis domestica} MELGNHTRVKEFIFLGLTQSPELSIILFLLLFLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLRNLSIVDICFSSITTPKILLDLLVKRKTISFNGCMTQIFFFHLIGGV
DIFTLSVMAYDRYLAISKPLHYVTLMNNGRCFGLLVASWVGGFIHSIVQVSLLLPLPFSGPNVIDGFYCDVPQVLKLANTDTFTLELLMISNNGLLATVWFFLLIVSYTV
IMVMLRSHTGEGKRKAISTCSSHITVVTVHLVPSIYVYARPFSALPSDRVISVTFTVISPLLNPMIYTLRNQEMKSAIRRLQKQLVPSTKELPLF*
839 >lcl|XP_001378154.2|Plus1complement(52414282..52415220) NW_001581970 olfactory receptor 480-like LOC100028022 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTAVTEFILLGLTDDPNLCVILFIIFLGVYAVTLIGNLTIIILIRKSSQLHTPMYLFLSHLAFVDTAYSSSVTPVMLRNFLADKTSIPLGGCVAQMFCGAIFGTT
ECFLLAVMAYDRYVAICSPLLYSTNMSTKVCSLLLIASYLCGFVTAWIFIGCLLNQSFCGPNEINHFFCDYSPVLKLSSYKDDFATIFPAASSGSIIMITVLIIIISYVY
ILFSVLRISSTEGRSKAFSTCTSHLTAVILFYGTLTFIYVMPKSSYSTDENKVVSVFYIVMIPMLNPLIYSLRNNEVKGALRKMMSRKQLFS*
840 >lcl|XP_001378166.2|Plus1complement(52425962..52426900) NW_001581970 olfactory receptor 480-like LOC100028036 __SEG__ Chr5 {Monodelphis domestica} MSGNNCTAVTEFILLGLTDDPNLCVILFIIFLGVYAITLIGNLTIIILIRKSSQLHTPMYLFLSHLASVDTAYSSSVTPVMLRNFLADKTSIPLGGCVAQMFCGAIFGTT
ECFLLAVMAYDRYVAICSPLLYSTNMSTKVCSLLLIISYVGGCVTAWIFTGCLLNQSFCGPNEINHFFCDYSPVLELSSYHDDLAEILPAVFAGSVMMTTVLIIIISYIY
ILFSVLKINSTEGRSKAFSTCTSHLTAVTLFYGTTTFIYLMPKSSYSTDENKVVSVFYIVMIPMLNPLIYSLRNNEVKGALRKLMSQKHLFS*
841 >lcl|XP_001378188.2|Plus124059760..24060707 NW_001581971 olfactory receptor 10V1-like LOC100028068 __SEG__ Chr5 {Monodelphis domestica} MEEANQTEMVWFFFRPFSSHFQVQMVIFMAFLAMYLMSLSGNATIGLVVQANHSLHTPMYFFLANLAVLEIFYTSAIAPLALANLLSMGKTPISLPGCGTQMFFFVFLGG
ADCVLLAVMAYDRFVAICYPLRYTLIMNWRLCGQLMVGSLVLGFMLSLPLTTLIFRLPFCHNNEIYHFYCDMPAVMRLACTDTHTHETALYIISFIVLMIPLMLISISYV
YIVAAILRIQSVEGRRRAFSTCSSHITVVLLQYGCTSFIYLSPSSSYSPELGRVVSVVYTFITPILNPLIYSMRNKELKDALQRTLGKLLWTQCK*
842 >lcl|XP_001378198.2|Plus1complement(52483281..52484219) NW_001581970 olfactory receptor 480-like LOC100028081 __SEG__ Chr5 {Monodelphis domestica} MTGKNYTSMTEFFILGLTDDPTLRVFFFVVFLGIYIVTLLGNLSIIILIQKCSQLHTPMYLFLSHLAFVDIGFSSSVMPVMLTNFLEGITSIPLGGCVAQLCSVVTFGTT
ECFLLAVMAYDRYMAICNPLLYSTNMSTRVCTLLVITSYVGGCMNAWTFTGCLLNLSFCGPNKINHFFCDYSPLLKLSCSHVPLVEILPSFSSGSIIVITVLTITISYVY
ILFSVLKIHSSGGRSKAFSTCTSHLTAVTLYFGTITFIYVMPKSIYSTDQNKVVSVFYTVMIPMLNPLIYSLRNKEVKGAMKKLIGRKHLFL*
843 >lcl|XP_001378199.2|Plus124112166..24113134 NW_001581971 olfactory receptor 10V1-like LOC100028082 __SEG__ Chr5 {Monodelphis domestica} MGIENRTGVMQFHFHPFSTDPSVQVVLFVAFLLLYLGSLMGNFTIALTVWSERSLHTPMYFFLFVLAVLEIGYSTDIAPLTLASVVSMGKTTVSLPSCGAQMFFFIFFGG
SDCVLLAVMAYDRYVAICHPLHYNLIMSWQSCTQMALGSLVLGFLLSLPLTALICRLPFCDNAEIYHFFCDMSAVMRLACADTRVHEAALYIISVAAVAIPFLLISISYA
FILATVLRMKSAEGQRRAISTCSSHLIVVLLQYGSCTLIYLRPSSSYSPEEGRVVSLVYTFFSPLLNPLIYSMRNKEVKDAVGRLLRRQTPAQKAKAFFSEK*
844 >lcl|XP_001378208.1|Plus14216373..4217392 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100028095 __SEG__ Chr3 {Monodelphis domestica} MAEQLESVLDATVKPSTNFSSYRLAEAYREFVLDYRTEILSLVIALVGLVGNSIVLWLLAFLTQRSPFSVYILNLAMSDAIFLGSYFGLCMWAIVGDLDAAVLELILVCI
LHMSYCVGLSLLAAISTERCLSVLFPLWYRCHRPKHTSAAVCAILWALQGLYWGIIVALHFLINFHTYFYRFLFFIQFGWFSLLTCVLGVSSLTLVLRVQCSSQRRHPPR
LYVLVLLTVLVFLLCGLPWGINDAASFFRNSSSMHLGASRLLACVNSSANPFIYFFLGSQWRRRGREPLRVVLQRALGEEQVGGFEEKDTSHPNTVDKNKRLRQGRGVHE
MHPFFPHPI*
845 >lcl|XP_001378232.1|Plus1complement(4278833..4279783) NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100028125 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQWELVLNTTVQTSTKSSLDLPGEAHRKIVLPNWTEILSLVVALVGLVGNSIVLWLLAFRTQRSPFSVYILNLAAADALFLGSFFGLHMWRILGDLKPLILKL
LLFCILRLSYCVGLSLLAAISTERCLSVLFPIWYRCHRPKHMSAAVCAILWALLGLFSAAFMALRFSSMFFVLFVWFSLLTCVLCVSSLTLVLRVQCSSQHRQPPRLYLL
VLLTVLVFLLCGLPLGVIEGVWIFRRFPLMFSEVPSLLACVSSSANPFIYFFLGSQWHRRGREPLRVVLQRALGEEQVGGDGGRDTSHPNTLHELS*
846 >lcl|XP_001378247.2|Plus1complement(4330483..4331499) NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100028143 __SEG__ Chr3 {Monodelphis domestica} MAESPPAEQLESVLNTTVQLSANWSLDPLSEATGKSVLDYWIIILSLVIAVIGLVGNSIVLWLLGFRTQRSPFSVYILNLAAADALFLGSYFGLRMWVIVGELNLLLVLL
WPCLLGLPYCVGLSLLAAISTERCLSVLFPLWYRCHRPKQTSAAVCTILWALPGLYWGVFVALHFLNKNHFYNYFYPFLCFVEFGWFFLLTCVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLTVLVFLLCGLPWGVIDVVWFFSGSSLKRYRIFRLLACVNSSANPFIYFFLGSQWRKRGREPLRVILQRALGEEQVGGDGGRDTSNPNMWVNYPEDEN
KMLRQGSP*
847 >lcl|XP_001378278.2|Plus111752404..11753330 NW_001581855 olfactory receptor 287-like LOC100028179 __SEG__ Chr1 {Monodelphis domestica} MEKKNLSNLEEFILLGFPGTQGLQIFLFLLFFVMYVLTVMGNMAIITLVWIHQRLQTPMYFFLCNLSFLEIWFTTACVPKTLANFASQSKVISFISCATQMYFVFSLGCT
EYFLLAVMAYDRYLAICYPLRYSTIMTHSVSARLALVSWVCGFSAITVPTALITRLSFCASNVINHFFCDIAPWIVLSCTDTRVVELVSFGIAFCVILGSCIITLVSYIY
IISTIVRIPSAQGRHKAFSTCSSHLTVVLIWYGSTIFLHVRTSVESSLDLTKAITVLNTIVTPVLNPFIYTLRNKDVKEALRKTVSGK*
848 >lcl|XP_001378285.1|Plus1complement(7169217..7170419) NW_001581846 serine/threonine-protein kinase Kist-like LOC100028190 __SEG__ Chr1 {Monodelphis domestica} MAGSSSLWGTEPPHFLEAFGRLWQVQSWLGSGSSASVYWVRCCGTPGSPPGALKQFLPPGTTAIASATEYGFHKERAVLEQLQGHRNIMTLYGVFTIQFPPNMPSYCLLL
ELLDVSVLELLLYSSHQGCSMWMIQHCARGVLEALAFLHHEGYVHADLKSCNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDRYQAPEAEIQNCLAQAGLQSETECTS
AVDLWSLGIILLEMFSGMKLKHMIRSQEWKVNSSAIIDHIFASKAVVTSAIPAYHLRDLIKSMLHDDPSRRIPADMALCSPFFSIPFAPHIEDLVMLPTPVLRLFNVLDD
DYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAVEQDKGILSLNPPSLLAKLKLR*
849 >lcl|XP_001378286.2|Plus1complement(11767499..11768479) NW_001581855 olfactory receptor 6-like LOC100028191 __SEG__ Chr1 {Monodelphis domestica} MKYTNGTSSVKEFILLGFPSLNHLQALLFLLFCIIYVMTLIENLVIIVIVQVNRQLHTPMYFFLANLSVLEALYTSVTIPKMLANFLTEKKTISFAGCFTQLFFFLSLAS
SECFLLAAMAYDRYLAICLPLRYPTLMNPTVCLVLALSAWLSGFLASFVSIVLISQLSFCGPNVLNHFFCDISPLLKLSCSNTEAIETLDFVAALAVLMTSLCVTAFSYI
CILATVIQIPSGTGRRKAFSTCASHLVVVTVFYTTTIFMYARPRAISTFDFNKLVSIIYSVVTPLLNPIIYCLRNREVWEALAKLTRMLRFFVAAQFSSSVREKFI*
850 >lcl|XP_001378292.2|Plus1complement(4442406..4443386) NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100028197 __SEG__ Chr3 {Monodelphis domestica} MAESPTAGQPESVLDTIVQTSANSSLDPPTEAPGDFVSHYRITILSLVIALVGLVGNSIVLWLLGFRTRRSPFSVYILNLAAADALLLGSYFGLRTWRIVGDFDFVILGL
LELCFLGLPYCVGLSLLAAISTECCLCVLFPLWYRSHRPKHTSAAVCAILWALHGLLWGVIVALYFLNKDHFYDLYFVLDLVQFSWFLLLTGVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLTVLVFLLCGLPWGIIHAVWSFSGFCIMPSELSSLLACVNSSANPFIYFFLGSQWRRRGREPLRVVLQRALGEEQVAGDGGRDTSHPNTVDKLS*
851 >lcl|XP_001378294.1|Plus114354567..14356486 NW_001581926 leucine-rich repeat-containing protein 32 LRRC32 __SEG__ Chr4 {Monodelphis domestica} MKVLCHNRGLLQIPAVLHADSKALDLSHNQLQSVLETPLIFYPALQHLDLSSNQISFIQPGIFTSLSQLEHLNLSQNRLGRALPHSGHGGIGRLPRVTTLDLSGNGLYNS
MAEAFLKDAPALLTLSLAENSLTRISRWTLQGVPALEELDLHSNVIMEIEEGAFEALPHLARLNLSMNSITCISDFSLPQLQVLDLSRNSIETFQTIATDEEYQLSWLDL
RENKLSQFPDLPQHNRLIYLNVSNNLIQMHPASSLSDESPGVKDWPGGLHQAPDPSGNDSSMALSRLLVLDLSYNEIEAIPEGFFDPMTSLQFLNLSRNCLRNFEVKQEH
SLPSLDILDVSHNDLQSFAVGIHALASLRWLYLQYNALAALPPLTFSRLPKIQWVDLQRNWIHLCGTPHDLSESAVSGCIVFSSIPSLRTLNLAGNTMQRLPSGAFLHTP
LATLDLSANPGLGIMPGALAGLESSLEVLRLQENGLAALHVDLPRFTRLKQLNLSENQLSWLPAWTRQASLEELDLRNNSFSYLQSHDMSGLEGTLQRLYLAGNPLVCCG
NSWLAAVIQRGSVDIASLENLTCRHSKDFSSQEEILFLQIRPEDCEKEGLKKINLLIILIFALVLSILLVGLALFCCFCRQEFNQHFKA*
852 >lcl|XP_001378298.2|Plus1complement(11805493..11806449) NW_001581855 olfactory receptor 6-like LOC100028205 __SEG__ Chr1 {Monodelphis domestica} MFSWDNYTQVTEFILLGFPGSLGLHLSLFMLFLFVYSLTVIENIIIITLIRVNPSLHKPMYLFLSNLSFLEVWYISVTVPKMLLTFMAPEFGRISFMGCMAQLYFFLGLA
CTECALLGVMAYDRYVAICNPLRYPAIMGPGVCLRLAASSWLSGFTISLGKVFFISRLGYCGPNVMNHFFCDVSPLLNLACTDMSMAELIDFLLALLILIVPLLVTIFSY
VCIISTVLRIPSASGQQKAFSTCASHLAVVVIFYSASLFIYARPRAIYSFDYNKLVSVVYTVLTPLLNPIIYCLRNTEVKVALKKTVQRMTKKMDAVA*
853 >lcl|XP_001378299.2|Plus139431894..39432916 NW_001581861 olfactory receptor 4F6-like LOC100028206 __SEG__ Chr1 {Monodelphis domestica} MDEMNHSVVTEFVLLGLSDSWEIQLLLFLFSSVVYVASILGNMLILITVIFDPYLHSPMYFLLANLSFIDLGFCSIAAPKMICDLFRKHKVISFGGCVAQIFFSHAFGGV
EMVLLIAMSFDRYVAICKPLHYITIMNSRMCILLLILAWIIGITHSGVQLAFVVDLPFCGPNILDSFFCDLPQFIKLACTDTYRLQFMVTANSGFISLACFCVLIISYIF
ILVTVQKHASGVSSKAFSTLAAHITVVVLFFGPLIFFYTWPFHISNLDKFLAIFDAVIIPFLNPVIYTFRNKEMKMGMKRMFRRLVNFRKFHKGTGSKDCVFSWFLIVCR
KQKLSLNFQR*
854 >lcl|XP_001378315.1|Plus1complement(4490820..4491800) NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100028226 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQLESVLDTTVQASATWSLDPPTEAPGVFLHYWMDILSLVIALVGLVGNSIVLWLLGFRTQRSPFSVYILNLAAADALFLGSYFGLSIWEIVGDLNHFFLLLL
ELCLLGLPYCVGLSLLAAISTERCLSVLFPLWYRCHRPKRMSVTLCTFLWALQGLFWGLLVALYFLNKDQFYNYFYSFLPFVQFTWFSLLTCVLGVSCLTLVLRVQCSSQ
RRRPPRLYLLVLLSVLVFLLCGLPLGVFYAVRFFSSFYLIPFGLSSLLACVSSSANPFIYFFLGSQWRRRGREPLRVVLQRALGEEQVGGDGAKDTSHPNIVGRLS*
855 >lcl|XP_001378322.2|Plus139492288..39493226 NW_001581861 olfactory receptor 4F3/4F16/4F29-like LOC100028235 __SEG__ Chr1 {Monodelphis domestica} MDEVNHSVVAEFVFLGLSDSWEIQLLLFLFSSVVYVASILGNLLILITVIFDSHLHSPMYFLLANLSFIDMGGSSIAAPKMICDLFRNHKVISFGGCVAQIFFTHALGGV
EMVLLIAMAFDRYVAICKPLHYLTIMNSRMCILLLILAWITGITHSGVQLAFVVHLPFCGPNVLDNFFCDLSQIIQLACMDTYRLQFMVNANSGFISLICFCVLIISYIF
ILVTVQKQSSGVSSKALSTLAAHITVVFLFFCPLIFFYTWPHPISHLDKFLAIFDAVITPFLNPVIYTFRNKEMKLGMRRMYSRLVLLKKFS*
856 >lcl|XP_001378324.1|Plus1complement(87508793..87509986) NW_001581902 putative protein phosphatase 1 regulatory inhibitor subunit 3G-like LOC100028237 __SEG__ Chr3 {Monodelphis domestica} MPYGDPPLTEEDSVPRTLSLGDSGGGSGHNCPDALTQSPPSSPNGSPQLPERDASLLECELLDARRCFRTRSFSLPPGPILEAAKLLQQQQQQQQQQQRRLQAQPRDPGA
EWGTTAQEEELLSPSVCCTKCKKRVQFADSLGLSLASVKHFSVAEEPQVPPAVFYRHKSFPMRERDLEQIGDLLAAAFSPLLLEGSSFSPASARPLPRLQPLFQLPGPGN
AAPERLHLQRVCLEQVDCGAPLSLEVKGSGRVLYCAGPREVTVRYTFTEWRSFLDVPATLQSGQSAQLEVQGQEEQPGRALLGLRPRSSEEGAGDPGDLDTESFHFSLCL
PPGLLRENTEEGSPVFVVHFAVCYRCAQGEFWDNNAGANYTLSCSSGPCQLQHPAPVPPEGSFEGTL*
857 >lcl|XP_001378331.2|Plus139528447..39529379 NW_001581861 olfactory receptor 4F6-like LOC100028246 __SEG__ Chr1 {Monodelphis domestica} MDGMNHSIVSQFVFLGLSDSWEIQCFLFVSSSVLYVVSILGNMLILLTVSVDSHLHSPMYILLANLSLIDLGFGSVTAPKMICDLFRKQKLISFGGCIAQIFLIHAFGGT
EMVLLIAMAFDRYVAICKPLHYLTIMNPRMCIFLLIVSWIIGLIHSLIQLAFVVNLPFCGPNELDSFFCDLPRFIKLACAETYRLQFMVTANSGFISLGSFCVLIVSYIF
ILVTVLKHSSAGSSKALSTLAAHITVVILFFGPLIFFYTWPFSTSNLDKFLAIFDAVLTPFLNPVIYTFRNKEMKLAMGRVYSQLWKKVF*
858 >lcl|XP_001378341.2|Plus111921426..11922355 NW_001581855 olfactory receptor 13A1-like LOC100028258 __SEG__ Chr1 {Monodelphis domestica} MALSNQTLVAEFVLQGFSEIPQLQPFLFTAFLLLYLMALTGNLVIVMAICLDSNLHTPMYFFLANLAIIDIGCTSTVLPKLLENLVVEKKSISFNGCMTQLFFFSWFLGT
ELLLFTAMAYDRYVAICHPLHYSAMMNKMVCTFLVGSVWTTGTLSSSLQTGLMVRLTFCGPNQINHFLCEVPTLLLLSCTSTYLNDIMIVIADIYFGVVSFVLTMVSYGF
IISNILKIRTTEGKKKAFSTCSSHLIVVTIYYTTITYTYMLPGSSSSMDNGKVVALLYTTVSPTLNPLIYTLRNKDFKTALKKLFPSVL*
859 >lcl|XP_001378342.2|Plus139549761..39550699 NW_001581861 olfactory receptor 4F3/4F16/4F29-like LOC100028259 __SEG__ Chr1 {Monodelphis domestica} MSRVNHTLVSEFVFLGLSNSWYIQLFLFVLSSIFYVASMLGNSLIVLTVTSDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKRKVISFAGCITQMFFIHLIGGV
EMVLLIAMAFDRYVAICKPLHYLTIMSPRMCTVFLVTAWVIGFIHSVVQLVFVVNLPFCGPNELDSFYCDLPRFIKLACTDTYKLEFMVTANSGFISLGSFFILVISYIF
ILVTVQKHSSSGSSKALSTLSAHITVVVLFFGPLIFVYTWPHPTSHLDKFLAIFDAVLTPFMNPVIYTLRNKEMKMAMRRLCSQIGNFRKIS*
860 >lcl|XP_001378351.2|Plus124764605..24765558 NW_001581971 olfactory receptor 14I1-like LOC100028268 __SEG__ Chr5 {Monodelphis domestica} MVNFTLITEFLLVQYSSIREIQVLHAVLFLMIYLAALMGNLLTITAIATDPHLHSPMYFFLSNLSFLDVGFISVTLPKFIVNSLTGIQSISLLGCMAQIFLFIFFGSTEI
ALLLTMSYDRFVAICHPLHYGVTMTPARCLWATAGSWLSGFIYATIHTGNMFRLPFSGSNEIHQYFCDIPDVLKVASSDVLNTEFILIVAGSGFSLFCLVFLFVSYARIF
SSVFKIPSVEGRYKALSTCAPQLIILLLFLLSAIFASLKAPSDASTIQNLLVAMSYTILPPFINPIIYSLRNQRIKVALTRMIKQIILPKNEMSILE*
861 >lcl|XP_001378352.2|Plus111935383..11936312 NW_001581855 olfactory receptor 13A1-like LOC100028273 __SEG__ Chr1 {Monodelphis domestica} MASNNQTLVTEFILQGFSETPQLQILLFISFLFLYLTALTGNILIVMTTSLDSNLHTPMYFFLANLAILDIGCTSTVLPKLLENLVVEKKSISYEGCMTQLYFLSWFLGT
ELLLFTVMAYDRYVAICHPLHYNTMLSKMICVLLVSSVWVTSALVSLLHTGLMVRLTFCGPNEIQHFLCEIPSLLLLSCSSTYLNNIAIIMADVYFGVINFVLTMVSYGF
IISNILKIRTTEGKKKAFSTCSSHLMVVSIYYTTIIYTYFFPGSGSSMDNGKVVALLYTAFCPTVNPLIYTLRNKDFKTALKKMFLFIQ*
862 >lcl|XP_001378354.2|Plus139580689..39581627 NW_001581861 olfactory receptor 4F3/4F16/4F29-like LOC100028275 __SEG__ Chr1 {Monodelphis domestica} MDRKNHTVVSEFVFLGLTNSWDIQILLFLFSSLFYVSSILGNLLIVFTVISDPCLHSPMYFLLANLSFIDLGVSSVASPKMICDLFRKRKVISFFGCITQIFFIHLIGGV
EMVLLIAMAFDRYIAICKPLHYLTIMSPRMCTLLLVAAWSIGLIHSLVQLAFVVNLPLCGPNELDSFYCDLPRFIKLACTDTYRLEFMVTANSGFISLGAFFMLVISYIF
ILVTVQKHSSGGSSKALSTLSAHITVVVLFFGPLIFFYTWPFPTSHLDKFLAFFDAILTPFLNPLIYTLRNKEMKLAMKKVCRQLANFKEIS*
863 >lcl|XP_001378355.2|Plus1complement(4538074..4539090) NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100028276 __SEG__ Chr3 {Monodelphis domestica} MAESPAAEQLESVLNTTVERSTNSSLDPPTEAPGEFVSLHWAEIPSLVIALVGLVGNSIVLWLLGFRTQRSPFSVYILNLAAADALLLGSYFGYVMWEIVGDLKSLFQSL
LEDCLLNMSYCVGLSLLASISTERCLSVLFPLWYRCHRPKHTSAAVCAILWALTGLFWGVLVALYFLNKKHFFRYYILLYFIQFGWFSLLTCVLGLSSLTLVLRVQCSSQ
RRRPPRLYLLVLLTVLVFLLCGLPLGVIYAINFFSGSSLMPYELCRLLACVNSSANPFIYFFLGSQWRRRGREPLRVVLQRALGEEKVGGEGGGALPTPTLWINYSEDEN
KMLRLGSP*
864 >lcl|XP_001378360.2|Plus1complement(11958544..11959470) NW_001581855 olfactory receptor 13A1-like LOC100028283 __SEG__ Chr1 {Monodelphis domestica} MAVSNQSIVTEFFLQGFSETPPLQLALFFIFFFLYIMALIGNALIVLAISIDSGLHTPMYFFLANLAILDIGCTSTVLPKLLEILVDKKSISYDGCMTQLYFFTWFLGAE
LLLFTAMAYDRYVAICHPLHYTTMMSRMVCIFLAGSVWAISVINSSIHTGLMVQLTFCGPNKIKHFLCEIPTLLLLSCTSTYLNNMMIVIADVYFGVINFGFTMVSYGFI
ISSILKIRTKEGKKKAFSTCSSHLIVVTIYYTTITYTYFLPGSGSSMDNGKIVAVLYTTISPTLNPLIYTLRNKDFKTAVKKMFPFIQ*
865 >lcl|XP_001378378.2|Plus112002866..12003795 NW_001581855 olfactory receptor 13A1-like LOC100028313 __SEG__ Chr1 {Monodelphis domestica} MALHNQTLVTEFILQGFSETPQVQILLFISLLFLYLIALTGNILIVMAIGLNSGLRTPMYFFLANLAILDIGCTCTVLPKLLENLVVEKKSISYEGCMTQVFFLTCFLGS
ELLLFTAMAYDRYVAICHPLRYSTMMSRMVCMLLVSSVWVTGVFSSLINTGLMVRLTFCGPNEIQHFLCEIPSLLVLSCSSTYLNNIMVVIADVYFGVINFVLTMVSYGF
IISNILKIRTTEGKKKAFSTCSSHLMVVSMYYTTIIYAYIFPGSDSSVDNSKVVTLLYTAVDPALNPFIYTLRNKDFKTALKKLFSFIH*
866 >lcl|XP_001378382.2|Plus124866862..24867827 NW_001581971 olfactory receptor 14I1-like LOC100028321 __SEG__ Chr5 {Monodelphis domestica} MGNFSVITEFLLMEFSRVWELQVLHAVLFLLIYLATMMGNLLTIAAILIDPHLHSPMYFFLSNLSLLDICNISVTLPKFIINSLIGSQTITLLGCTAQVFFFLFFSATEF
ALLVAMSYDRFVAICHPLHYGLIMMPSRCLWAAAGSWVTGLIYSAVHTGNMFRLPFSGSNVVHQFFCDIPHVLKVSSSGVYQTEFVLIIASLCFLLSCFAFLIASYVRIF
SNVLKIPSVEGRYKAILTCSPQLMILILFLISVMIAVLGDTSDTSPIQNLFVAMVYAILPPLINPIIYSLRNKKVLAAMGKMLRKIFSLSMKYPSLKASKS*
867 >lcl|XP_001378384.1|Plus156592448..56593449 NW_001581976 probable G-protein coupled receptor 146-like LOC100028323 __SEG__ Chr6 {Monodelphis domestica} MLSCDTFNVTKNSEDQLLCHDFHLILSIFSLLYLIICFPIGLCYNALLVLVNLYNKATMTMPDVYFVNIAIAGLIINAVAPIYLLGPTTTKWAIWSFNSEVYITLLILFN
VSSLVIMYSTTLLSLDYYIERALPRTYMSSVYNTKHVCGFIWGGAMLTSFSSLLFYICSHVSTKLIECSKMQNKEAADAIMVFIGYVVPAIAVLYALVLILRIRKEATPL
DHDTGRLDPSVHRLLIATVCTQFVLWTPYYLTLLVNTFLVSQGKLTDEHHMRILHFIKDLSKFLAFSSSFVMPLLYRYINKNFPGKLRRLIKKMHCGHQRCSHDRATVQQ
VMT*
868 >lcl|XP_001378387.2|Plus112023855..12024784 NW_001581855 olfactory receptor 13A1-like LOC100028327 __SEG__ Chr1 {Monodelphis domestica} MASNNQTLVTEFILQVFSETPQLQLFLFISFLFLYLTAFTGNILIVMAISLDSGLHTPMYFFLANLAILDIGCTCTVLPKLLENLVVEKKSISYKGCMTQLYFLTCFLGT
ELLLFTAMAYDRYVAICHPLHYSTMMNRMVCMLLVSSVWATGSLSSLLHTGLMVRLTFCGPNEIQHFLCEIPSLLLLSCSPTYLNNIMIVIADVYFGVINFVLTMVSYGF
IISNILKIRTTEGKKKAFSTCSSHLMVVSMYYTTIIYTYIFPGSGSSMDNGKVVALLYTTVGPTLNPLIYTLRNKDFKTALKKMFLFIY*
869 >lcl|XP_001378388.1|Plus158450512..58452167 NW_001581859 inositol 1,4,5-triphosphate receptor-interacting protein ITPRIP __SEG__ Chr1 {Monodelphis domestica} MTAGIFRVCLVVVTAIINHPILFPWENATIPENEEDIIHKMRVHQEKMQLEQLRLEEEVARLEEEKEALKQATEDGQHQNESRMAWDLWSTLCMIIFLMIEVWRQDYLDG
IPPDSPGEEDDLPSSRTTFKGINLPDKVTLSHFYERCIRGTTGDAVRTREFVEGFVDDLLEALRSVCNRDSDMEVEDFIGVGSMYENWRVDKPLLCDLFVPFIPPEPYCF
RPEVWCTSKSVPLDLQGYGQIKVGWINEDSVSCICGKTKLGEDLLCLLHSKTNDKTSPGSKMEDLLCFKDSPFLDMDQVMKWFQTALTRAWHRISRKYEFDLAFGHLDTP
GSLKIKFRSGKFISFNLIPVVQCEDSDLYFVSHFPKGRPMGAPTSTTHWFLSFAVYERHFLKMITKVLPENACHLSCLQIASFLLIKQNRLTGVSGLSNYHLKTALLHLL
LARPASDWGPGHLESRLNDLLRFLEKSLVEKKLYHFFVGNQKVPDTMGIPEDFRWAEPLNLFCPFVLQRSLYQKTVDSFYEMLKNASTLISEYSLHIPADHSSSLQKRTL
A*
870 >lcl|XP_001378389.2|Plus139677188..39678147 NW_001581861 olfactory receptor 4F3/4F16/4F29-like LOC100028329 __SEG__ Chr1 {Monodelphis domestica} MDVRNQSIVSEFVLMGFTNFWAMQLFLFVFSSVLFLAIILGNSLIVLMVAFDSHLQSPMYFFLAQLSFIDMIDSCMVTPKMLADIFRKHKLISFGGCVSQIFFIHAVGAT
EMVLLLAMAFDRYIAICKPLHYLTIMNLRVCISIVVTSWTIGISHSFIQLAFVIKLPFCGPNKIDSFYCDLPRFIRLACTDTYKLQFMVTANSGFISLGAFFILIISYFV
ILISVRQHSSGGSAKALSTLSAHIAVVILFFGPCIFDYVWPFPTWPVDKYLALFDSIITPFLNPIIYTLRNNEMKVAMKKVCNLMRLRFMRLTRSQIIS*
871 >lcl|XP_001378396.2|Plus112049806..12050735 NW_001581855 olfactory receptor 13G1-like LOC100028338 __SEG__ Chr1 {Monodelphis domestica} MAWMNQTLVTEFFVQGFSEAPHLRFLFFFLFLSLYTVALSGNILIFVTISFNSTLHTPMYFFLVNLAVVDVLCTSTILPKLLENMMGRKTISFAGCMAQLYFFTWSLGAE
LLLFTAMAYDRYVAICHPLHYSTMMSKKVCLLLSTGVWSISILNTSINSSLMFRLSFCHSNVVNHFFCEIPPLLKLSCTPTYLNETMAFTADVFLAVGNFIITMLSYACI
ISSILKIRTTEGKKRAFSTCSSHLIVVSMYYSTVIYTYIRPSSSYSLDKDKIVSVIYTSVAPTLNPLIYTLRNKEVKAGLKKVFSFFKR*
872 >lcl|XP_001378417.2|Plus112099549..12100478 NW_001581855 olfactory receptor 13A1-like LOC100028371 __SEG__ Chr1 {Monodelphis domestica} MNNQTFVTEFILKGLTEIPQFQVLFFILFLFLYTIALIGNSLIVAAISLSLGLHTPMYFFLVNLALLDVICTCTSVPKLLQILGGEDKTISFGGCMTQLYFLTWSVAAEL
LLFTAMAYDRYVAICQPLHYSKMMSKQVCVSLAVAVWGISAFGATTNTSLLLRLSFCGPNVIDHFLCEIPSLLPLSCSSTYVNDIMTIVADIFFAVLNFLLTMLSYGFII
FSIMAIQTTEGKKRAFSTCSSHLIVVTMYYSTVIYVYLSPGSSYSPDKGKIMAVLYSTVSPTLNPLIYTLRNKDVKRALKKLFIFLKEK*
873 >lcl|XP_001378418.2|Plus139744827..39745786 NW_001581861 olfactory receptor 4F3/4F16/4F29-like LOC100028372 __SEG__ Chr1 {Monodelphis domestica} MDVRNQSIVSEFVLMGFTNFWVIRLFLFVFSSVLFLAIILGNSLIVLMVAFDSHLQSPMYFFLAQLSFIDMIDSCMVTPKMLADIFRKHKLISFGGCVSQIFFIHAVGAT
EMVLLLAMAFDRYIAICKPLHYLTIMNLRLCISIVVTSWMIGISHSFIQLAFVIKLPFCGPNKIDSFYCDLPRFIRLACTDTYKLQFVVTANSGFISLGAFFILIISYIV
ILISVRQHSSGGSAKALSTLSAHIAVVILFFGPCIFKYVWPFPTWPVDKYLALFDSIITPFLNPIIYTLRNKDMKVVMKKVWNLMRLRLMTLTRSQIIS*
874 >lcl|XP_001378433.2|Plus124906498..24907463 NW_001581971 olfactory receptor 14I1-like LOC100028392 __SEG__ Chr5 {Monodelphis domestica} MGNFSVITEFLLMEFSRIWELQVLHAVMFLLIYLATMMGNLLTIAAILIDPHLHSPMYFFLSNLSFLDICNISVTLPKFIIDSLIGSQTITLLGCTAQVFFFLFFATTEF
ALLVAMSYDRFVAICHPLHYGLIMMPSRCLWAAAGSWLSGLIYSAVHTGNMFRLPFSGSNVIHQFFCDIPHILKVSSSGVYQTEFALVIASSCFLLSCFAFLIASYIRIF
SNVLKIPSVEGRYKAISTCSPQLMILILLLISVMTAVLGDTSDTSPIQNLFVAMFYAILPPLINPIIYSLRNKKVIAAMGKMLRKIFSLSMKYPSLKASKS*
875 >lcl|XP_001378440.2|Plus112132312..12133250 NW_001581855 olfactory receptor 13A1-like LOC100028402 __SEG__ Chr1 {Monodelphis domestica} MLLRNQTLVTEFILQGFSDSIPIRILLFGTFFFLYTIALTGNILIIVLVIRSSSLHTPMYFFLVNLAMLDMICTTSVLPKVLENLVTEKKTISYGGCMAQVYFLTWSVSG
ELLLFTAMAYDRYVAICHPLHYSTMMSKKICVLLAVGVWSICGLNTTINTGLMIRLLFCGPNIINQFFCEIPPVLLLSCTSTYVNNIMTVLADVFFSVLNFLLTIVSYCF
IISSIMRIQTTEGKKRAFSTCSSHLIVVTMYYCTVFYAYVSPISSYSPENGKVVAVLYTAVSPTLNPLIYTLRNKDVREALRKGFRFVSEGL*
876 >lcl|XP_001378444.2|Plus124933817..24934782 NW_001581971 olfactory receptor 14I1-like LOC100028408 __SEG__ Chr5 {Monodelphis domestica} MGNFSVITEFLLMEFSRIWELQVLHAVLFLLIYLATMMGNLLTIAAILIDPHLHSPMYFFLSNLSLLDICNISVTLPKFIINSLIGSQTITLLGCTAQVFFFLFFSATEF
AVLVAMSYDRFVAICHPLHYGLIMMPSRCLWAAAGSWVTGLIYSAIHTGNMFRLPFSGSNVIHQFFCDIPHILKVSASGVYHTEFVLIIASSCFLLSCFAFLIASYIRIF
SNVLKIPSVEGRYKAISTCSPQLMILILFLISVITAVLRDTSDTSPIQNLFVAMVYAILPPLINPIIYSLRNKKILAAMGKMLRKIFSLSMKYPSLKASKS*
877 >lcl|XP_001378450.2|Plus112150187..12151119 NW_001581855 olfactory receptor 13A1-like LOC100028415 __SEG__ Chr1 {Monodelphis domestica} MAISNHSQVTEFILQGFSEHPSLRIPLFGCFLSLYLVALTGNVLIITAITLNSSLHSPMYFFLFNLATMDIICTSSVLPKVLQGLLSEENTISYGGCMTQLYFLIWSASS
ELLLFTVMAYDRYVAICHPLHYSTRMSKMLCNVLAASVWLICAFNSSIHTGLMTQLSFCGPNVITHYFCEIPPLLLLSCTSTYINRVMTVLADAFYGFINFVLTLVSYGF
IISSILKIQTTEGKKRAFSTCSSHLIVVSMYYTAVFYAYISPICGYNPERSKLAGVLYTMLSPTLNPLIYTLRNKEVKMALRKLFPCFRN*
878 >lcl|XP_001378460.2|Plus124969145..24970110 NW_001581971 olfactory receptor 14I1-like LOC100028425 __SEG__ Chr5 {Monodelphis domestica} MGNFSVITEFLLMEFSRIWELQVLHAVLFLLIYLATMMGNLLTIAAILIDPHLHSPMYFFLSNLSLLDICNISVTLPKFIINSLIGSQTITLLGCTAQVFFFLFFSATEF
AVLVAMSYDRFVAICHPLHYGLIMMPSRCLWAAAGSWLSGLIYSAVHTGNMFCLPFSGSNVVHQFFCDIPHVLKVSASDVYQTEFALVIASSCFLLSCFAFLIASYVRIF
SNVLKIPSVEGRYKAISTCSPQLMILILFLISIMIAVLGDTSDTSPIQNLFVAMVYAILPPLINPIIYSLRNKKIIAAMGKMLRKIFSLSRKYPSLKASKS*
879 >lcl|XP_001378461.1|Plus156689123..56690220 NW_001581976 G-protein coupled estrogen receptor 1-like LOC100028426 __SEG__ Chr6 {Monodelphis domestica} MEVYHAGTLSPVDCNSTTFELNQSHLLNETDPFKQANDQYEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLD
EKYYDITILCTFMSLFLQINMYSSIFFLTWMSFDRYIALAKVMRSSLFRTKHHARLSCGLIWMASISATLVPFTAVHLQHTEEVCFCFADVKEIQWLEITLGFIIPFAII
GLCYSLIVRVLIKAHKHRSLRLRRQKALRMIFAVVLVFFICWLPENVFISVHLLQRKEPAISSCKQSFRHAYPLTGHIVNLAAFSNSCLNPLIYSFLGETFREKLRLYIE
QKSNLSALNRFCHAALKSVIPENSEQTEVKFSSAV*
880 >lcl|XP_001378470.2|Plus112161522..12162451 NW_001581855 olfactory receptor 13A1-like LOC100028436 __SEG__ Chr1 {Monodelphis domestica} MASNNQTSVTEFILKSFSENPQFQIFLFSLFLGLFIVAFTGNSLIIVVISLNPGLHTPMYFFLINLALMDILSTFTVVLKLLQNLMTENTISYGGCIAQIYFLTLCIGAE
LLLFTAMAYDRYAAICQPLHYNKMMNKTVCCLLASVVWSVSGINTTIHTIITVRLSFCGPNAIDHFFCEIPPLLPLSCSSTYINNIMTFVSDMFFAIINFLFILLSYGFI
ISSILKIQTTEGKKKAFSTCSSHLIVVTMYYCTIIYIYILPALGQSLKEGKIASVFYAIVSPAVNPLIYSLRNKDVKVALNKLCPFFQK*
881 >lcl|XP_001378471.2|Plus139873881..39874843 NW_001581861 olfactory receptor 4F15-like LOC100028438 __SEG__ Chr1 {Monodelphis domestica} MTVMPTVSMDGANDSVVTEFVLLGLSASWEMKVLLFLFFFSFYVGVVLGNLFIVFTVVCDSHLHSPMYFLLANLSLIDLGLSSTTAPRMITDIFSEHKVISFPGCMIQMF
FVHVMGGTEMVLLIAMAYDRYTAICKPLHYLTIMNHKTCISFVVVAWVIGVIHAVSQFVCIVNLPFCGPNKVDSFYCDFPRVAELACTDTDWVEDVVTANSGLISMGTFF
LLIISYIFILVTVRHHSSAGLSKAFSTLSAHITVVFLFFGPCFFMYVWEFPTLSLDKFLAILDFVVTPLLNPAIYTFRNKDMKVAMKRLSRKIVSSKDSS*
882 >lcl|XP_001378479.2|Plus124996839..24997804 NW_001581971 olfactory receptor 14I1-like LOC100028446 __SEG__ Chr5 {Monodelphis domestica} MGNFSVITEFLLMEFSRIWELQVLHAVLFLLIYLATMMGNLLTIAAILIDPHLHSPMYFFLSNLSLLDICNISVTLPKFIINSLIGSQTITLLGCTAQVFFFLFFATTEF
AVLVAMSYDRFVAICHPLHYGIIMMPSRCIWAAAGSWLSGLIYSAIHTGNMFRLPFSGSNVIHQFFCDIPHVLKVSASDVYQTEFVLVIASLFFLLSCFAFLIASYVRIF
SNVLKIPSVEGRYKAISTCSPQLMILILFLISIMIAVLGDTSDTSPIQNLFVAMVYAILPPLINPIIYSLRNKKVIAAMGKMLRKIFSLSMKYPSLKASKS*
883 >lcl|XP_001378482.2|Plus112200194..12201126 NW_001581855 olfactory receptor 13A1-like LOC100028452 __SEG__ Chr1 {Monodelphis domestica} MAISNHSQVTEFILQGFSEHPSLRIPLFGCFLSLYLVALTGNVLIITAITLNSSLQSPMYFFLFNLAIMDIICTSSVLPKVLQGLLSEENTISYGGCMTQLYFLIWSGSS
ELLLFTVMAYDRYVAICHPLHYSTRMTKMLCNVLAASVWLICAFNSSVNTGLMTQLSFCGPNVITHFFCEIPPLLLLSCTSTYINRVMTVLADAFYGFINFVLTLVSYGF
IISSILKIQTAEGKKRAFSTCSSHLIVVSMYYTAVFYAYISPICGYNPERSKLAGVLYTMLSPTLNPLIYTLRNKEVKMALRKLFPCFRN*
884 >lcl|XP_001378486.2|Plus125012244..25013221 NW_001581971 olfactory receptor 14I1-like LOC100028457 __SEG__ Chr5 {Monodelphis domestica} MGNFSVIMEFFLMEYSSIRELQVLHAVLFLLIYMAALMGNFLTIAAIVTDPLLHSPMYFFLSNLSLLDIGCISVTLPKFIVNSLTYNRTISLLGCALQIFFFIFFAATEV
ALLVAMSYDRFVAICQPLHYGVIMTPARCIWVATSSWLSGFFYSAIHTGNMFRLPFSGSNVIHQFFCDIPHILKVSCSEVRNTEYVLLAASSTIVLFCFGFLIISYGYIF
STVFKMPSVEGRYKALSTCSPQLIIFFLFVLAGLATVLGPLSDTSPIQNLLISMTYAILPPFMNPIIYSLRNTKIKTALCRIIKIVFFSKKCHVLRILKCKIIHD*
885 >lcl|XP_001378490.2|Plus112218735..12219664 NW_001581855 olfactory receptor 13A1-like LOC100028464 __SEG__ Chr1 {Monodelphis domestica} MASNNQTSVTEFILKSFSENPQFQIFLFSLFLGLFIVAFTGNSLIIVVISLNPGLHTPMYFFLINLALLDILSTCTVVLKLLQNLMTENTISYGGCIAQIYFLTWFLGSE
LLLFTAMAYDRYAAICQPLHYNTMMNKTVCCLLASVVWSVSGINTTIHTIITVRLSFCGPNAIDHFFCEIPPLLPLSCSSTYINNIMVFVADMFFAIINFLFILISYGFI
ISSILKIQTTEGKKKAFSTCSSHLIVVTMYYCTIIYIYILPALGQSLNEGKIASVFYAIVSPAANPLIYSLRNKDVKVALNKLCPFFRK*
886 >lcl|XP_001378496.2|Plus125031504..25032484 NW_001581971 olfactory receptor 14I1-like LOC100028471 __SEG__ Chr5 {Monodelphis domestica} MGNFSIIMEFFLMEYSSIRELQVLHAMLFLLIYMSAVIGNFLTIAAIVTDPHLHSPMYFFLSNLSLLDIGSISVTLPKFIVNSLTHNQTISLLGCALQIFFFDFLVATEI
ALLVAMSYDRFVAICQPLHYGVIMTPARCIWVATSSWLSGFFYSAIHTGNMFRLPFSGSNVIHQFFCDIPHILKVSCSEVRNTEYVLLAASSTIVLFCFGFLIISYTYIF
STVFKMPSVEGRYKALSTCSPQLIIFFLFVLAGLVTVLGPLSDTSPIQNLLISMTYTILPPFINPIIYSLRNTKIKTALCRIIKIVFVPRRKCHVLRILKCKIIHD*
887 >lcl|XP_001378502.2|Plus112236107..12237036 NW_001581855 olfactory receptor 13A1-like LOC100028477 __SEG__ Chr1 {Monodelphis domestica} MASNNQTSVTEFILKSFSENPQFQIFLFSLFLGLFIVAFTGNSLIIVVISLNPGLHTPMYFFLRNLALMDILSTCTVVPKLLQNLMTENTISYGGCIAQIYFLSWCLGAE
LLLFTAMAYDRYAAICQPLHYNTMMNKTVCCLLASAVWAFSGTNTTINTLMTVRLSFCGPNAIDHFFCEIPPLLPLSCSPTYINNIMTFVADMFFAIINLLFILLSYGFI
ISSILKIQTTEGKKKAFSTCSSHLIVVTMYYCTIIYIYILPAFGQSLKEGKIASVFYAIVSPAVNPLIYSLRNKDVKVAFKKLCPFFRK*
888 >lcl|XP_001378516.2|Plus140024549..40025484 NW_001581861 olfactory receptor 4F15-like LOC100028496 __SEG__ Chr1 {Monodelphis domestica} MNELNHSMVSEFVFLGISSSWAIQLGLLLFSSFFYIVIVLGNIFIVLIVSTDGHLHSPMYFLLANLSFIDLCLSTVVVPKMISDLLYEHKVISFQGCITQIFFIHLMGGT
EMVLLIIMAFDRYVAICKPLHYLTIMNPKMCIFLQVSSWVIGLIHSLTQLAFVANLPFCGPNEIDSFYCDLPRFIKLACIDSYKMEFIVTANSGFISIGTICLLFISYIY
ILVTVHKHSSGLSKALSTLSAHISVVILFFGPCIFVYVWPFPTLPVDKFLAIIDFIITPVLNPSIYTFRKQDMKAVMKRLSSRLVNFRKIL*
889 >lcl|XP_001378528.2|Plus112264916..12265845 NW_001581855 olfactory receptor 13A1-like LOC100028511 __SEG__ Chr1 {Monodelphis domestica} MASNNQTSVTEFILKSFSENPQFQIFLFSLFLGLFIVAFTGNSLIIVVISLNPGLHTPMYFFLINLALLDILSTCTVVPKLLQNLMTENTISYGGCIAQIYFLTWFLGSE
LLLFTAMAYDRYAAICQPLHYNTMMNKTVCCLLASAVWAFSGTNSMIQTIVTVRLSFCGPNAIDHFFCEIPPLLPLSCSPTYINNIMAFVADMFFAIINLLFILISYGFI
ISSILKIQTTEGKKKAFSTCSSHLIVVTMYYCTIIYIYILPAFSQSLKEGKIASVFYAIVSPAVNPLIYSLRNKDVKIALNKLCPFFKK*
890 >lcl|XP_001378537.2|Plus112288547..12289479 NW_001581855 olfactory receptor 13A1-like LOC100028525 __SEG__ Chr1 {Monodelphis domestica} MAISNHSQVTEFILQGFSEHPNLRIPLFGCFLSLYLVALTGNVLIITAITLNSSLHSPMYFFLFNLAIMDIICTSSILPKVLQGLLSEENTISYRGCMTQLYFLIWSGSS
ELLLFTVMAYDRYVAICHPLHYSTRMTKMLCNVLAASVWLICAFNSSINTGLMTQLSFCGPNVITHFFCEIPPLLLLSCTSTYINMVMTVSSDAFYGFINFVLTLVSYGF
IISSILKIQTSEGKKRAFSTCSSHLIVVSMYYTAVFYAYISPICGYNPERSKLAGVLYTMLSPTLNPLIYTLRNKEVKMALRKLFPCFRN*
891 >lcl|XP_001378538.2|Plus140047460..40048398 NW_001581861 olfactory receptor 4F15-like LOC100028526 __SEG__ Chr1 {Monodelphis domestica} MNELNHSIVSEFVFLGISSSWAIQLGLLLFSSFFYMVIVLGNVFIVLTVSTDGHLHSPMYFLLANLSFIDLCLSTVAVPKMIVDLLYEHKVISFQGCITQIFFIHLMGGT
EMVLLISMAFDRYVAICKPLHYLTIMNPKMCIFLQVSSWVIGLIHSLTQLAFVANLPFCGPNEIDSFYCDLPRFIKLACIDTYKLEFIVTANSGFISIGTICLLFISYIY
ILVTVHKHSSSGLSKALSTLSAHISVVILFFGPCIFFYVWPFPTLPVDKFLAIIDFIITPVLNPSIYTFRNKDMKAAMKRLSSRLVSFRKIL*
892 >lcl|XP_001378539.2|Plus1complement(25064109..25065200) NW_001581875 somatostatin receptor type 2-like LOC100028527 __SEG__ Chr2 {Monodelphis domestica} MNLEFELLNDSFFYPNGSMVSANNSNVTDPYYDQTSNAILTFMYFMVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICR
VVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPQTAKMINVAVWGLSLLVILPIMIYAGLRNNQGGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICL
CYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAIMPTPALKGIFDLVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKATGTD
DGERSDSKQDKSRLNETTETQRTLPHGDLQTSI*
893 >lcl|XP_001378543.2|Plus125094344..25095324 NW_001581971 olfactory receptor 14I1-like LOC100028534 __SEG__ Chr5 {Monodelphis domestica} MGNFSIIMEFFLMEYSSIRELQVLHAVLFLLIYIAALMGNFLTITAIVTDPHLHSPMYFFLSNLSLLDIGCISVTVPKFIVNSLTHNQTISLLGCALQIFFFDFLAATEV
ALLVAMSYDRFVAICQPLHYGVIMTPARCIWVATSSWLTGCVYSALHTGNMFRLPFSGSNVIHQFFCDIPHVLKVSCSEVRYTAYVLLATSSTIVLFCFGFLIISYTYIF
STVFKMPSVEGRYKALSTCSPQLIIFFLFVLAALVTVLGPLSDTSPIQNLLISMTYTILPPFMNPIIYSLRNTKIKTALCRIIKIVFVPRRKCHVLRILKCKIIHD*
894 >lcl|XP_001378549.2|Plus140093111..40094049 NW_001581861 olfactory receptor 4K5-like LOC100028544 __SEG__ Chr1 {Monodelphis domestica} MDEANNSVVSEFVLLGLCNSRQLQIFLFLLFSVLYLTIILGNILIILSVINDPNLHSPMYFLLANLSFIDLWLSSVTTPKMIIDFLRESKTISFGGCLCQIFFGHFVGGG
EMVLLVAMAYDRYVAICKPLYYTTIMNQKRCIGLVVISWAVGFVHSVSQLAIIIDLTFCGSKKMDSFFCDLPLVIELACMDAHVLRLIVNIDSGILALICFFLLLISYAH
ILLTVCHHSMDGSTKALSTCTAHIMVIVIFFGPCIFIYLWPLKIASVDKFLAVFYTVFTPLLNPAIYTLRNKEMKVALKKWGSQYVNFKRNS*
895 >lcl|XP_001378556.2|Plus125134806..25135771 NW_001581971 olfactory receptor 14I1-like LOC100028551 __SEG__ Chr5 {Monodelphis domestica} MDNFTIIMEFFLMEYSSIREVQVLHALLFLFIYMGALMGNFLTIAAIVTDPHLHSPMYFFLSNLSLLDVGCISVTLPKFIVNSLTKNQTISLLGCAFQIFFFIFFAATEI
ALLVAMSYDRFVAICQPLHYEIIMTPARCICVATSSWLTGFFYSAIHTGNMFRLPFSGSNVIHQFFCDIPHILKVSCSEVHYTEYVLLASSATLLLFCLGFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIIFILFALAGLVAFLGPLSDTSPIQNLLIAMTYTILPPFMNPIIYSLRNTKIKIALWRIIKKVIFPKKDLSNFNNIKM*
896 >lcl|XP_001378564.2|Plus112335571..12336500 NW_001581855 olfactory receptor 13A1-like LOC100028561 __SEG__ Chr1 {Monodelphis domestica} MASNNQTSVTEFILKSFSENPQFQMFLFSLFLGLFIVAFTGNSLIIVVISLNPGLHTPMYFFLINLALLDILSTCTVVPKLLQNLMTENTISYGGCIAQIYFLTWCLGAE
LLLFTAMAYDRYAAICQPLHYNTMMNKTVCCLLASAVWAFSGTNITINIIMTVRLSFCGPNAIDHFFCEIPPLLPLSCSSTYINNIMTFVADMFFAIINLLFILLSYGFI
ISSILKIQTTEGKKKAFSTCSSHLIVVTMYYCTIIYIYILPALGQSLKEGKIASMFYAIVSPAVNPLIYSLRNKDVKIALKKLCPFFRK*
897 >lcl|XP_001378570.2|Plus125158192..25159142 NW_001581971 olfactory receptor 14I1-like LOC100028568 __SEG__ Chr5 {Monodelphis domestica} MGNFSIIMEFLLMEYSSTRELQVLHAVVFLLIYMATLMGNFLTIAAIVTDPHLHSPMYFFLCNLSLLDVGCISVTVPKFIVNSLTKNQTISLLGCAFQIFFFIFFAATEV
ALLVAMSYDRFVAICQPLHYEVIMTPARCICVATSSWLTGFFYSAIHTGNMFHLPFSGSNVIQQFFCDIPHILKVSCSEVRNTEYVFLAIGSTLLLFCFGFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIVLLLLVLVAVITVLGPLSDTSPIQNLLISMIYTILPPFMNPIIYSLRNTKIKIALCRIIKRVIFPQEDSIKI*
898 >lcl|XP_001378576.2|Plus1complement(12355047..>12356006) NW_001581855 olfactory receptor 13A1-like LOC100028576 __SEG__ Chr1 {Monodelphis domestica} LDLMQISTALMATMNQTLVTEFFIKGFSEAPHLQSLFFVLFLSLYTVALSGNVLIFVTISFNPALHTPMYFFLINLAMVDVLCTSTILPKLLENMVSVKTISYEGCMAQL
FFFTWSLGAELLLFTAMAYDRYVAICHPLHYSTMMSKGVCMLLATGVWIISIINTSVHTCLMMKLTFCHSNVVNHFFCEIPPLLKLSCTPTYLNETMAFTADVFLAVGNF
MITMLSYACIISSILKIRTTEGKKRAFSTCSSHLIVVSMYYSTVIYTYIRPSSSYSLDKDKVVSVIYTSVAPTLNPLIYTLRNKEVKVGLKKVFLFFRR*
899 >lcl|XP_001378577.2|Plus140149182..40150123 NW_001581861 olfactory receptor 4L1-like LOC100028578 __SEG__ Chr1 {Monodelphis domestica} MDLTNDSVISEFILLGLTNSWSLEILFFAIFFLAYALIMTGNILIIIIVIFDSHLHSTPMYFLLANLSFLDMTISTITVPKMIRDCLSEHKTISKWGCMAQMFFLHFLGG
SEMTLLIFMAVDRYVAICKPLHYTSIMNYRTLVAFVLLSWVVGFVHTMSQMAFTVNLPFCGPNLVDNIFCDLPLVIKLACADTYVLDLLVIADSGLLSLICFILLLVSYT
VILVTVHRRSSGGLTKAMSTLSAHITVVTLFFGPCIFIYASPFSSFSVDKFLSVFYSVITPLLNPIIYTLRNQDMKAAMIRLRSRHVSSRQTL*
900 >lcl|XP_001378583.2|Plus125176676..25177614 NW_001581971 olfactory receptor 14I1-like LOC100028587 __SEG__ Chr5 {Monodelphis domestica} MANFTIIMEFFLMEYSSIRELQVLHAMLFLLIYMAALMGNFLTITAIVTDPHLHSPMYFFLSNLSLLDIGCISVTVPKFIVNSLTHNQTISLLGCALQIFFFSFLAATEI
ALLVAMSYDRFVAICQPLHYGVIMTPARCIWVATSSWLTGCVYSAIHTGNMFRLPFSGSNVIHQFFCDVPHILKVSCSEVRNTEYVLLAASSTIVLFCFGFLIISYTYIF
STVFKMPSVEGRYKALSTCSPQLIIFFLFVLAALVTVLGPLSDTSPIQNLLISMTYTILPPFMNPIIYSLRNTKIKTALCRIIKTLFFPRKN*
901 >lcl|XP_001378588.2|Plus140162247..40163182 NW_001581861 olfactory receptor 4L1-like LOC100028592 __SEG__ Chr1 {Monodelphis domestica} MKNNSVLNEFILLGLTNSWELEILFFVIFFLAYTSIMAGNSLIILMVIFDSHLRSTPMYFLLANLSFLDMTLSTVTVPKMITDFLRDRKTISLWGCMAQMFLVHLLGGSE
MSLLVVMAVDRYVAICKPLHYTTIMNHRILLGSVFISWVIGFVHTMSQMAFVVTLPFCGPNVIDDVFCDLPLVMNLACTDTYILDLLVIADSGLLSLICFLLLLISYVVI
LLTVHRRSSGGLSKALSTLSAHITVVTLFFGPLILIYAWPVSSYTLDKFLSVFFSVVTPLLNPIIYSLRNREMKAAMVRLRSRHISSGPPL*
902 >lcl|XP_001378596.2|Plus125221685..25222632 NW_001581971 olfactory receptor 14I1-like LOC100028601 __SEG__ Chr5 {Monodelphis domestica} MANFTIIMEFFLMEYSSIRELQVLHAMLFLLIYMAAVIGNFLTITAIVTDSHLHSPMYFFLSNLSLLDIGCISVTLPKFIVSSLTHNQTISLLGCAVQIFFFIFLEATEI
ALLVAMSYDRFVAICQPLHYGLIMTPARCIWVATSSWLTGCVYSALHTGNMFRLPFSGSNVIHQFFCDIPHILKVSCSEVRNTEYVLLATSSTIVLFCFGFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIIFFLFVLAGMVTVLGPLSDASPIQNLLISMTYTILPPFMNPIIYSLRNTKIKTALCRIIKMVFFSKKSVMF*
903 >lcl|XP_001378601.2|Plus140189233..40190174 NW_001581861 olfactory receptor 4L1-like LOC100028609 __SEG__ Chr1 {Monodelphis domestica} MELKNHSFINEFILLGLTNSWELEIFFFVIFFLAYTSILAGNSLIILMVTFDSRLNSSPMYFLLANLSFLDMTLSTVTVPKMITDFFRERKTISLWGCMAQIFLVHLLGG
SEMVLLIVMAIDRYIAICKPLHYTTIMNWRILVGSVLLSWVVGFVHTMSQMAFAVTLPFCGPNVIDDVFCDLPLVINLACTDTYVLDLLVIADSGLLSLISFVLLLISYI
IILVTVQRRSSSGLSKALSTLSAHITVVFLFFGPSILIYAWPVSSYALDKFLSVFFSAVTPLLNPIIYSLRNQEMKTAMVRLRSRHISSRPTL*
904 >lcl|XP_001378603.2|Plus125260350..25261279 NW_001581971 olfactory receptor 14I1-like LOC100028613 __SEG__ Chr5 {Monodelphis domestica} MGNFSVITEFLLMEFSRIWELQVLHAVLFLLIYLATMMGNLLTIAAILIDPHLHSPMYFFLSNLSLLDIWNISVTLPKFIINSLIGSQTITLLGCTAQVFFCLFFAATEF
ALLVAMSYDRFVAICHPLHYGLIMMPSRCLWAAAGSWLSGLIYSAVHTGNMFRLPFSGSNVIHQFFCDIPHVLKVSASGVYQTEFVLIIASLCFLLSSFAFLIASYVRIF
SNVLKIPSVEGRYKAISTCSPQLMILILFLISIMIAVLGDTSDTSPIQNLFVAMVYAILPPLINPIIYSLRNKKVIACFLKDAQEDFFP*
905 >lcl|XP_001378606.1|Plus1complement(48905949..48907199) NW_001581837 probable G-protein coupled receptor 151-like LOC100028619 __SEG__ Chr1 {Monodelphis domestica} MLAADSDDSNFSTMNTSLARLHFAGGYQPYDSKDWRSIIPAFLVAICLVGFAGNLCVISILLHGAWRGKSSMINSLILNLSLADLFLLLFSAPLRAAAYSKGVWDMGWFV
CKSSDWFTHTCMAAKSLTIVVVAKACFMYASNPAKQMNINNCTIWTVLVVIWATACLLPLPEWFFSTIRHHEGVEMCIMDVPALAQEFTSMFGKLYPLLVFCLPLLFAGM
YFWKAYCQYQCRGTKTPNLRNQIRSRRLTMMLLSVTITSAIMWLPEWIAWLWVWHLKTGSPVPPQGFIAVSQVLMFSISSANPFIFLAMSEEFKGFKDFWKWLTSKKPLP
DPNLQGTPASNSQVISENVQSQEPLPSVPDKEKPGSSPSGEEKTDKEIPILPDVEQFWHERDIAPTEQDNDPIPWEHGSEAAGCSK*
906 >lcl|XP_001378609.2|Plus140202476..40203417 NW_001581861 olfactory receptor 4L1-like LOC100028622 __SEG__ Chr1 {Monodelphis domestica} METKNNSMINEFILLGLTNSWELEIFFFVIFFFAYMSILAGNCLIILMVIFDSHLHSTPMYFLLANLSFLDIVLSTVTVPKMIIDFFKKKKTISFWGCMAQIFLAHLFGG
TEMTLLIVMAIDRYVAICHPLHYTTIMNYRILVGGVLLSWTVGFVHTMSQMAFMVSLPFCGPNVIDDVFCDLPLVLKLACTDTSVLELLLVIFSELLSLIAFITLLMSYI
IILVTVWHRSANGLSKALSTLSAHITVVILFFGSLILIYGLPISSYTIDKFLSVFYSVITPLLNPVIYSLRNQEMKAAMTRLRSWSINFKPTF*
907 >lcl|XP_001378615.2|Plus125274842..25275777 NW_001581971 olfactory receptor 14I1-like LOC100028631 __SEG__ Chr5 {Monodelphis domestica} MDNFTIIMEFFLMEYSSIREVQVLHAVLFLLIYMGALMGNFLSITAIVTDSHLHSPMYFFLSNLSLLDVGYISVTLPKFIVNSLTKSQTISLLGCAFQIFFLTFFAATEI
ALLVSMSYDRFVAICQPLHYEIIMTPSRCFCMATSSWLTGCVYSALHTGNMFRLPFSGSNVIHQFFCDIPHVLKVSSSEVCDTEYVLLASSATLLLFCFVFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIIFILFALAGVISVLGPLSDTSPIQNLLIAMTYTILPPFMNPIIYSLRNTKIKITVWRIIKKVIFPKN*
908 >lcl|XP_001378623.2|Plus112537668..12538600 NW_001581855 olfactory receptor 13A1-like LOC100028642 __SEG__ Chr1 {Monodelphis domestica} MAKRNQTQVTEFILQGFSEHPELQIPLFSCFLSLYVVALTGNVLIIIAIVLNTNLHSPMYFFLFNLAIMDIICTSSILPKVLDGLLSEKNIISYVSCLAQLYFLTWALSS
ELLLFTAMAYDRYVAICHPLHYSTMMSKTLCSMLAAGVWGICAFNSSIHTGLMTRLSFCGPNVITHFFCEIPPLLLLSCTSTYINSVMTVLADAFYGVFNFLLTLVSYGF
IISSILKIRSVEGKKKAFSTCSSHLIVASMYYTAVFYAYISPVASYNPEKSKLAGVLYSVLSPTLNPLIYTLRNKEVKQALRKLFPFYRN*
909 >lcl|XP_001378625.2|Plus140221719..40222657 NW_001581861 olfactory receptor 4L1-like LOC100028644 __SEG__ Chr1 {Monodelphis domestica} MEMNNSMVNEFILLGLTNSWELEIFFFVVFFLAYTLILTGNFLIILMVTLDSHLHSTPMYFLLANLSLFDMSLSTVTVPKMIIDFFRERKTISLWGCMAQMFLAHLFGGS
EMTLLIVMAVDRYVAICKPLHYTTIMNRRILVGSVLLSWIVGFVHTMSQMAFMVNLPFCGPNVIDDVFCDLPLVLKLACTDTYILEMLVIADSGLLSLISFILLLVSYTI
ILVTVWHRSASGLSKALSTLAAHITVVILFFGPITLIYAWPVDSYTLDKFLSVFYSVITPLLNPIIYTLRNQEMKAAMIRLRSRHISSKPIF*
910 >lcl|XP_001378633.1|Plus1complement(61653606..61654664) NW_001582021 CX3C chemokine receptor 1-like LOC100028655 __SEG__ Chr8 {Monodelphis domestica} MTETILKATTLDYYEGITFGCDQKDILDFGMMFLPSFYSLVFAVGLVGNLLVIFALTNSSKHKSITDIYLFNLALSDLLFVTTLPFWSHYLLHEEGFNNALCKLITAFYF
IGYYSGIFFITIISIDRYVAIVLAANSLNSRTVQHGVVVSLGVWAAAILVATPQFMFTEKVDKECLSNYPDSLQHIWPILKNVEINSIGFVIPLLIMCFCYFGIIRTIFS
CKNHRKTRTIKLISVVVGVFFLFWTPYNVMIFVDTLKFYGFFESCEVKNNLRLVINVTETFAFVHCCLNPFIYAFAGEKFRKYLHHLYRKCLSILCGHDAHTQLLPPVAH
RRESTFISSSITNYTSDESILL*
911 >lcl|XP_001378637.2|Plus112556878..12557804 NW_001581855 olfactory receptor 13A1-like LOC100028659 __SEG__ Chr1 {Monodelphis domestica} MINETQTFQFILQGFSEHPELRILLFICFFFLYMVALAGNVLIITAIVFNSSLHSPMYFFLFNLATMDIICTSSILPKVLEGLVSEENAISFGGCMAQLYFLTWSASSEL
LLLTVMGYDRYVAICHPLHYNTMMSKTLCSVLASGVWGLCAFNTAIHTGLMIRLDFCGPNVVTHFFCEVPPLLLLSCSPTYVNTIMIVLADAFYGILNFAMTLVSYSLII
SSILKIRTTEGKKKAFSTCSSHLIVVSMYYTAVFYAYISPVSSYSPEKSKLAGVLYTMLSPTLNPLIYTLRNKEVKQALRKILPFTKK*
912 >lcl|XP_001378644.2|Plus125324403..25325383 NW_001581971 olfactory receptor 14I1-like LOC100028667 __SEG__ Chr5 {Monodelphis domestica} MGNFSIIMEFFLMEYSSIRELQVLHAMLFLLIYIAAVIGNFLTIAAIVTDAHLHSPMYFFLSNLSLLDISYISVTLPKFIVSSLTHNQTISLHGCAVQIFFFSFLAATEI
ALLVAMSYDRFVAICQPLHYGLIMTPARCIWVATSSWLTGCVYSALHTGNMFRLPFSGSNVIHQFFCDIPHILKVSCSEVRNTEYVLLATSSTIVLFCFGFLIISYTHIF
STVLKMPAVEGRYKALSTCSPQLIIFFLFVLTGMVTVLGPLSDSSPIQNLLISMTYTILPPFMNPIIYSLRNTKIKTALCRIIKIVFVPRRKCHVLRILKCKIIHH*
913 >lcl|XP_001378646.2|Plus175964778..75966868 NW_001581989 SLIT and NTRK-like family, member 1 SLITRK1 __SEG__ Chr7 {Monodelphis domestica} MLLWILLLETSLCFAAGNITGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQHFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFREQTFLGLDDLEYLQADFNLLRDIDPGAFRDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETSEQDLCPLKNRVDSSLAAPPAQEETCAPGPIPTPFKINGQEDPATPGAAPNGGTKIPVNWQIKIRPTAAVSAINA
KSKPSGRSMPCPEICSCDQIPDSGLKVNCNDRNVSSLADLKPKPSNVQELFLRDNKIHTIRKAHFLDYRNLNLLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFTGLLNLEYLNVEFNEIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFLYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGPE
VIMSDLKCESPEDFFKADFMFLSNDVMCPQLYAKISPTLTSHSKNSTGLAETGTHSNSYLETSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
914 >lcl|XP_001378647.1|Plus161732974..61734038 NW_001582021 c-C chemokine receptor type 8-like LOC100028671 __SEG__ Chr8 {Monodelphis domestica} MDYTPEPNVSVTTEDYYPEILASPCHTAFTQKSSSLLLALFYCLLFGFGLLGNTLVILVLVACKKLRSMTDVYLLNLAISDLLFVFSFPFLTHYTLDQWVFGNIMCKTIS
GIYYIGFFSSIFFITIMSMDRYLAIVHAVYALKVRTTRKGMAVSLLVWMVATLASVPLLVFYQVSSEEGTLKCYSFYDDRTIEWKLITHFEINILGLVIPLSILVFCYAN
ILRHLKGCQNRHKIKAIRLVLVVVVAFFLFWVPFNMMLFLNSLHNLHILDGCDLSQKLTQATQITEVISFTHCCVNPVIYAFAGEKFKNHLSEIFWKYKGYFWVCKERFT
SNEYVDRSSVNQPSSRSSITDYIL*
915 >lcl|XP_001378649.2|Plus112566272..12567213 NW_001581855 olfactory receptor 6M1-like LOC100028674 __SEG__ Chr1 {Monodelphis domestica} MEKMGNETSVKEFILEGFPAVQHLGKLLFGVLLLLYLVSIVGNTVIVMIMWMDHRLQIPMYLFLSGFSFLECCFTTSVIPKLLAIFLSGMQTISFAACLTQTFVFLTLGV
TGFFLMAVMSIDRYMAICNPLHYHSIMTMRVSFLLILFCCSIGPIVTTSLIIKVSQLSFCGSNIIKHFVCDLGPLTQLSCSDTSSIESLAFFLALFIILSSLAVTIICYI
NIALTITHLPSAKERQKAFSTCSSHLIVLFLMYGSCIFIYMKPNQANRLDTNKEAALINTVVTPVLNPFIYTLRNKQFRQALRDVIFKIKLLR*
916 >lcl|XP_001378651.2|Plus140238412..40239350 NW_001581861 olfactory receptor 4L1-like LOC100028676 __SEG__ Chr1 {Monodelphis domestica} MEMNNSVVNEFILLGLTNSWELEIFFFVVFFLAYTLILAGNFLIILMVTLDSHLHSTPMYFLLANLSLFDMSLSTVTVPKMIIDFFRERKTISLWGCMTQMFLAHLFGGS
EMTLLIVMAVDRYVAICKPLHYTTIMNRRILVGSVLLSWIVGFVHTMSQMAFMVNLPFCGPNVIDDVFCDLPLVLKLACTDTYILEMLVIADSGLLSLISFILLLVSYTI
ILVTVWHRSASGLSKALSTMAAHITVVTLLFGPVILIYAWPVGSYTLDKFLSVFYSVITPFLNPIIYSLRNQEMKAAMIRLRSRHINSKTIF*
917 >lcl|XP_001378655.1|Plus1575789..576862 NW_001581938 n-formyl peptide receptor 2-like LOC100028680 __SEG__ Chr4 {Monodelphis domestica} MENSLGLLPNASDILFPEEPSPSIIHQTFWTIALIIYCLAFVLGITGNGLVIWVTGFRMTRTVTTVLFLNLASADFAFIAFLPFIIITTALQPHWPFGWFLCKLISSLSV
FNMSASVFLLTLISLDRCVSVLWPVWARNHRTPARAAMAAVGAWIFALAISFPNIIFRSTHTEDDITLCYSDLDPWNETGVDEDQYDALAESRLWSLALSRFFLGFVIPL
VIISVCYGLIAARLCSGMKMVKSSRPFKVLTAVVAAFFLCWLPHHVMSMITVSVYQQPHLEHLLPSLSPLSSSLVFLNSCLNPLLYVFIGRDFRERLLRTLPAALERALS
EESGPTGITGNSSTSAPAATDVESQGL*
918 >lcl|XP_001378660.1|Plus161757355..61758401 NW_001582021 c-C chemokine receptor type 8-like LOC100028687 __SEG__ Chr8 {Monodelphis domestica} MDYTPEPNVSVTTEDYYPEILASPCHTAFTQKSSSLLLALFYCLLFGFGLLGNTLVILVLVACKKLRSMTDVYLLNLAISDLLFVFSFPFLTHYTLDQWVFGNIMCKTIS
GIYYIGFFSSIFFITIMSMDRYLAIVHAVYALKVRTTRKGMAVSLLVWMVATLASVPLLVFYQVSSEEGTLKCYSFYDDRTIEWKLITHFEINILGLVIPLSILVFCYAN
ILRHLKGCQNRHKIKAIRLVLVVVVAFFLFWVPFNMMLFLNSLHNLHILDGCDLSQKLTQATQITEVISFTHCCVNPVIYAFAGEKFKNHLLEIFQKYKWYSWLGKEHMA
RTSGHLFSSRSFSTDYIL*
919 >lcl|XP_001378666.2|Plus1complement(40257101..40258030) NW_001581861 olfactory receptor 4L1-like LOC100028693 __SEG__ Chr1 {Monodelphis domestica} MDLMNKSIVSEFVLLGLSGTWTLQIFYFLIFFMLYGATVVGNLLIMVTVTFSSHLHSPMYFLLGNLSFFDMCLSTVTTPKMIADLLRKQRTISLWGCVTQMFFMHLFGGA
EMTLLIAMAFDRYVAICKPLHYTSIMSRRLLYGFVLFSWIIGFIHTMSQIVLTVNLPFCGPNVVDNLFCDLPLVIKLACKDTYILELFVIADSGLLSLICFILLLVSYTV
ILVTVHNHSSGGLSKALSTLSAHITVVTLFFGPCIFIYAWPFSNFSGTKILSVFYTVITPLLNPIIYTLRNQEMKVAMKKLRIQRISSR*
920 >lcl|XP_001378668.2|Plus125362005..25362955 NW_001581971 olfactory receptor 14I1-like LOC100028699 __SEG__ Chr5 {Monodelphis domestica} MGNFTIIMEFLLMEYSSIQELQVLHAILFLLIYMATLMGNFLTIAAIVTDPHLHSPMYFFLCNLSLLDIGCISVTLPKFIVNSLIDNQIISLLGCAFQIFFFILFATTEV
ALLVAMSYDRFVAICQPLYYGVIMTPTRCVLVVTSSWLTGCVYSAIHTGNMFRLPFSGSNVIQQFFCDIPHVLKVSSSEVRDTEYVLLAISSTLVLFCFGFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIIFLLFVLVGVVTVLGPLSDTSPIQNLLISMIYTILPPFMNPIIYSLRNTKIKIAICRIIKTVIFPQEGSIKI*
921 >lcl|XP_001378675.2|Plus125377929..25378909 NW_001581971 olfactory receptor 14I1-like LOC100028711 __SEG__ Chr5 {Monodelphis domestica} MGNFSVIMEFFLMEYSSNRELQVLHAVLFLLIYIAALMGNFLTITAIVTDSHLHSPMYFFLSNLSLLDISYISVTLPKFIVNSLTHSQTISLLGCALQIFFFSFLASTEV
ALLVAMSYDRFVAICQPLHYGVIMTPARCIWVATSSWLSGFFYSAIHTGNMFRLPFSGSNVIHQFFCDIPHVLKVSCSEVRNTEYVLLATSSTIVLFCFGFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIIFFFFVLSGMVTVLGPLSDTSPIQNLLISMTYTILPPFMNPIIYSLRNTKIKTALCRIIKIVFVPRRKCHVLRILKCKIIHD*
922 >lcl|XP_001378686.2|Plus125405586..25406551 NW_001581971 olfactory receptor 14I1-like LOC100028726 __SEG__ Chr5 {Monodelphis domestica} MENFTIFTEFLLMQYSTIQELQVLHAVLFLLIYMAALMGNFLTITAIVIDPHLHSPLYFFLSNLSLLDIGYISVTLPKFIVNSLTHNPTISLHGCAVQIFFLIFFAGTEI
ALLVAMSYDRFVAICQPLHYGVIMTPARCICMATSSWLSGIFYSALHTGNMFRLPFSGSNVIHQYFCDIPHVLKVSCSEVRDIEYILLATSSTLILFCFGFLIISYTYIF
STVLKMPSVEGRYKALSTCSPQLIIFILFALSGIVTVLGPLSDTSPIQNLLISMTYSILPPFMNPIIYSLRNTKIKNALLKIIKIMFFPKKEVSGFKNIKL*
923 >lcl|XP_001378717.1|Plus1613435..614508 NW_001581938 n-formyl peptide receptor 2-like LOC100028775 __SEG__ Chr4 {Monodelphis domestica} MENSLELLPNASDTLYPVERLPSAIHQTFWIIGLIIYCLTFVLGITGNGLVIWVTGFRMTRTVTTVLFLNLASADFTFTAFLPFIIINTILQPHWPFGWFLCKLISSLSV
FNMSASVFLLTLISLDRCVSVLWPVWARNHRTPARAAMAAVGAWIFALAISFPTVIFKTTVTENGKTFCYSDLDPWNETGADEALYDALAESRLWSLVLSRFFLGFVIPL
VIISVCYALIAARLCSGMKMAKSSRPFKVLTAVVTAFFLCWLPHHVMSMITVSAYQQPHLEHLLPSLSPLSSSLVFLNSCLNPLLYVFIGRDFRERLLRTLPAALERALS
EESGPTGITGNCSNSAPAATDVESQGL*
924 >lcl|XP_001378724.1|Plus1complement(40295939..40296907) NW_001581861 olfactory receptor 4K3-like LOC100028785 __SEG__ Chr1 {Monodelphis domestica} MSDQTLRVESMEQRNFSMVAEFILLGLTESRELQIFFFVFFSIIYTVTVFGNLFIIFTVIFNSHLHSPMYFLLANLSFIDMSLASFATPKMIHNLASKHKAISYQGCMAQ
MFFLHLFGGSEMMLLVAMAIDRYIAICKPLHYSTIMNHRACFGLVLLSWTTGFVHTMSQMVFTVTLPFCGPNIVDSFFCDLPRVIKLACLDTYILELLVIADSGLLSLIC
FILLLISYSIILVTIRLHSSSGSSKALSTLSAHITVVVLFFGPCIFIYVWPFSSISTDKTLSVFYTIFTPLLNPIIYTFRNKDMKRAIRRLKHQHVNCIRTS*
925 >lcl|XP_001378734.2|Plus140348711..40349649 NW_001581861 olfactory receptor 4K13-like LOC100028801 __SEG__ Chr1 {Monodelphis domestica} MEPKNNSVVSEFILLGLTKSQNLQIFFFLGFSLVYIGIVLGNLLILITVAFDSHLHTPMYFLLANLSLIDMILGSFATPKMIVDFLREQKTISWWGCFSQMFFMHILGGS
EMMLLVAMAIDRYVAICKPLHYMTIMNHRVLLGLILTSYAVGFVHSSSQMAFMLNLPFCGPNTVDSFFCDLPLVIKLACRDTYVLQLLVIADSGLLSLICFILLLFSYTI
IIYSVRHRASGGSSKALSTLSAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKKIRNQHINSKHNL*
926 >lcl|XP_001378761.2|Plus1complement(40387907..40388881) NW_001581861 olfactory receptor 4K15-like LOC100028839 __SEG__ Chr1 {Monodelphis domestica} MNGTNHSRVSEFILLGLSDSPELQPLFFVVFSVLYVAIVMGNFLIILTVTSDPRLHSPMYFLLANLSFIDVCVASFATPKMIADFLVEQKTISFEACLAQIFFVHLFTGS
EMVLLVSMAYDRYVAICKPLHYMTIMSRRVCIILVIISWCVGFIHTTSQLAFTVNLPFCGPNKVDSFFCDLPLVTKLACLDTYVVSLLIVADSGFLSLSSFLLLVISYTV
ILITVQSRSSASMAKARSTLTAHITVVTLFFGPCIFIYVWPFSSYSVDKVLAVFYTIFTPILNPTIYTLRNKEVKAAMSKLKSRYLNTNKVSVVIRSVFSLEPK*
927 >lcl|XP_001378771.2|Plus15962232..5963248 NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100028856 __SEG__ Chr3 {Monodelphis domestica} MAESPTAEQLESVLNTTVQLSANWSLDPPTEAAGEFISLSWTEILSLFFALVGLVGNSIVLWLLGFRTRRSPFSVYILNLAAADALLLGNYFGLRMWTIVSDLNPIVLML
LWFCILNLSYWVGLSLLAAISTERCLSVLFPLWYRCHRPKHTSAAVCAFLWALQGLFWGVIVALYFLNKDTFYDLYFDLYLVQFGWFSLLTPVLGVSSLTLVLRVQCSSQ
RRRPPRLYFLVLLSVLVFLLCGLPWGIVDAVQLFSSSTVIPSELSRLLACVNSSANPFIYFFLGSQWCRRGREPLRVVLQRALGEEPVAGGGGRALPTPTLCMNYPEDEN
KMLRKGIP*
928 >lcl|XP_001378802.1|Plus11618673..1619992 NW_001582004 probable G-protein coupled receptor 152-like LOC100028893 __SEG__ Chr8 {Monodelphis domestica} MEAGSARLAPPWRPKSDLEDDYYPQGGWDTAFLVILLLTGLPANGLMAWLSGCQARRRAGKRLALFLLSLATSDFLFLVATAFQIMEIRLQGHWPLGTAACRFYYFLWGV
SYSSGLFLLAALSLDRSLTALFPRWYPCRRPSRLPLWLCSGAWVLATLFSVPWLIFPEANAWWYDLVICLDFWDTEEVPLRVLEILGGLLPFLLLLLSHVLTQIQGCRLR
RRQQPQEGRAGPPPAGFSRVASTILSAYVVLRLPYQLAQLLYLAYLWDFYPGYLLWEALVYSDYLMVLDSCLSPFLCLLASANARALLHSMLSSFAAALAEEQFGGAGPV
ASLPAQPESATVQLQPSPTSQAQPQAHPTAQAQVNPPSQPQPNLIDQPHVNPTAQPSEVPPTSTCDPTSGLPEEQPAAAPQEGPAITPAAAGDSSGDAPPETPPTPGPS*
929 >lcl|XP_001378836.2|Plus1complement(40544564..40545526) NW_001581861 olfactory receptor 4K2-like LOC100028935 __SEG__ Chr1 {Monodelphis domestica} MEAANYSGVSEFVLLGLTDSPELQAFFFVVFSVLYVVTILGNCLILLTVISIPQLHSPMYFLLGNLSFIDMCLSSFATPKMIMDFFFHRKTISFEGCISQIFFLHLFTGT
EIVLLISMSFDRYIAICKPLRYSNIMSQRVCLGLVVVSWTVGFLHTMSQLAFTLYLPFCGPNVVDSFFCDLPLVIQLSCIDIYVLGLFMISTSGMIALVSFLLLLTSYII
VLVTMKKHSSGGSSKALSTCTAHFIVVFMFFGPCIFIYVWPFTNFLVDKVLSVFYTIFTPFLNPLIYTLRNQEVKAAMRKMSNQYINFRKTAQFPRYPVQ*
930 >lcl|XP_001378844.2|Plus1complement(40559303..40560235) NW_001581861 olfactory receptor 4N2-like isoform 1 LOC100028946 __SEG__ Chr1 {Monodelphis domestica} MEQENSTVTEFTLLGLTESREIQLFVFVLIFSFYMIVLPGNLLIIITIRSDPALTAPLYFFLGNLAFLDASYSFIVAPKMLVDFLYEKKTITYQGCITQLFFLHFLGAGE
MFLLVVMAFDRYIAICQPLHYANIMNRQVCYALLLALWIGGFTHSIVQVALIVRLPFCGPNQLDNFFCDVPQVIKLACTDTFVVELLMVSNSGLLTLLCFLGLLTSYAVI
LFRVRGSSSEGKSKALSTCTTHVIIVFLMFGPAIFIYTRPFRTFPADKVVALFHTVIFPLLNPVIYTLRNQEVKSSMKKLVNRQVLCGVE*
931 >lcl|XP_001378859.2|Plus1complement(7592144..7593889) NW_001581909 frizzled-10-like LOC100028967 __SEG__ Chr3 {Monodelphis domestica} MSRLGPRLWLVLQVVGACAAISSMDIDRPGEGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMC
EQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSSMFPPLFRPQRPPSPPEQQQPKDGLGRSGCSNPGKFHHVEKSSSCAPLCTPGVDVYWS
RADKQFAVVWLAIWAVLCFFSSAFTVLTFLIDPPRFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVIQEGLESTGCTIVFLVLYYFGMASSLWWVIL
TLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL
MVRIGVFSVLYTVPATCVIACYFYERLNMDYWKVLAAQHKCRVNNQTKAPDCMMSSSIPAVEIFMVKMFMLLVVGITSGVWIWTSKTLQSWQNVCSRRLKKRSRRKPTTV
ISAGGIYKKAQHPPKGHHGKYEAATQPPTCV*
932 >lcl|XP_001378865.2|Plus1complement(40592738..40593679) NW_001581861 olfactory receptor 4M1-like LOC100028975 __SEG__ Chr1 {Monodelphis domestica} MESENYTRVTEFVLTGLSQTREVQLILFVIFLSFYLIILPGNVLIIFTIRYDAHLTSPMYFLLANLAFLDIWYSSITAPKMLVDFFAERKIISFGGCIAQLFFLHFVGAS
EMFLLTVMAFDRYAAICRPLHYATIMNKRLCCVLVACSWFGGFIHSIIQVALIIRLPFCGPNELDSYFCDITQVVRIACANTFPEELVMIFSSGLISVVCFIALLMSYAF
LLVMLKKHSGSGESTSRAMSTCYSHMTIVVLMFGPSIYIYARPFDAFSLDKIVSVFHTVIFPLLNPIIYTLRNKEVKTAMRKMINKYILCKGK*
933 >lcl|XP_001378901.2|Plus140689976..40690932 NW_001581861 olfactory receptor 11G2-like LOC100029032 __SEG__ Chr1 {Monodelphis domestica} MKNSERSNHSGSVSEFVLLGFPGPWEIQIFLFSFFSGTYILTLIGNLSIICAVNLDQKLHTPMYIFLANFSFLEICYVTSTVPNMLANFFSENKIISFTGCFLQFYFFFS
MGTTETFFLSAMAYDRYLAICQPLHYPTVMTLLKCKKMVACCWVCGFSSYLLPVYLISQLPFCDHNTIDHFICDPGPLIGLSCVPAPATEIIFSVFNSVLIFSTFLFITS
SYTLVIRVVLKIPSAEGRRKAFSTCGSHLAVVSLFYGSIMVMYVSPTSGNPAGIQKIVTLFYSVLTPLFNPLIYSLRNKEMKASLKKVFGSMKFGQHV*
934 >lcl|XP_001378948.2|Plus140798572..40799528 NW_001581861 olfactory receptor 11G2-like LOC100029100 __SEG__ Chr1 {Monodelphis domestica} MKNSERSNHSGSVSEFVLLGFPGPWETQIFLFSFFSGTYILTLIGNLSIICAVNLDQKLHTPMYIFLANFSFLEICYVTSTVPNMLANFFSENKIISFTGCFLQFYFFFS
MGTTETCFLSAMAYDRYLAICQPLHYPTVMTLLKCKKMVACCWVCGFSSYLLPVYLISQLPFCDHNTIDHFICDPGPLIGLSCVPAPATEIIFSVFNSVLIFSTFLFTTS
SYTLVIRIVLKIPSAEGRRKAFSTCGSHLAVVSLFYGSIMVMYVSPTSGNPAGIQKIVTLFYSVLTPLFNPLIYSLRNKEMKASLKKVFGSMKFGQHV*
935 >lcl|XP_001378971.1|Plus111218416..11219456 NW_001581878 galanin receptor type 1-like LOC100029143 __SEG__ Chr2 {Monodelphis domestica} MALSARLNASMNGGGLSEAQLRPFFAALCGLILLAGLLANGLMLTVLGRGSGSRGQAPGPLLALTNSLMVNITLSDLAFLAYVVPVLLLTFLRRAWWLGPAVCTSSQSFN
TGTMFCTFYSMVATAFLRYTAVAFPSVVFPAGRAARLLLCVAMWLLGFSVSLPNWLYQKVVEEGKEEAGSEPGPACLMLLGPGQTSCYFALLGALAFLPFAGGLVLTFTH
LGWLLWGPARPPDVQQHREATGLILVVLVVFVLMWGPCCVLGYVAAVGALPDTFPVFVATSLCTILAYSNCAVSPILCFCLSRPFQAGLREIFSCFTRERRVLGHGGAAQ
GLPGGERGRVGAPGGL*
936 >lcl|XP_001378978.2|Plus140848065..40849006 NW_001581861 olfactory receptor 11G2-like LOC100029152 __SEG__ Chr1 {Monodelphis domestica} MPSEARNISYTVTEFILLGFPSRWEIQVLLFCLFSVTYILTILGNMAIVCAVYWDLRLHTPMYLLLANFSFLEICYVNSDVPNMLANFLSKTKAVSFTRCLLQLYFFFSL
GTTECLFLSIMAYDRFLAICRPLHYPTIMTTKFCSHLVIFCWVYGFLWFLVPVVLVTQLPFCGPNVIDDFLCDLGPLLDLASACVPIPGTVLICGTMSSLLIFATFFYII
GSYTLVLRAVLWVPSASGRRKAFSTCSSHLAVVLLFYGSVMMTYVSPGSGQAEGMQKFTTLFYSVMTPLFNPLIYSLRNKEMKEALKKVLGRA*
937 >lcl|XP_001378982.1|Plus11715839..1716957 NW_001581923 testis-specific serine/threonine-protein kinase 1-like LOC100029158 __SEG__ Chr3 {Monodelphis domestica} MDDAAVLKRRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRRKAPTDFLEKFLPREIEILAMLNHRSIVKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALHE
DDARKKFQQLSSAVKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDNGRIMLSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSN
IKKMLRIQKEHRVNFPRSKHLTGECKDLIYRMLQPDVNRRLHIDEILSHCWVQQLKPKSQTMTSTTATKDGESSRNTGQDLLRVPEAITDKKSTARLEPKEDPKLDTVLE
KEEAVQVTRQSETLGFTAEVQHQSPQTEQGNASSPPPESVHS*
938 >lcl|XP_001378986.2|Plus140873056..40874006 NW_001581861 olfactory receptor 11G2-like LOC100029165 __SEG__ Chr1 {Monodelphis domestica} MNIYSIYNISSNMAGFILLGFPCHRENQLLLFSLFFIIYILTLLWNGAIICAVVWDQKLQTPMYILLANFSFLEIWYVTTIIPNMLVNILSKTKVISFSGCFIQFYFFFS
FGVTECFFLAIMAFDRYLAICRPLHYPTIMTGRLCTNLIISCWVLGFLWFLVPIIIISQMSFCDPKIIDHFVCDPGPLLALMCTRAPMMELTCSTLSCLNLFAPFGFIMG
SYALVLRAVLRVPSVAGRRKAFSTCGSHLAVVSLFYGSVMVMYVKPASGNDSGTQKIVTLFYSVVTPFLNPMIYSLRNREMKEALRKVLGKRELES*
939 >lcl|XP_001378991.1|Plus11721736..1722815 NW_001581923 testis-specific serine/threonine-protein kinase 2-like LOC100029170 __SEG__ Chr3 {Monodelphis domestica} MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHRSIIKTYEIFETSDGRIYIVMELGVQGDLLEFIKCRGALHE
DVARKMFRQLSSAVKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCVRDGNGRIILSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGAMPYDDSD
IKKMLRIQKEHRVDFPRSKNLTGECKDLIYRILQPDVTRRLHIDEILSHSWMQPPKPRVMPSASFKREGEGKYRAEYKQLDARPATKQEHRPDHKLGAKTQHRLLVVPEN
EETKPEERLAETSKTKDHLSGSEVGKAHS*
940 >lcl|XP_001378994.1|Plus158378887..58381292 NW_001581976 extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1-like LOC100029173 __SEG__ Chr6 {Monodelphis domestica} MAGCRWGALCVCVAAASLLYARGLARADCWLIEGDKGFVWLAICSQNQPPYESIPQQINNTIVDLRLNENKIKSVQYASLSRFGNLTYLNLTKNEITYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGILRGLSKLEYLYLQANLIETVTATAFWECPNIMNIDLSMNRIQRLDSGTFTGLSKLSICELYSNPFYCSCELLGFLKWLADFTNMTRTYDRMQC
ESPPDYSGYFLLGQGRTGYRNALSMLSSLCTDGSYTVGARFVPARYPPTTPPPEGPCAEDECFSGDGTTTLVAFHTPATKSEVRPNIWVKHLTHNSATLGVQLPTPFRKM
YVLAQFENGFSSDITSLHKEREEIELSNLITHTNYTYCVVSLGHPLRYNHTCLTICPSKPPPSPGPVPSPSTATHYIMTILGCLFGMVVVLGAVYYCLRKRRRQEEKHKK
AAGGVKKTIIELKYGPELETPAIAQLSQGPVLGADAITRIPYLPSAGEVEQYKLLESSETPKATKGNYMEVRTAEQQERRECELALPPDTQSSVAEISTIAKEVDKVNQI
INNCIDALKSESTSFQAVKSGAVSTAEPQLVLLSEQIPGKHGFLSPVYKDSYSHPLQRHHSMEGPPKRSSTSSSGSVRSPRSFRSEGSSAHKTEAKYIEKTSPTADTILT
VTPAAAILRAEAEKIRQYGEHRHSYPGSHQGEPLPPPPHDGLGGRKPSILEPLTRPRPRDLAYSQLSPQYHNLSYSSSPEYTCKPSQSIWERFKLNRKRHKDEEEYMAAG
HALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
941 >lcl|XP_001379038.2|Plus141031814..41032752 NW_001581861 olfactory receptor 11G2-like LOC100029231 __SEG__ Chr1 {Monodelphis domestica} MSVGNRVTDFILLSFRCSREMQILLFGVFSLTYVLTLMGNVSIICAVRLDHHLHTPMYIILAHFSFLEICYVNTTVPNMLANFLSETKTISFTACFLQFYFFFSTGTTEP
FFLSLMAFDRYLAICQPLHYPTIMTGHFCIKLVLFCWVMGFLCFPLPIYFMTQLPFCGPNVIDHFICDPGPLLALTCVHSPKLELSFSIIPALVIFLTFPFILGSYALVF
RAVLRVPSAAGRKKAFSTCGSHLTVVSLFFGTILFMYITPTSGHITSTQKIVTLFYSVFTPLVNPLIYSLRNKEMKTALKKVQLAMKILPNE*
942 >lcl|XP_001379054.2|Plus141062622..41063599 NW_001581861 olfactory receptor 11G2-like LOC100029259 __SEG__ Chr1 {Monodelphis domestica} MTFSNTYNGSKSITGFILLGFTYTGEIQKLLFMLLFTIYILTLLGNGSIICAVYCDERIHTPMYILLANFSFLEICYASTTVPNMLVNFFSETKVISFSGCFLQFYFFFS
LGAVECFFLAIMAFDRYLAICRPLHYHTIMTRHLRTSLVVSCWIFGFLWFPIPIIFISKLSFCGPKIIDHILCDPSPILVLTCTPAPMMEFACSFLSSMILVIPFFFIIG
TYALVLKAVLKIPSGRGQRKAFSTCGSHLVVVSLFYGSAMVIYMRPRSGQKTDTQKVVTLFYSMVTPFLNPFIYSLRNKEMKDALKKVLGYENESLCKRYLLRSS*
943 >lcl|XP_001379060.2|Plus141089467..41090402 NW_001581861 olfactory receptor 11G2-like LOC100029269 __SEG__ Chr1 {Monodelphis domestica} MDIFNTYNNSNNTAGFILLGFPCSREIQILLFILFFIIYILTLIGNGSIICAVYWDERLHNPMYILLANFSFLEIWYVTSTVPNMLVNFLSKNKTISFSGCFLQFYFFFS
LGTTECFFLAVMAFDRYLAICRPLHYPTIMTGHLCTCLVVNCWIFGFLWFLVPIIFISQMSFCGSKIIDHFLCDPGPLLALTCTRAPLIEFTCSILSSLLLFAPFLYIMG
TYALVLRAVLKVPSAAGRRKAFSTCGSHLAVVSLFYGSVMVMYVKPTSGHEAGTQKTVTLFYSVVTPFLNPLIYSLRNKEMKDALNKFLGI*
944 >lcl|XP_001379086.2|Plus141140335..41141267 NW_001581861 olfactory receptor 11H4-like LOC100029307 __SEG__ Chr1 {Monodelphis domestica} MNKSRTHIVTEFILLGFPGHWEIQILLFVLFFIVYILTMVGNGAIICAVRWDQRLHTPMYILLGNFAFLEFWYINSTLPSMLENFLSETKTISFAGCFLQLYFFSSLGTT
EIYFLCIMAYDRYLAICHPLHYPTIMTLKYCNTLMSVCWVLGFLTYSLSTIQLSQLPFCGPNIIDHIICDMDPLISLSCVPAPTTEILFYIISSLIIFLPILYILGSYFL
LLRTVLQIPSAAGRRKAFSTCGSHLAVVCLFFGSLMIMYVSPTSENSGDVQKIISLFYLVVTPFLNPLIYSLRNKEMKAALRKVIGIASE*
945 >lcl|XP_001379114.2|Plus141188977..41189909 NW_001581861 olfactory receptor 11H4-like LOC100029341 __SEG__ Chr1 {Monodelphis domestica} MNKSGVHTVTEFILLGFPGDWEIQILLFSLFLIVYILTMMGNGAIICAVKWDQRLHTPMYILLGNFAFLEIWYITSTVPSMLENFLSETKAISFAGCFLQFYFFSSLGTT
EAYFLCIMAYDRYLAICHPLHYPTKMTLQHCYTLMSVCWVLGFLSYFLSTVQLSQLTFCGPNIIDHFICDIDPLMALSCAPDPTTEILFYIISSLIIFLTIIYLFGSYIL
LLRAMLRVPSAAGRRKAFSTCGSHLAVVCLFFGSLMIMYVSPTSDNSGEVQKIITLFYTVVTPFLNPLIYSLRNKEMKAALRKVIGISSE*
946 >lcl|XP_001379158.2|Plus1complement(79553371..79554534) NW_001581835 somatostatin receptor type 1-like LOC100029402 __SEG__ Chr1 {Monodelphis domestica} MFLNDTASFPSSSSSSSPSISSGGSGPGSIAPEGTEEPGRNASQNGTLSEGQGSAILISFIYSVVCVVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPF
LVTSTLLHHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLVVILPIIVFSRTAANSDGTVACNMLMPEPAQSWLVGF
VLYTFLMGFLLPVGAICLCYVLIIAKIRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFKRS
FQRILCLSWMENTEEPLDYYATALKSRGYSVEDYQPDNVESRGVYGNGTCTSRISTL*
947 >lcl|XP_001379212.1|Plus1complement(27900450..27901619) NW_001581971 putative G-protein coupled receptor 44-like LOC100029467 __SEG__ Chr5 {Monodelphis domestica} MLSNITVCPVLEYMRNDTGPGNSSNRYIDYASVTLHGLVSLLGMAENAIILFVVGCHMRQTVVTTWVLHLALSDLLATASLPFFTYFLAVGHSWQLGTTFCRLHSSIFFL
NMFASGFLLSAISLDRCLQVVKPIWAQNQRTVAGAQKVCLVLWGLAVLNTIPYFLFRDTIKRQDERVMCYYNVLLYNPGPDPHAACGRRQMALAVSKFLVAFAIPLVIIA
ACYLAVSLQVRYRCRRRPSRFVRLVMAVIAAFVLCWLPYHVFSLLEVQAHYDPSLRRLVKLALPFVTSLAFINSVINPFLYVLTCPDVLRKLRRSLRCVLESVLVEDSEL
GGGGSGRRRRSSQGASLFRSPSTSSSTAGYRSRWAACLLTKITRQPRRTSASTEPQEGK*
948 >lcl|XP_001379217.2|Plus117089982..17091238 NW_001581855 immunoglobulin superfamily containing leucine-rich repeat protein-like LOC100029479 __SEG__ Chr1 {Monodelphis domestica} MKQLHLLWLAGFLGSVSGCPEVCDCGEKYVFQIADCAYRDLQSVPPGFPANVTTLSLSANRLGDLEAGAFEEVPLLQSLWLAHNEIRVVAPGSLTSLVYLKSLDLSHNLI
SNFSWNDLHNLSALQLLKMDSNELAVIPRDAFKNLGDLRSLQLNHNRFLTLVDGTFEGLTSLSHLQINDNPFNCTCGLLWLKVWAVATAVSIPEQDNIACSSPPFLKGIP
LGRLPPLHCAPPTVQLTYQPNQDGAELRDGFVLALHCDTDGQPPPEVQWRIQTPGGKVEITSPNVGPDGRVPGVAGSPQPRFQAFANGSLLIPGFGKQEEGTYSCRATNE
LGSAEGSVNVALASPGEASEDALGRKFHGKAVEGKGCYTVDNEVQPSGPEDNVVIIYLSSTNPKKNKANSLELLGPWILLLCFSHLIF*
949 >lcl|XP_001379297.2|Plus141982909..41983862 NW_001581861 olfactory receptor 6S1-like LOC100029586 __SEG__ Chr1 {Monodelphis domestica} MGRNQSSGVTEFILAGFPTLHSMQAELGSIFLLVYLLTLMGNMVIISVVGVDPRLQTPMYFFLGNLSCLEILITSVIIPKMLTNFFSGRHTISFNACIVQFYFYFCLGAS
EFLLLAIMSVDRYLAVCHPLRYPILMRGAICIRLALICWAGGLLPVLGPTVVVALLPFCGQDVVIQHFFCDSGPLLRLACTNTKQLEEVDFALASVVIMISLLLTATSYG
HIVLAVFRIPSASGRQKAFSTCTSHLMAVTLFYGSAIFLYVRPSQSSSVGTNWAVTVVTTFVTPLMNPVIYTLRNERVKEALRDMLKKGLAACSGHH*
950 >lcl|XP_001379572.2|Plus1complement(43308513..43309454) NW_001581861 olfactory receptor 10G3-like LOC100029949 __SEG__ Chr1 {Monodelphis domestica} MERTNSTPVTEFILTGIPYPPKLRTFLFLFFLVIYTLTQMGNLIIFLTVCIDPQLHARPMYIFLGALSVIDMGISSIIVPRLIMNFTPGIKPISFGGCVAQLYFYHFLGS
TQCFLYTLMAYDRYLAICRPLHYPVLMTSKMCCLMVTGAWVAGSIHGAIQAILTFRLPYCGPNQVDYFFCDIPAVLRLACADTTVNEQVTFVDIGVVVATCFSLILLSYI
YIIRAILRIRTADGRQRAFSTCGAHVTVVTIYYVPCAFVYLRPEANSPLDGAAALFPTAITPFLNPLIYTLRNQEVKLALKRMVGDRTTMSKN*
951 >lcl|XP_001379577.1|Plus1complement(66771105..66772115) NW_001582021 chemokine XC receptor 1-like LOC100029955 __SEG__ Chr8 {Monodelphis domestica} MTSVGYSDDQLSSTPFTDYDTEGILCENHENFESMTLSHTVFYSLVFFLSLVGNSLVLWVLVKYESLESLTNVFILNLCLSDLVFSCLLPFWVVVHYYDWIFGEFFCKLL
NMLFSISLYSSIIFLMVMTTHRYISVVHPLSNLGGHSCWSRVGIILGIWMASIMVSVPDTIFHTVLTDKSCDFSEPKWFLLSTYLHNLFFIFSLVVTLFCYVQILRTLFQ
SHTRRRHRTVRLIFTIVVAYFLSWAPYNMVLFLQTLVKLGYIQNCEVIKKLNYWEHICREFAFSHCCFNPVLYVFVGIKFRRHLKALCRQIWPSQWSLTSSPRSPRAFLY
EDASFF*
952 >lcl|XP_001379584.2|Plus1complement(43332427..43333374) NW_001581861 olfactory receptor 10G2-like LOC100029962 __SEG__ Chr1 {Monodelphis domestica} MEKTKNNSMESKVTEFILLGLSHPPNLRTFLCLVFLVIYILTQLGNMLILLTVWADPQLHARPMYILLGVLSFLDMWLSSVIVPRIILNFTHASKAMSFAGCVAQLYSFH
FLGSTQCFLYTLMAYDRYLAICRPLHYPVLMNGRLCTMLVAGAWVAGSIHGSIQATLTFRLPYCGPNQVDYFFCDIPAVLRLACADTTINELVTFVDIGVVAASCFLLIL
LSYANIVYAILQIRTADGRRKAFSTCGSHLTVVTVYYVPCIFIYLRPGSKSPLDGAVAVFYTVVTPLLNPLIYTLRNKEVKSALRKLAGSGGTTK*
953 >lcl|XP_001379588.1|Plus1complement(66837149..66838240) NW_001582021 c-C chemokine receptor type 1-like LOC100029967 __SEG__ Chr8 {Monodelphis domestica} MGTSAPLLDFTVPEYNSSFPEYYYFGEDAIPCFKYNIKELASKFLPPLYSLVFIVGLLGNAAVVLILTKYKRLTSMTNIYLFNLAISDLLFLVTIPFWIHYEKQNDWVFG
NAMCKLLTGLHYLGLYSEIFFIILLTVDRYVAIVHAVFAIRVRRVVLSVTTSIITWVIALLVSLPDIIFTKTQWEFTHYTCSLHFPHETARIWRKFQALKLNFLGLILPM
WIMIACYTGIIRILLKRRNEKKWKAVKLIFAIMIIFFLFWTPYSITILISAFDEFIFTLDCEKSKQLDLAIQVTEVIAFTHCCVNPVIYAFIGERFQKYLSHFARNHIAV
HLCRRVPSFLKDRLERASSISPPTGEHEISDEF*
954 >lcl|XP_001379593.2|Plus1complement(43356051..43357007) NW_001581861 olfactory receptor 10G2-like LOC100029972 __SEG__ Chr1 {Monodelphis domestica} MEKVKNNSVETTVTDFILLGLSHPPNLRTFLCLVFLVIYTLTQLGNILILLTVWVDPQLNARPMYILLGVLSFLDMWLSSVIVPLIILSFTPASKAIPFAGCVAQLYFFH
FLGSTQCFLYTLMAYDRYLAICRPLHYPVLMNGRLCTMLVAGAWVAGSIHGSIQATLTFRLPYCGPNLVDYFICDIPAVLRLACADTTINELVTFVDIGVVAASCFLLIL
LSYANIVYAILQIRTADGRRKAFSTCGSHLTVVTVYYVPCIFIYLRAGSKSPLDGAVAVFYTVVTPLLNPLIYTLRNQEVKAALKRLTRARGTHNEKK*
955 >lcl|XP_001379603.2|Plus143402274..43403212 NW_001581861 olfactory receptor 4E2-like LOC100029982 __SEG__ Chr1 {Monodelphis domestica} MEGFNQTRVTEFVFRGLTDNSMLEMLFLVTFSATYMLTLFGNLLIVVTIMFTPRLHTPMYFFLSNLSFIDICLSSVTVPKMLEGFLLERKVTSFDACIAQLFFLHLFACA
EIFLLTIMAYDRYVAICTPLHYSTVMNMKVCAQLVFALWLGGTIHSLVQTVLTTRLPYCGPNIIDSYFCDVPSVIKLACTDTYLTGVLIVSNSGTISTVSFLALVTSYTV
ILVSLRKQSAEGRRKALSTCTAHFTVVVLLFGPCIFIYTRPDTSFSIDKVVAVFYTVITPLLNPLIYTLRNEEVKNSMKQLRQHQVFTKVFT*
956 >lcl|XP_001379609.1|Plus166906739..66907803 NW_001582021 c-C chemokine receptor type 3-like LOC100029988 __SEG__ Chr8 {Monodelphis domestica} MATYSMDINEEATTFDYEFSTPCQKMNIKELGAKFLPPLYSFVLIVGLLGNILVVLILTKYKRFKSMTNIYLFNLAISDLLFLFTLPFWIDYARKNDWVFGHTMCKILSG
LYYMGLYSEIFFIVLLTIDRYLAVVYAVFALKARTVTFGIFTSIVTWGLSALAALPEVIFHESQEDLENHICSPRYPEDNEATWKRFQALRMNILGLAIPLAIMIICYTG
IIKKLLSCRNEKKYKAVKLIFVIMIVFFLFWAPYNLTLLLNAFQSSFFTADCERSKQLDLAMQITEVIAYTHCCVNPVIYAFVGERFRKYLCLFVRRHIAVHLCKYIPFL
PGEKLERVSSISPSTGEQELSAAF*
957 >lcl|XP_001379612.2|Plus1complement(43420746..43421690) NW_001581861 olfactory receptor 4E1-like LOC100029992 __SEG__ Chr1 {Monodelphis domestica} MEEAILPNQTSVSYFRLRGLSTNQKVQMTVFAIFLIFYILTLMGNILIVITIIYDRRLHTPMYFFLSNLSFIDVCHSTVTVPKMLVDTWSEKKLISFDACVVQMFFLHLF
ACTEIFLLTVMAYDRYVAICNPLHYMTVMNWKVCVLLAAALWTGGTIHSVALTSLTIKLPYCGPHEIDNFFCDVPQVIKLACTDTRIIEILIVSNSGLISVVCFVVLVVS
YAVILVSLRKRISAGRRKALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKVVSVFFTAVTPLLNPIIYTLRNEDMKNALSKLTGRKEGKEEK*
958 >lcl|XP_001379621.2|Plus167111080..67112138 NW_001582021 c-C chemokine receptor type 5-like LOC100030002 __SEG__ Chr8 {Monodelphis domestica} MDNESTTPFYYPDYPIEEPCQKLDVKHTASRLLPPLYSLVFIFGFVGNALVFLVLIRCKKLKSMTDIYLLNLAISDLLFIVTLPFWAHYAADQWIFGDALCKVLTGFYHM
GFFGGVFFIILLTMDRYLAIVHAVFALKARTVTFGILTSVITWVVAGLASLPAIIFTKSQKEGIQHTCSPHFPSEQFSAWKNFQTLKMNLLGLVVPLLVMIICYSGILKT
LLRCRNEKKKHKAVRLIFVIMIVYFLFWAPYNLVLLLNTFQAFFGLDNCESSKRLDRAIQITETLGMTHCCINPVIYAFVGEKFRRYLSTFFHKYIVRRFCKRCPIFQGE
ALDRVSSMYTRSTGEQDISTGL*
959 >lcl|XP_001379629.1|Plus1107924522..107925577 NW_001581900 proto-oncogene serine/threonine-protein kinase mos-like LOC100030012 __SEG__ Chr3 {Monodelphis domestica} MPSPVPLARYLPREFSPSVDLRPCSSPLELPGKRGKLFLEGTPSPRARRLPRRLAWCSIDWDQLCFLRKLGTGGFGSVYKGTYRGLTVAIKQVKKCNKNRLASRQSFWAE
LNVARLCHKNVVRVLAASTCTPRGYNSLGTIIMEYWGHTTLYDVIYGASSAPDNESSAEEPLDLGRCLQYSLDVVNGLLFLHSQGIVHLDLKPANILIGEQEICKIGDFG
CSQKLEDLLGLSSHHCHLGGTYTHRAPELLKGEAVTDKADIYSFAITLWQMVTKEVPYSGDHQYILYAVVAYNLRPALTSSVFTDSLPGQRLEHIIQCCWTADTLVRPSS
DLLLGDLNSLHANLADLNARS*
960 >lcl|XP_001379637.2|Plus1complement(62138144..62139073) NW_001581871 olfactory receptor 10J1-like LOC100030024 __SEG__ Chr2 {Monodelphis domestica} MQKKNHTMVTMFTFQGFSSFHEHQITLFAVFLTLYIITLASNVIIVAVICIDRYLHTPMYFFLSILSTSETLYTLVIIPRMLSSLIGWNQPISLEGCATQMFFFVTLAIN
NCFLLTAMGYDRYVAICNPLRYMIVMNKKVCAHLVGGACVIGLTMASVQVTSIFSLTFCEAEVAHFYCDILPMMKLACIDTTINEIINFVVSLGVILVPMGLIFISYILI
ISAILKIASAEGRKKTFATCASHLTVVIVHYGCASIAYLKPKSENSMEQDRLLSITYTLITPLLNPVVYSLRNKEVKDALRRVIGKKFS*
961 >lcl|XP_001379647.2|Plus1complement(111404976..111405920) NW_001581961 olfactory receptor 8D4-like LOC100030038 __SEG__ Chr4 {Monodelphis domestica} MAIGNNTLVTEFILLGLTEEVDLQIPLFLVFLGIYMVSVVGNLGLILLIWISSPLHIPMYYFLCNLSFIDLCYSSVIVPKMLVNFISEKNIISYTGCMTQIFFFCFFAID
ECYMLTAMAYDRYVAICSPLLYHSTMSPWICSLLVLVVYLMGASGAIALTHGMTRLFFCGENVVDNYFCDILPLLKLACSSTNINELLLVFIGGFNVLATILPILISYTF
IILSILRIQSAKGRYKAFSTCGSHLASVAIFYGSIIFVYYTPASSSKTNQEKVASVFYTIVNPMLNPLIYSLRNKDVKNALWKVMQGRMSSKSN*
962 >lcl|XP_001379653.2|Plus1complement(62373077..62374006) NW_001581871 olfactory receptor 10J1-like LOC100030047 __SEG__ Chr2 {Monodelphis domestica} MKIQNHTEVNEFYFQGFSSFQEHQITLFLIFLALYILTLAGNVIIVIIIQIDRHLHTPMYFFLSMLSTSETLYSLVIIPRMLSSLVCRDKSISLAGCATQMFFFVTFGIN
NCFLLTAMGYDRYVAICNPLRYTVIMNKKVCALLVWGAFSIGLVVAMTQVTSVFRLPFCDIEVAHFFCDIRPVMKLSCTDTTINEILTLIISILVLLVPMGLVFISYVLI
ISTILKIASAEGRQKAFATCASHLTVVIVHYGCAAIAYLKPKSENTKDQDQLISVTYTVITPLLNPVVYSLRNKEVKDALLRAIGKKHL*
963 >lcl|XP_001379662.2|Plus1complement(62451887..62452822) NW_001581871 olfactory receptor 10J4-like LOC100030059 __SEG__ Chr2 {Monodelphis domestica} MPKANITTVSEFTLEGFSSFGWNHRLILFVIFLVLYLLTLASNALILTLIQLNRQLHTPMYFFLSVLSISETCYTVAIIPRMLTGLLHPYRPITIPGCATQLFFYLTFGV
NNCFLLAAMGYDRYVAICNPLRYSVLMGKTTCAQLACGSWSMGLGTAVIQVPSVFSLPFCGVSIVSHFFCDIRPLLKLACADTTIKELVTLLISLGVIVLPMVLVFISYV
LIFSTILKIASAEGRRKAFATCASHLTVVIVHYGCTSFVYLKPKSQNSLEDRLISVTYTVITPLLNPVVYSLRNKEIKEALRRSLGWKSLT*
964 >lcl|XP_001379665.2|Plus1complement(111453137..111454072) NW_001581961 olfactory receptor 8D4-like LOC100030062 __SEG__ Chr4 {Monodelphis domestica} MDKRNHSMVTNFILMGLTDQPELQLPLFILFLEIYIISIVGNMGLLLLIRISSQLHTPMYYFLSNLSFIDLCYSSVITPKMLVSFVSEQNIISYSGCLTQFFFFCTFGIA
DCYMLTAMAYDRYVAICCPLLYNSTMSQTLCSMLVVGVYTMGIFGAITHTSCLARLSFCGNNVISHYYCDIPPLLKLSCSSTYINELLVMFLVVVNSLVTTLPILISYAF
ILSNILSIHSSKGRSKAFSTCGSHLASVAVLYGSVIFMYCQPSSSSNITQQKVSSVIYTTVIPMLNPLIYSLRNKDVKDALKKIRKDWIVS*
965 >lcl|XP_001379669.2|Plus1complement(111478069..111479013) NW_001581961 olfactory receptor 8D4-like LOC100030067 __SEG__ Chr4 {Monodelphis domestica} MAIGNNTLVTEFIILGLTEEVDLQIPLFLVFLGIYMVSVVGNLGLILLIWISSPLHVPMYYFLCNLSFIDLCYSSVIVPKMLVNFISEKNIISYTGCMTQLFFFCFFAID
ECYMLTAMAYDRYVAICSPLLYHRTMSPWICSLLVLVVYLMGASGAIAHTHGMTRLFFCEKNAVNNYFCDILPLLKLACSSTNINELLVVFIGGFNVLATILPILISYTF
IILSILRIQSAKGRYKAFSTCGSHLASVAIFYGSIIFVYYTPASSSKTNQEKVASVFYTIVNPMLNPLIYSLRNKDVKNALWKVMRGRMLSKSN*
966 >lcl|XP_001379700.2|Plus162597404..62598336 NW_001581871 olfactory receptor 10J1-like LOC100030106 __SEG__ Chr2 {Monodelphis domestica} MKRENYSEVNEFIFQGFSSFQEHQIVLFVVFLALYILTLAGNTIIVTIISMDRHLHTPMYFFLSMLSISETLYTLVIVPRMLASLTGLNQPISKAGCATQMFFFITLAIN
NCFLLTAMGYDRYVAICNPLRYTVIMDKKMCAKLLCGACSIGLTVATVQIASVFRLSFCETKVPHYFCDILQVMKLSCADTTIHDIINLIISSLVIVVPMGLVFISYVLI
IATILKIASAEGRQKAFATCASHITVVIVHYGCASIAYLKPKSENTRDQDQLISVTYTVFTPLLNPVVYTLRNKEVKDALCRAVGRKPLS*
967 >lcl|XP_001379702.2|Plus1complement(111592495..111593439) NW_001581961 olfactory receptor 8D4-like LOC100030110 __SEG__ Chr4 {Monodelphis domestica} MDKGNHSIVADFILMGLTDKPEFQIPLFLLFLEIYIISFMGNMGLILLIWINSQLHTPMYYFLSNLSFIDLCYSSIITPKMLVSFLSEKNIISYSGCLTQFFFFCTFGIA
DWYMLTAMAYDRYVAICSPLHYHSTMSQKIRYLLVLGVYVMGTLGAITHTSGLSRLSFCGNIFISHYFCDIPPLLKLSCSSTYINELLVMLLVVVNSLVTTIPIVISYAF
ILSSILSIHSVKGRYKAFSTCGSHMVTVAVLYGSIIFMYCWPESSNNITQQKVASVIYTTVIPMLNPFIYSLRNKDVKDALKKIKKDWIVSWCN*
968 >lcl|XP_001379708.2|Plus1complement(111621387..111622328) NW_001581961 olfactory receptor 8D4-like LOC100030121 __SEG__ Chr4 {Monodelphis domestica} MAMGNNTIVTEFILLGLTNQTEIKIPLFLLFLGIYLVSMVGNLGLILLIWVSSQLHTPMYYFLSNLSFIDLCYSTVITPKMLENFVSEKNIISYQGCITQFFFFLFFVIA
EFYMLTTMAYDRYVAICRPLLYNVTMVPSFCSLLVAGVYTMGGIGAIVHTTCLARLSFCGDNVIHHYFCDVLPLLKLSCSSTVINELLVVFVGGFNLMATTLPILISYIF
ILLNILRIPSTKGRYKAFSTCGSHLAAVSVFYGSIIFMYYIPTSNSVTQEKVGSVFYTTVIPMLNPLIYSLRNKDVKDALRKVMKGIIFSNST*
969 >lcl|XP_001379727.2|Plus1complement(111661792..111662733) NW_001581961 olfactory receptor 958-like LOC100030141 __SEG__ Chr4 {Monodelphis domestica} MEIKNHTVVTEFILLGIPHTEGQEQVLFVVFLIFYLCTLLGNLLILVAVMSDSRLHTPMYFFLCNLSVLDIGFSSVSTPKTLANLLVRNQVISLGGCISQVFFYHFLGST
ECFLYTVMAYDRFAAICHPLRYTIIMNRRVCTLLAAATWFIASFHATVLTTLTFQLPYCGSNVVDYFFCDIFPVVKLACGNTLIIETVSFTNIGLVGMICFLLILASYIR
IVIAILKMHSAEGRRKAASTCVSHLSVVTLFFGPCALIYTQPSLSEVLVTPVQIFGNIVTPMLNPTIYTLRNKDVKGALKKLAGAQVTSEGGH*
970 >lcl|XP_001379735.2|Plus1complement(111683147..111684088) NW_001581961 olfactory receptor 958-like LOC100030153 __SEG__ Chr4 {Monodelphis domestica} MEIKNHTVVTEFILLGIPHTEGQEQVLFVVFLIFYLCTLLGNLLILVAVMSDSRLHTPMYFFLCNLSVLDIGFSSVSTHKMLVNLLVRNQVISLGGCMSQVFFYHFLGST
ECLLYTVMAYDRFAAICHPLRYTIIMNRRVCTLLAAGTWFTSSFHATILTTLTFQLPYCGSNVVDYFFCDIFPVVKLACGNTLIIETVSFTNIGLVPMTCFLLILASYIR
IVIAILKMHSAEGRRKAASTCVSHLSVVTLFFGPCALIYTQPSLSEVLVTPVQIFGNVVTPMLNPTIYTLRNKDVKGALKKLAGAQVTSEGGH*
971 >lcl|XP_001379740.2|Plus1complement(111729375..111730313) NW_001581961 olfactory receptor 149-like LOC100030159 __SEG__ Chr4 {Monodelphis domestica} MEMKNQTVVTEFILLGIPHTEGLEIELFFVFFFFYFFTLLGNLTILLAIISSPRLHTPMYFFLCKLSIFDIFFPSVSSPKMLFFLSGNSHAISYGGCVCQLFFYHFLGCT
ECFLYTVMAYDRFVAICYPLRYTVIMSHKVCAILAMGTSFFGCVQATFLTALTFQLPYCGPNQVEYFFCDIPVMLKLACADTSALEMVGFISVGLMPFSCFLLILTSYSR
IVCSILRIRSAEGRRRAFSTCSAHLTAILLFYMPVVLIYLQPTPNPWLNATVQILNNLVTPMLNPLIYSLRNKEVKSSLRKVLQQIGLLPEQ*
972 >lcl|XP_001379751.2|Plus1complement(111743757..111744689) NW_001581961 olfactory receptor 149-like LOC100030172 __SEG__ Chr4 {Monodelphis domestica} MKNYTVVTEFILLGIPHTEGLEIQLFIVFLSFYFSTLLGNLTILLAIISSPRLHTPMYFFLCKLSILDIFFPSVSSPKMLSYLSGKSHGISYGGCVCQLFFYHFLGCTEC
LLCTVMAYDRFIAICFPLRYTVIMSHKVCTILAMGSSFFGCIQATFLTALTFQLPYCGPNQVEYYFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSRIV
CSILKIRTAEGRYRAFSTCSAHLTAILLLYIPVVLIYLQPTPNPWLNATVQILNNLVTPMLNPLIFSLRNKEVKSSLKKVLQQVGFLLEK*
973 >lcl|XP_001379772.2|Plus162955334..62956275 NW_001581871 olfactory receptor 6N2-like LOC100030208 __SEG__ Chr2 {Monodelphis domestica} MDCANQTWIQNFVLVGFTPTPFLQPFAFLGVLFIYLLTLAGNMFIIVLVQADSGLATPMYFFISILSFLELWYISTTVPTLLCTVLHGPSPVSPTVCFTQLYVFHSLGMT
ECYLLGVMALDRYFAICRPLHYHSLMGGQVRVWLATASWVAGFSAALVPTCLTASLSFCQVEIAHYFCDLAPLMHLACVDTAWHARVHGAVIGVATGCNFILILLLYGGI
LRAVLKLPTATSRAKAFSTCSSHMMVVTLFYGSAFAVYVGSPGGREEGSDKLIALIYALLTPFLNPIIYTLRNKEVKEAVKRVAHRFGAVLKG*
974 >lcl|XP_001379784.2|Plus1111967358..111968296 NW_001581961 olfactory receptor 148-like LOC100030225 __SEG__ Chr4 {Monodelphis domestica} MKIENYSVVTEFILLGIPHTEGMETVLFVIFLLIYIFTLVGNFLILVAIISSSRLHTPMYFFLGLLSTFDIFFPSVSSPKLLVFLSGNSRAISYRGCASQLFFYHFLGCT
EGILYSVMSYDRFVAICHPLRYSVIMNPRLCVILATCTTLIGCIHATILTSLTFQLPYCGPNEVHYYLCDIPVVLPLACADSSLAQRVGFTNVGLLALTLLFTILVSYTR
IGIAILRIRSAEGRSKAFSTCSAHLAAIMCAYGPVMIIYFQSTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRALKRVLCGAGLTVEA*
975 >lcl|XP_001379789.2|Plus1complement(63077520..63078479) NW_001581871 olfactory receptor 6K6-like LOC100030231 __SEG__ Chr2 {Monodelphis domestica} MTQGPEIVNQTAVTEFFFSEFPNLEEGGLLFFFPLLLIYVFIITGNLVIFIVIQLDVALHTPMYFFISVLSFLEIWYTTTTIPKMLTNLVSVQKTISVAGCLLQMYFFHS
LGISEGCLLTAMAIDRYVAICKPLHYPTIVTPRLCSQLTAGSCLCGFLLVLPEIVWISTLPFCGPNQIHQIFCDFTPVLNLACTDTSLIVIVDAIHAVEILASFLVIALS
YIRIILVILRIPSVEGRHKAFSTCAAHIAVFLLFFGSVALMYLRFSATYSMFWDTAIAITFVVLAPFLNPIIYSLRNKDMKEAIKRFLCPQKWDNRAEG*
976 >lcl|XP_001379791.2|Plus1112003414..112004355 NW_001581961 putative olfactory receptor 10D4-like LOC100030233 __SEG__ Chr4 {Monodelphis domestica} MEIKNFTEVTEFILLGIPETVGLETVLFVLFLFLYLCTLSGNVLILMAVISSSRLHTPMYFFLGNLSIFDMGFSSATSPKMLFYLSGQTPVISFKGCVTQLFFYHFLGCT
ECLLYTVMAYDRFVAICHPLRYRIIMNHRVCSILATGTWMSGCVHATILTSLTFQLPYCDANQVDYYFCDIPAVLPLACADTSLAQRVSFTNVGLLSLLCLFLILISYTR
IGISISRIRSTEGRQRAFSTCSAHLTAILCAYGPVIIIYLQPTPSPLLGSVVQILNNLVTPMLNPLIYSLRNKDVKFALKKVFCNVGPIVENG*
977 >lcl|XP_001379794.2|Plus163096226..63097173 NW_001581871 olfactory receptor 6K3-like LOC100030236 __SEG__ Chr2 {Monodelphis domestica} METKNQTGISEFFFSGFPRFQEGGFLFFIPLLLIYMFVVIGNLMIFIAIRLDVRLHNPMYNFIGIFSFLEIWYTTTTIPKMLSNLINDQKTISFTGCLLQMYFFHSLGNS
EGILLTTMAIDRYIAICNPLRYPTIMTPRLCDQLIMGSCVFGFLVLLPEIIWISTLPFCGSNQIHQLFCDFAPVLSLACTDTSMILVEDVVHAIAILIAVLIIILSYIQI
IAVILGIPSVEGRQKAFSTCASHLTVFIMFYGSVSLMYLRFSATFPPFLDRTIALMFAVLAPFCNPFIYSLRNKDMKEAIRKILSSQKVFSMSEN*
978 >lcl|XP_001379808.2|Plus1complement(112035730..112036662) NW_001581961 olfactory receptor 149-like LOC100030252 __SEG__ Chr4 {Monodelphis domestica} MRNQSVVTEFILLGIPHTEGLEAELFFLFLTFYLLTLLGNLIIFMAIISSSQLHTPMYFFLANLSVFDIFFPSVSSPKMMLYLMGNSHTISFQGCVSQIFFYHCLGGTEC
FLYTVMAYDRFVAICHPLRYTVIMNHKVCTILTIGTWLGGCFHSTILTFLTFRLPYCGPNEVNYFFCDIPIVLPLACADTSLAQMVSFTNVGLMPLICFLFIFISYIRIV
LSILKIRSSEGRRRAFSTCSAHLTSILLFYGPVILIYLGPASTPWLGSVIQVLNNIVTPSLNPLIYSLRNKDVKLALRKVFYQVVNTSGV*
979 >lcl|XP_001379814.2|Plus1complement(112052326..112053267) NW_001581961 olfactory receptor 10G9-like LOC100030261 __SEG__ Chr4 {Monodelphis domestica} MEKKNQSFVTMFILMGIPHAPELDTALFGIFLVIYVLTIVGNLLILMVIKVESHLHTPMYYFLAFLSFIDMWFSTVTVPKILMGLLNPDGGAISFHSCVAQLYFFHVLGS
TECFLYTVMSYDRYLAITYPLRYTSMMSGKTCALLTGSTWFSGSVHSAIQTILTFRLPYCGPNQIQHYFCDAPPILKLACADTSANEKVIFVNIGVVASGCFFMIFLSYV
SIVHAILKIHTAEGRQKAFQTCASHCIVVLCFFGPCIFIYLRPGSKDAVDGIVAIFYTVLTPLLNPLIYTLRNKEVKIALLRLQNRVVFAQRN*
980 >lcl|XP_001379823.2|Plus1complement(112092334..112093275) NW_001581961 olfactory receptor 10G9-like LOC100030271 __SEG__ Chr4 {Monodelphis domestica} MEGKNQSFVTTFILMGIPHPPELETALFGIFLVVYALTLVGNLLILLVIKVDSHLRTPMYYFLANLSFIDTWFSTVTVPKILMGLFSTDGGAISFHSCAAQLYFFHILGG
TECFLYTVMSYDRYVAITFPLRYATMMSGKTCALLAGGTWLTGGLLAALQTILTFRLPYCGPNQIQHYLCDAPPILKLACTDTSVNEMVIFVNIGVLTIGCFFLIFLSYV
SIIRAILKISTAEGRYKAFQTCASHCIVVLCFFGPCLFIYLRPGSKDAVDGIVAIFYTVLTPMLNPLVYTLRNKEVKTALLRLQKRGVFSKGK*
981 >lcl|XP_001379829.2|Plus1complement(44782166..44783149) NW_001581861 olfactory receptor 6J1-like LOC100030279 __SEG__ Chr1 {Monodelphis domestica} MKNQTTTVAEFILLGFPISREVELLFFILLLPTYLLTLLGNILIICTVVSYSRLYTPMYFFLCNLSILDILFTSVISPRVLTNLATGNKTISFAGCITQCYFYFFLGTVE
FLLLTSMSYDRYAAICNPLRYSTIMSPSVCIGLVLFSWVGGFLSVLFPTILISRLPFCGSNIINHFFCDSGPLLALACTDTTAIELMDFLLSSTVILLSLILIGYSYTYI
IMTILRIPSASGRKKAFNTCASHLTVVGIAGGITVFIYVTPSQKETLEINKIPSVLSSVVAPFLNPFIYTLRNDTVHGILREVWVGLRVALVERRRSFLRMLYHKGH*
982 >lcl|XP_001379836.2|Plus144828005..44828943 NW_001581861 olfactory receptor 6C4-like LOC100030289 __SEG__ Chr1 {Monodelphis domestica} MGNNSTTVTEIILLGLTDACEFQMPIFVGLLLTYLIILLGNLLIIVVTLMDHRLYTPMYYFLRNFAVLEIWFTSVIFPKMLNNILTGNKTISLVGCFLQGFLYFFLGTTE
FLLLAVMSFDRYVAICNPLRYATIMSKRVCVQLVLSSWLGGFLLIVIPSGITFQQPFCGPNVINHFFCDNFPLLELVCADTSLVELMGFVVANISLLGTLSVTAPCYGHI
LYTILRIPSAKERQKAFSTCSSHIIVVSLFYGSCIFMYVRAGKGSEGENLNKVVALLITVVTPMLNPFIYTLRNKQVKLVIREKVGKWISQA*
983 >lcl|XP_001379838.2|Plus163266313..63267269 NW_001581871 olfactory receptor 6K2-like LOC100030291 __SEG__ Chr2 {Monodelphis domestica} MENENQTMIIEFLFTAFPHFQDGGCPFFILLLFIYLFIIIGNSMVFVAVVLDVRLHTPMYFFIGVLAFLEIWYTTTTIPKMLINLVSDQKTISIAGCLLQMYFFHSIGIT
EAYLLTTMAIDRYLAICYPLRYPTIMTPQLYTSLTLGCCFFGFLTPLPEITWIATLPFCGPNQIHNIFCDFDPILNLACVDTSSIILIKVVDIIHAMEIISAITLVILAY
IQIIGVILRIRSSEGRHKAFSTCASHLAIFLIFFGSVALMYLRFNAKYSFIWDTTISLMFAVLSPFFNPIIYSLRNKEIKGAIKKYLCQLKIFTCYST*
984 >lcl|XP_001379841.2|Plus1complement(112178074..112179006) NW_001581961 olfactory receptor 10G9-like LOC100030294 __SEG__ Chr4 {Monodelphis domestica} MDRKNESIVTTFILTGIPHVPELGTTLFGIFLLIYILTLVGNLLILLVIKVDSHLHTPMYYFLANLSFIDMWFSTVTVPKILMTLISTDGGAISFHGCVAQLYFFYALAN
TECFLFVLMSYDRYLAITYPLRYTTMMSGKTCAILAGGTWLSGIVHSTAETTLTFRLPYCGPNKIEHYLCDAPPILKLACADTSVNEMVIFVNIGLLVCVCSFLIFLSYV
SIVRAVLKIRTAEGRHKAFQTCASHCIVVLCFFVPCVIIYLRPGSKNVMDRIVAIFQTVITPLMNSLVYTLRNKEVKMALLRLKDRGKFL*
985 >lcl|XP_001379844.2|Plus144842938..44843873 NW_001581861 olfactory receptor 6C4-like LOC100030299 __SEG__ Chr1 {Monodelphis domestica} MWNSTTITEIILLGLTDACEFQMLIFVGLLLTYLITLLGNLLIIVVTLMDHRLYTPMYYFLRNFAVLEIWFTSVIFPKMLNNILTGNKTISLVGCFLQFFFYFFLGSTEF
LLLAVMSFDRYVAICNPLRYATIMSKRVCVQLVLSSWLGGFLLIVIPSGITFQQPFCGPNVINHFFCDNFPLLELVCADTSLVELIGFGVANISLLGTLSVTASCYGHIL
YTILRIPSAKERQKAFSTCSSHIIVVSLFYGSCIFMYVRAGKGSEGENLNKVVAILNTVVTPMLNPFIYTLRNKQVKLVIREKVGNWISQT*
986 >lcl|XP_001379852.2|Plus1complement(112197962..112198894) NW_001581961 olfactory receptor 10G9-like LOC100030307 __SEG__ Chr4 {Monodelphis domestica} MDRKNESVVTTFILTGIPHAPELGTTLFGIFLLIYILTLVGNLLILLVIKVDSHLHTPMYYFLANLSFIDMWFSTVTVPKILMTLISTDGGAISFHGCVAQLYFFYALAN
TECFLFVLMSYDRYLAITYPLRYTTMMSGKTCAILAGGTWLSGIIHSTAETTLTFRLSYCGPNKIEHFLCDAPPILKLACADTSVNEMVIFVNIGVVTSGCSFLIFLSYV
SIVRAVLKIHTAKGRHKAFQTCASHCIVVLCFFVPGVIIYLRPGSKNVMDRIVAIFQTAITPLMNSLVYTLRNKEVKMALLRLKDRGKFL*
987 >lcl|XP_001379856.2|Plus1complement(63397568..63398509) NW_001581871 olfactory receptor 10Z1-like LOC100030313 __SEG__ Chr2 {Monodelphis domestica} MGLCNETTWRDFVFLGFSSFGNLQFLLFAIFLSLYLITLASNVFIIIIIRLDSHLHTPMYLFLSVLSFSETCYTLGIIPKMLSNLAVGSQAISYVGCAVQMDFSASWACT
NCFLLAVMGFDRYVAICAPLHYASRMHPTLCTQLVGTSFLSGYLIGMGMTLVIFQLPFCGSHEIHHFFCDTPPVLSLACGDTSMSELEILILSLLVLLVSFSLITISYAN
ILVTILRIPSAKGKQKAFSTCASHLTVVIVHYGCASFMYLRPKASYSLERDQLIAVTYTVVTPLLNPIVYSLRNRAVQAAFKNVFQGKLLGKR*
988 >lcl|XP_001379859.1|Plus1complement(111701633..111702700) NW_001581900 neuropeptides B/W receptor type 1-like LOC100030316 __SEG__ Chr3 {Monodelphis domestica} MQTFGNRVILCFRKMYNLSSSLGPTNSSCPNPELNCSQELSEQDGEEPGSHNASNPDLLLQPLYIAVPVIYSVICAVGLTGNTAVLYVLLRAPRMKTVTNLFILNLAIAD
ELFTLVLPINIADYLLLQWPFGELMCKLIISIDQYNTFSSLYFLTVMSIDRYLVVLATIESRKMAYRTYRAAKVVSLAVWFLVTLIVLPFTIFAQLYEEEGRIQCVLVFP
QPENFWWKISRIYTLILGFAIPVSTICILYSIMLCRLRAMQLDSHAKALDRAKKRVTLMVLVILAVCLFCWTPYHLSTIVALTMDIPQTPVIIGVSYFITSLSYANSCLN
PFLYAFLDDNFRRSFRKLVECRASP*
989 >lcl|XP_001379866.2|Plus144894907..44895845 NW_001581861 olfactory receptor 6C4-like LOC100030328 __SEG__ Chr1 {Monodelphis domestica} MGNNSTTVTEFVLQGLTDACEFQMLIFVGLLLTYLITLLGNLLIIVVTLMDHRLYTPMYYFLRNFAILEIWFTSAIFPKMLNNILTGNKTISLVGCFLQGFLYFFLGTTE
FLLLAVMSFDRYVAICNPLRYATIMSKRVCVQLVLSSWLGSFLLIIVPSYITLQQPFCGPNIINHFFCDNFPLLELICADTSILELIGFIGANVSLLGTLSVTASCYGHI
LYTILRIPSAKERQKAFSTCSSHIIVVSLFYGSCIFMYVRTGKGNEGEELNKVVAILNTVVTPMLNPFIYTLRNKQVKLVIKEKVGKWISQA*
990 >lcl|XP_001379870.2|Plus1complement(112263362..112264294) NW_001581961 olfactory receptor 10G7-like LOC100030333 __SEG__ Chr4 {Monodelphis domestica} MNWQNESFVATFILTGIPHAQDLGTMLFGIFLVIYVLTLVGNLLILLVIKIDSHLRTPMYYFLANLSFIDMWFSTVTVPKILMTLISTDGGAISFHGCVAQLYFFYALAN
TECFLFVLMSYDRYLAITYPLRYTTMMSGKTCAILAGGTWLSGIIHSTAETTLTFRLPYCGPSQIEHYLCDAPPILKLACADTSVNEMVIFVNIGVIGSGCCFLIFLSYV
SIVRAILKIRTAEGRHKAFQTCASHCIVVLCFFGPGLIIYLRPGSKHVMDRIIAIFQIVITPLMNPLVYTLRNKEVKMALLRLKDQGKYV*
991 >lcl|XP_001379878.2|Plus1112284544..112285479 NW_001581961 olfactory receptor 10G6-like LOC100030343 __SEG__ Chr4 {Monodelphis domestica} MQSGNQTFVTHFILVGLHHHPKLGVPLFLVFLAIYLLTISGNGLIILTILVDVRLHRPMYWFLCHLSFLDMTISCAIVPKMLAGFLLNSRAISFGGCVIQLFSFHFLGCT
ECFLYTLMAYDRFLAICKPLHYATIMTRSVCNCLALGTWLGGSLHSIFQTCFMFRLPFCGPNQVDYFFCDIPAMLRLACADTVINELVTFVDIGFLALTCFVLILTSYGY
IVAAILRIRSADGRRNAFSTCAAHLTVVIVYYVPCTFIYLRPGSQEPLDGVVAVFYTVITPLLNPIIYTLRNKEMKSALWRLGGRREVQPH*
992 >lcl|XP_001379883.2|Plus144943934..44944914 NW_001581861 olfactory receptor 6J1-like LOC100030349 __SEG__ Chr1 {Monodelphis domestica} MENQTTVTEFILLGFPISREVELLFFLLLLPTYLVTLLGNILIICIVVSHSCLYTPMYFFLCNLSILDILFTSVISPRVLANLATGYKTISFAGCITQCYFYFFLGTVEF
ILLTSMSYDRYAAICNPLRYSTIMSPSMCIGLVLFSWVGGFLSVLFPTILTSMLPFCGSNIINHFFCDSGPLLALACTDTTFIELMDFLLSSTVIIFSIILTGYSYVCII
MTILRIPSATGRKKAFNTCASHLTIVVMAGGITAFIYVTPSQKESLEINKIPSVLSSVVAPFLNPFIYTLRNDTVLGVLREVWVGVRAVLVGRGRELLSRVSKKDH*
993 >lcl|XP_001379886.2|Plus1112292565..112293506 NW_001581961 olfactory receptor 10S1-like LOC100030353 __SEG__ Chr4 {Monodelphis domestica} METEWSNQTLVTHFILEGLANTSEYPILFFFLFLLIYTITVVGNFFILLTVSLDPHLHSPMYHFLGHLSFLDACLSTVTVPKVLAGLLTPEGKVISFGGCAVQLYSFHFL
ASTECFLYTVMAYDRYLAISQPLKYPVVMNQQVCAGLAGATWATGAIHSAIHTSLTFRLPYCGPSHVDYFFCDIPPVLKLACTETALNELVMLANIGIVATGCLLLIIIS
YVFIVASVLKIRTADGRRNAFSTCTAHLTVVFLYYMPPICIYIQPRSSGAGVGAPAVFYTIVTPMLNPFIYTLRNKEVKRALRRLLGHGPRES*
994 >lcl|XP_001379895.2|Plus1112383714..112384664 NW_001581961 olfactory receptor 6T1-like LOC100030366 __SEG__ Chr4 {Monodelphis domestica} MYSENWTQVTEFVLIGFPGSWGLQLILFLGLLVTYVVTIMGNVLIIVLSWSDHRLQTQMYFFLRNLSLLELGWVSVVVPKMLVSLLTRDYSISFAACIMQSYFYFLLATT
DYFLLAVMSLDRYLAVCRPLHYETLMSGPICVRLVIASWISGFLWVLSPTILMANLPFCSSNVIDHFFCDSWPLMQLSCGDTQLLKLLAFILSTTVLLGSLALTAISYVY
IFLTVFRAPTATERRKAFSTCASHLTVVIIAYGGSIFLYIRTSETQSLFLKKGASALVCIITPLLNPFIFSLRNDKVKQALGDALKWHRNIGTRKL*
995 >lcl|XP_001379898.2|Plus1complement(63524292..63525269) NW_001581871 olfactory receptor 6Y1-like LOC100030371 __SEG__ Chr2 {Monodelphis domestica} MYARPQREDNWTATTQFILLGFPTQPEIQLLLFSLFLIAYLLTLLENFMIIVAIHSDGQLHKPMYFFLSHLSFLEMWYVTVISPKMLVDFLSHDKSISFAGCMTQLYFFV
TFVCTEYILLAVMAFDRYVAICNPLRYPAIMSNQLCSILAGGCWICGLMTAMIKMVFIARLHYCGMPHINHYFCDISPLLNVSCEDSSQAELVDFFLALMVIAVPLCVVV
ASYAAIIATILRIPSAQGRYKAFSTCASHLTVVTLFYSTTLFTYARPKLMYAYNSNKVVSVLYTVIVPLLNPVIYCLRNREVKVALKKTILCRAGGNGEDRASHA*
996 >lcl|XP_001379902.1|Plus1112416688..112417638 NW_001581961 olfactory receptor 6T1-like LOC100030375 __SEG__ Chr4 {Monodelphis domestica} MYSENWTQVTEFLLMGFPGNWGLQLLLFFGLLITYVVTVMGNLIIIVLSWSDHRLQTQMYFFLRNLSLLELVLVSVVVPKILISILTGDYTISFTGCIMQSYFYFLLGTT
DFFLLAVMSLDRYLAICHPLHYETLMNRPICVRLVITSWIAGFLWVLCPTILMARLPFCGPNVIDHFFCDSWPLMRLSCGSTQLLELVAFILSTAVLLSSLALTSVSYTC
ILATVLRTPTATERKKAFSTCASHLTMVVIVYGSSIFVYIRTSETQSRLLNKGVSALGCIVTPLLNPFIFSLRNDKVKQALGDALRWHRNITTRRI*
997 >lcl|XP_001379907.2|Plus1complement(63545344..63546297) NW_001581871 olfactory receptor 6P1-like LOC100030384 __SEG__ Chr2 {Monodelphis domestica} MGNWSGIHVENFILVGFPTSQPLQLFLFVLFLIFYLMTLLENALIISTVWLTPALHRPMYFFLSHLSFLELWYINVTVPRLLGAFLTQNLWISFVGCMTQLYFFVALACT
ECVLLAVMAYDRYLAICEPLRYPSLMSPSLATRLATASWVSGFFSSMMKLLFIGRLSYCGPNVINHFFCDISPLLNLTCSDKEQAELVDFLLALVMILLPLLAVVSSYVA
IIVAILRIPTSQGRQKAFSTCASHLAVVVIFYSSILFIYARPRAMYAFNYNKVISVLYTVIVPLLNPAIYCLRNKEVKDALRKTVLDRCHHCGDSQD*
998 >lcl|XP_001379919.2|Plus1complement(112484272..112485216) NW_001581961 olfactory receptor 4D5-like LOC100030404 __SEG__ Chr4 {Monodelphis domestica} MNPVNHTQVTGFVLLGLSQAWELRIFFFMVFLTVYFCTVMGNLLIVAIVSSDPHLHTTMYFLLANLSFLDFCYSSITSPRMLADLLSGNPTISFGGCLTQLFFFHFIGGI
KIFLLTVMAYDRYVAISQPLRYPLIMNQGVCGLFMAGSWVGGFIHSIVQVALTVQLPFCGPNKLDNFYCDVPQLIKLACTDTFALELLMVSNNGLVTLMCFLVLLGSYTA
LLIMLRSHSREGRSKALSTCASHIAVVTLIFVPCIYIYARPFRTFPMDKAVSVLYTMVTPMLNPAIYTLRNKEVIDAMKKLWRKYIVTRGKQEH*
999 >lcl|XP_001379923.1|Plus1complement(63624817..63625770) NW_001581871 olfactory receptor 6P1-like LOC100030411 __SEG__ Chr2 {Monodelphis domestica} MGNWSGIHVESFILVGFPTSQPLQLFLFVLFLIFYLMTLLENALIISTVWLTPALHRPMYFFLSHLSFLELWYINVTVPRLLGAFLTQNLWISFVGCMTQLYFFVALACT
ECVLLAVMAYDRYLAICEPLRYPSLMSPSLATRLATASWVSGFFSSMMKLLFIGRLSYCGPNVINHFFCDISPLLNLTCSDKEQAELVDFLLALVMILLPLLAVVSSYAA
IIVAILRIPTSQGRQKAFSTCASHLAVVVIFYSSILFIYARPRAMYAFNYNKVISVLYTVIVPLLNPAIYCLRNKEVKDALRKTVLDRCHHCGDSQD*
1000 >lcl|XP_001379925.2|Plus1112616813..112617754 NW_001581961 olfactory receptor 6M1-like LOC100030413 __SEG__ Chr4 {Monodelphis domestica} MENQSMVTEFVLVSFPVLQELQTFLFVVLLLTYMLTIAGNIVIISLIWTDYRLHTPMYFFLSNLSFLDILFTTVIAPKLLSCLLNDRKTISFAGCITQTYFYFFLGTVEF
ILLAVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVLCPTIVVSRLPYCNKEISHFFCDIAPLLQVACIDTHLIEIINFLLSSMVVLSSLVLTIVSYSYIIS
TILRIPSAQGRQKAFSTCVSHITVVSIAYGSSIFMYVRPNQSYSLDFDKVTAVFTTVVTPLLNPFIYSLRNEKVKEVLREAISKIISLLPRRS*
1001 >lcl|XP_001379933.2|Plus1112663070..112664008 NW_001581961 olfactory receptor 6X1-like LOC100030424 __SEG__ Chr4 {Monodelphis domestica} MRNGTLITEFILLGFPDIQGLQVPLFIVIFFIYILTIFGNGLIIAIVWTEQRLQTPMYFFLSNLSFLEIWYTTTVIPKLLETFVVERTIICVPCCLLQSFFHFFLGTTEF
FILTAMSFDRYIAICKPLHYTTLMTSSLCLQLALSSWIIGFTIVFCQTVLIFQLPFCGNNIINHFYCDVGPILKVACVDTSLLEILGLLATILIIPGSLAFTVVSYIYIV
STILKIPSATGRQKAFSTCASHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTIITPLLNPFIYTIRNKEVKEALWKAMACQKTSHHW*
1002 >lcl|XP_001379934.2|Plus1complement(64820508..64821452) NW_001581970 olfactory receptor 508-like LOC100030425 __SEG__ Chr5 {Monodelphis domestica} MEFKPSENYTAVIDFLILGLTDDPFLCVILFLLFMGIYLFTVMGNFCTIILIRLSPQLHTPMYLFLSHLAFVDVGYSTSVTPNLLVNFMVEKNIITYPGCVTQLCSLVTF
GATESFLLTFMAYDRYMAICNPLLYSVKMSDQVCSLLIMTSYAGGCLNGVTYTGCLLNLFFCGPNVINHFFCDFSPLVKLSCHHVFIAEILPAIYSAIIIAIALITITIS
YLYIFFTILNMNSTEGRHKAFSTCTSHLTAVTLFYGTIIFIYVMPTSSYSTDQNKVVSIFYIVVIPMLNPMIYSLRNKEIKDALKRLVSNKRHS*
1003 >lcl|XP_001379944.2|Plus1complement(64831155..64832099) NW_001581970 olfactory receptor 508-like LOC100030436 __SEG__ Chr5 {Monodelphis domestica} MESMPPGNYTAVTNFLLLGLTDDPLLCIILFVLILGIYVFTVMGNFCTIILIRLSPQLHTPMYLFLSHLAFVDFWYSTGATPNMLANFLQEKNIMTYSGCITQLCSLVTF
GATESFLLTSMAYDRYMAICNPLLYSVKMSDQVCLLLIVISYIGGCLNGVTYTSCLLNLSFCGPNVIDHFFCDFSPLVKLSCYHVFAAEILPAIYSAIIIAIALVTITIS
YLYIFFTILSMNSTEGRHKAFSTCTSHLTAVTLFYGTIIFIYVMPTSSYSTEQNKVVSVFYIVVIPMLNPMIYSLRNKEIKDALKRLVNSKRHS*
1004 >lcl|XP_001379957.1|Plus111132230..11133336 NW_001581988 5-hydroxytryptamine receptor 1F-like LOC100030455 __SEG__ Chr7 {Monodelphis domestica} MDFLNLTDQNFTSEEPFNRMPSKILVSFTLSLLALMTTAINSLVITAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVKESWLMGQVVCDIWLSVDITCCTCS
ILHLSAIALDRYRAITDAVEYARKRTPKQAGMMITVVWTISVFISMPPLFWRHQGTSKEDECIIKHDHIVFTIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRNASRV
AKGELNGQILLESGERSTHLVSTPYVQEKSLSDPSTDFDKIQSTIKSPKSELRPEKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKEVVVNICDKCQISEELSN
FLAWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRHYF*
1005 >lcl|XP_001380002.2|Plus1complement(63974214..63975176) NW_001581871 olfactory receptor 10K1-like LOC100030512 __SEG__ Chr2 {Monodelphis domestica} MERSNETSVSEFIFLGFSSLAEFQWLLFVVFLLLYLFTLGTNAVILSTILLERALHTPMYFFLGILSSFETCYTFVIVPKMLVDLLAQEKTISFVGCAIQMLIFLFLGCS
HSFLLAAMGYDRYVAICNPLRYTVLMGYGTCLGLVAAACACGFTVALVTTSLVFHLPFHSSNQLHHFFCDISPVLKLASHHTRLSQMVIFMLGVFVLVIPLLLILASYIR
IISAILKIPSTVGRYKAFSTCASHLIVVTVHYGCASFIYLRPKTNYTSSQDALISVSYTILTPLFNPMIYSLRNKEFKAALWRAMGQNMCPKHSRTCSST*
1006 >lcl|XP_001380111.2|Plus1complement(20945305..20946246) NW_001581878 olfactory receptor 6C4-like LOC100030655 __SEG__ Chr2 {Monodelphis domestica} MMGNQTAVTEFFLVGLTDDPEIQVILFIFLLLTYLLSFTGNMTIIILTLLDSQLQTPMYFFLRNFSFLEISFTTVFVPKMLVNIGTGNKTISFAGCFTQFFFAILLGATE
FYLLAAMSYDRYVAICKPLHYTMMMNKKLCLQLILSSWFSGFMVVIGPHIMTTMLPFCASNVINHYCCDYTILLQLACADTHIIEIITFVLAVVTLLFTLVLVIISYVYI
MGTIMRIPSAQKRKKAFSTCSSHMIVVSLSYGSCIFMYVNPSMKEAATFNKGVAVLNTSVAPLLNPFIYTLRNQQVKRAFKDMVRRIKFFSIK*
1007 >lcl|XP_001380265.1|Plus146757728..46758780 NW_001581861 leukotriene B4 receptor 1-like LOC100030865 __SEG__ Chr1 {Monodelphis domestica} MATNITTTASYMPNFRLIGSLSIILLSLALVLGLPGNSFVVWSILTQMRRRSVTALLVLNLALADLAVLLTAPFFLHFLAHGSWSFGLTGCRLCHYICGVSMYASVLFIT
VMSLDRSLAVARPFLSQKFRTKAAAWRVLVGIWVVSAILAVPVIVYRKVTGEKGKEICAANYTTPGHIAFHLLFESITGFVLPFVAIVGSYSDIGRRLRATRFRRSRRTG
RLVVLIILTFAIFWLPYHAVNLGEASRALSGYEIGKGAAGQRLKAARYVLIALAFLSSSLNPLLYACAGGGLLRSAGVGFVAKLLEGTGSEVSSTRRGGTQVLSPRGNPN
SPQEPGPAEEGLTLSTNPID*
1008 >lcl|XP_001380440.1|Plus1120748805..120749824 NW_001581879 trace amine-associated receptor 7a-like LOC100031100 __SEG__ Chr2 {Monodelphis domestica} MASTDQQTGEVQFCFQNISGSCVKTAQSLGIRTVLYGILGFIIILTVGGNTVVIFSITYFKQLHSPSNFLVASLACADCSLGLTVLPFSTVRSVETCWYFGDRFCKFHSG
LDICFCLASMFNLCFISVDRYVAITDPLLYPIRFTISLSGEFIALSWTSAFLYSFSLLYTGANEEGLEEAMNDFHCEGNCQIFFNKTWVIITSLLYFIPFSIMIWLNSKI
FAVAKQQARKIEQMGNTMSSEGDKVPKRERKAAVTLGIAVMAFFLFWSPYFITIITDTFLGPTTPPLAFDIMIWFAYSNSAINPLIYAFFYPWFRKAIKVVLSCKILWIN
CSSMNLFLE*
1009 >lcl|XP_001380446.1|Plus1120769944..120771026 NW_001581879 trace amine-associated receptor 9-like LOC100031110 __SEG__ Chr2 {Monodelphis domestica} MELNENSNGEVGINSSYQLKAMEFCFENVNKSCIKTTYSPIPRMILYMVFGFGTLLAVFGNLLVITAILHFKQLHTPTNFFIASLACADFLVGLTVMPFSTVRSVESCWY
FGDSFCKFHTSFDGSFCYSSLFHLCFISIDRYIAVTDPLIYPTKVTVPISGICIVISWVCSITYSFSLFYTGVTDDGLEDLVLALSCVGGCQAAVNQDWVLIGFLVFFIP
TIAMLIIYGKIFLVAKQQARKIESSSNQTQESAESYKERVAKRERKAAKTLGIAMAVFLVCWLPYYIDSIIDAYMNFITPAYVYEILVWFVYYNSAMNPLIYAFFYPWFR
KAIKLIVSGRILRNDSSSMNLFSEEVEIHN*
1010 >lcl|XP_001380452.1|Plus1120819033..120820115 NW_001581879 trace amine-associated receptor 9-like LOC100031116 __SEG__ Chr2 {Monodelphis domestica} MELNEDSHREVGINSSYQLKAVEFCFENVNKSCIKSTYSPFPRMILYVVFGFGTLLAVFGNLLVITAILHFKKLHTPTNFLIASLACADFLLGLTIMPFSMVRSVESCWY
FGDNFCKFHTSFDASFCYSSLFHLCFISIDRYIAVTDPLIYPTKVTVPISGIFIVISWVCSITYSFSLFYTGVIGDGLEELVIALSCVGGCQAAVNQDWVLIGFLVFFIP
TIAMLIIYGKIFLVAKQQARKIESSSNQTQASAESYKERVAKRERKAAKTLGIAVAVFLFCWLPYYIDSIIDAYMNFITPAYVYEILVWFVYYNSAMNPLIYAFFYPWFR
KAIKLIVSGRILRNDSSSMNLFSEEVEIHN*
1011 >lcl|XP_001380460.2|Plus1120839782..120840864 NW_001581879 trace amine-associated receptor 9-like LOC100031124 __SEG__ Chr2 {Monodelphis domestica} MELHEDSHKEVGINNSYQLKAVQFCFENVNKSCIKTTYSPFPRMILYVVFGFGTLLAVFGNLLVITTILHFRQLHTPTNFLIASLACADFLVGLTVMPFSMVRSVESCWY
FGESFCKFHTCFDGSFCYSSLFHLCFISIDRYIAVTDPLIYPTKVTVPISGMCIAISWSCSITYSFSLFYTGANDDGLEDLVIALSCVGGCQGAMNQDWVLVGFLLFFIP
TIAMLIIYGKIFLVAKQQARKIESSSNQTQASAESYKDRVAKRERKAAKTLGIAMAVFLVCWLPYFIDTLVDAYMNFITPAYVYEILGWFVYYNSAMNPLIYAFFYPWFR
KAIKLIVSGRILRNDSSSMNLFSEEVEIHN*
1012 >lcl|XP_001380463.1|Plus1120859789..120860871 NW_001581879 trace amine-associated receptor 9-like LOC100031129 __SEG__ Chr2 {Monodelphis domestica} MELHEDSHREVGINNSYELTAVQFCFENVNKSCIKTTYSPFPRMILYVVFGFGTLLAVFGNLLVITAILHFRQLHTPTNFLIASLACADFLVGLTVMPFSMVRSVESCWY
FGESFCKFHTCFDGSFCYSSVFHLCFISIDRYIAVTDPLIYPTKVTVPISGMCIALSWGCSITYIFSLIYTGANDDGLEDLVIALSCVGGCQAAMNQDWVLVGFLLFLIP
TIAMLIIYGKIFLVAKQQARKIESSSNQTQASAESYKDRVAKRERKAAKTLGIAMAVFLVCWLPYFIDTLVDAYMNFITPAYVYEILLWFVYYNSAMNPLIYAFFYPWFR
KAIKLIVSGRILRNDSSSMNLFSEDVEIHN*
1013 >lcl|XP_001380466.1|Plus1120875878..120876960 NW_001581879 trace amine-associated receptor 9-like LOC100031136 __SEG__ Chr2 {Monodelphis domestica} MELHEDSHREVGINHSYQLTAVQFCFENVNKSCIKTTYSPIPRMILYVVFGFGTLLAVFGNLLVITAILHFKQLHTPTNFLIASLAWADFLVGLTVMPFSMVRSVESCWY
FGESFCKFHTCFDGSFCYSSLLHLCFISIDRYIAVTDPLIYPTKVTVPISGMCIALSWGCSITYIFSLFYTGANDDGLEDLVIALSCVGGCQGAMNQDWVLVGFLLFLIP
TIAMLIIYGKIFLVAKQQARKIESSSNQTQASAESYKDRVAKRERKAAKTLGIAVAVFLVCWLPYFIDTLVDAYMNFITPAYVYEILLWFVYYNSAMNPLIYAFFYPWFR
KALKLIVSGRILRNDSSSLNLFSEEAEIHN*
1014 >lcl|XP_001380473.1|Plus1120894218..120895300 NW_001581879 trace amine-associated receptor 9-like LOC100031146 __SEG__ Chr2 {Monodelphis domestica} MELQENSLNEVGINSSYQLTAVQFCFENVNKSCIKTSYSPFPRMILYVVFGFGTLLAVFGNLLVITAILHFRQLHTPTNFLIASLACADFLVGLTVMPFSMVRSVESCWY
FGESFCKFHTCFDGSFCYSSLFHLCFISIDRYIAVTDPLIYPTKVTVPISGICIAISWSCSITYIFSLFYTGANDDGLEDLVIALTCVGGCQVAINQDWVLFEFLLFFIP
TVAMLIIYSKIFLVAKQQARNIESSSNQTQASAESYKDRVAKRERKAAKTLGIAMAVFLVSWLPYYIDTLIDAYMNFITPAYVYEILAWFVYYNSAMNPLIYAFFYPWFR
KAIKLIVSGRILMNDSSSLNLFSEKGEMHD*
1015 >lcl|XP_001380480.1|Plus1120902580..120903617 NW_001581879 trace amine-associated receptor 6-like LOC100031154 __SEG__ Chr2 {Monodelphis domestica} MSDSIGFQPAAVQFCYENVNGSCIQTHYSPVLRFILYLTYGTGVILAVLGNLLVMISILHFRQLHSPANFLIASLACADFLVGATVMPFSMVRSVESCWYFGNSYCKLHT
TFDVAFCYTSLFHLCFISIDRYIAVTDPLTYPTKFTFSVSGLCIALSWAFTMTYSGSVFYTGVSADGLEELISALTCVGGCQLAVNQKWTLIHFLLFFIPSLIMIILYSK
IFLVAKIQARKIENTGSTGDSSDSYKARVSKRERKAAKTLGIAVIAFLISWLPYSLDSLIDAFLGFYTPAYIYEICCWFAYYNSAVNPLIYGFFYPWFRKAIKLIVTGKV
LEHGSSTMSLFSEQE*
1016 >lcl|XP_001380488.1|Plus1120915046..120916083 NW_001581879 trace amine-associated receptor 8a-like LOC100031163 __SEG__ Chr2 {Monodelphis domestica} MSDSIGFQPAAVQLCYENVNGSCIQTPYSPVLRVILYMAFGTGVVLAVLGNLLVMISILHFRQLHSPANFLIASLACADFLVGATVMPFSMVRSVESCWYFGNSYCKLHT
TFDVAFCYTSLLHLCFISIDRYIAVTDPLTYPTKFTFSVSGLCIALSWTITMTYSGSVFYTGVNADGLEELVSALTCVGGCQIAVNQNWILIDFLLFFIPSLIMIILYSK
IFLVAKVQARKIENTGSTGDSSDSYKARVSKRERKAAKTLGIAVIAFMISWLPYSLDSLIDAFLGFITPAYVYEICCWFAYYNSAVNPLIYGFFYPWFRKAIKLIVTGKV
LEHGSSTMSLFSEQE*
1017 >lcl|XP_001380493.1|Plus1120920248..120921285 NW_001581879 trace amine-associated receptor 8a-like LOC100031169 __SEG__ Chr2 {Monodelphis domestica} MSDSIGFQPAAVQLCYENVNGSCIQTPYSPVLQVILYMAFGTGVVLAVLGNLLVMISILHFRQLHSPANFLIASLACADFLVGATVMPFSMVRSVESCWYFGNSYCKLHT
TFDVAFCYTSLLHLCFISIDRYIAVTDPLTYPTKFTFSVSGLCIALSWTITMTYSGSVFYTGVNADGLEELVSALTCVGGCQIAVNQNWVLIDFLLFFIPSLIMIILYSK
IFLVAKVQARKIENTGSTGDSSDSYKARVSKRERKAAKTLGIAVIAFMISWLPYSLDTLIDAFLGFITPAYVYEICCWFAYYNSAVNPLIYGFFYPWFRKAIKLIVTGKV
LEHGSSTMSLFSEQE*
1018 >lcl|XP_001380502.1|Plus1120933627..120934664 NW_001581879 trace amine-associated receptor 6-like LOC100031181 __SEG__ Chr2 {Monodelphis domestica} MTYNNGSQSSSVQLCYENINGSCIHFPYSKGHRVMLYLTYGTGIVLAILGNLLVMISILHFRQLHSPANFLIASLACADFLVGATVMPFSMVRSVEGCWYFGNNYCKLHT
TFDAGFCLTSLFHLCFISIDRYIAVTDPLTYPTKFTFSVSGLCIALSWAFTMTYSGSVFYTGVSADGLEELVSALTCVGGCQLAVNQNWVLIDFLLFFIPSLIMIILYSK
IFLVAKVQARKIENTGSTGDSSDSYKARVSKRERKAAKTLGITVIAFLISWLPYSLDSVIDAFLGFITPAYVYEICYWLGYYNSAVNPLIYAFFYPWFRKAIKLIVTGKI
LQDGSSTMNLFSEQE*
1019 >lcl|XP_001380509.1|Plus1120950849..120951901 NW_001581879 trace amine-associated receptor 7a-like LOC100031188 __SEG__ Chr2 {Monodelphis domestica} MSNNNGSQPAAVQFCYENTNGSCIKTSYSPGFQVILYLTFGFGALLAVLGNLLVMISILHFKQLHSPANFLIASLACADFLVGATVMPFSMVRSVESCWYFGESFCKFHS
CFDGSFCYSSIFHLCFISIDRYIAVTDPLVYPTKFTLSVSGICIMFSWLLALTFSFSLLYTGVNDDGLEELVSALTCVGGCQIAVNQTWVLIDFLLFLIPTLVMVILYCK
IFLVAKHQARKIESMSSKTESSSESYQARVSKRERKAAKTLGIAVAAFLIAWFPYFIETIIDAFLGFITPTYVYEILLWFAYYNSAMNPLIYAFFYPWFRRAIKLIVTGK
VFTGHSSTIDLFSEQIKALD*
1020 >lcl|XP_001380512.1|Plus1complement(71735447..71736544) NW_001581982 probable G-protein coupled receptor 62-like LOC100031191 __SEG__ Chr6 {Monodelphis domestica} MANRTELNETLGAGSPSSRLVGLIPAAFLEVVTLLGNGTVLAVVLRTPALRKAIYLAHLCLVDLLAAASVMPLGLLAAPPGLGTVYLSRGQCRAARFVTATLVSACTLTL
AALGLERYRYILHPLRPRPRPPPALVLGVIWGVSGLLGGLSLLGRPSPNCSLVAGPPGPFRPLWAIVAFALPALLLLVSYGSIFRVARLAALRPPPPAPGPRLRSDSLDS
RLSILPPRLASPHLVGGKAALTLALVVGQFLGCWLPFFAACLLPGRWSLGVEVALTWLAYSSFAAHPFLYGLLQRPVREELSRLARAWLQAVPGPWHCPPGAWLPQSFLK
LLRGDPESPALDPSAGQEASTMTAEGPGPAHGEPT*
1021 >lcl|XP_001380522.1|Plus1120975082..120976134 NW_001581879 trace amine-associated receptor 7a-like LOC100031204 __SEG__ Chr2 {Monodelphis domestica} MSNNNGSQPAAVQFCYENTNGSCIKTSYSPGFQVILYLTFGFGALLAVSGNLLVMISILHFKQLHSPANFLIASLACADFLMGATVMPFSMVRSVESCWYFGESFCKFHS
SFDGSFCYSSIFHLCFISIDRYIAVTDPLVYPTKFTLSVSGMCIMFSWLLALTFSFSVFYTGVNDDGLEELVSALTCVGGCQIAVNQTWVLIDFLLFLIPTLVMVILYCK
IFLVAKHQARKIESMSSKTESSSESYQARVSKRERKAAKTLGIAVAAFLIAWFPYFIETIIDAFLGFITPTYIYEIIVWLCYYNSAMNPLIYAFFYPWFRRAIKLIVTGK
VFTGHSSTIDLFSEQIKVLD*
1022 >lcl|XP_001380535.1|Plus1121009082..121010137 NW_001581879 trace amine-associated receptor 6-like LOC100031219 __SEG__ Chr2 {Monodelphis domestica} MSSSSESQPASVEFCFENVNGSCIKNPYSQGPRLILYVVFGSGAVLAVFGNLLVMISILHFRQLHSPANFLIASLACADFLVGATVMPFSMVRSVESCWYFGDTFCAFHS
CGDTAFCYASLFHLCFISIDRYIAVTDPLIYPTKFTVSVSGLCIALSWIIPITYSGSVFYTGANDDGLEELISALTCVGTCQVYVNQNWVLVDFLLFFIPSLVMVILYAK
IFLVAKIQARKIENTSSKGESLSSESYKARVAKRERKAAKTLGIAVIAFLISWLPYSIDAMIDAFVGFITPAYIYEILCWCAYYNSAMNPLIYAFFYPWFRKAIKLIVTG
KILQDSSSTLNLFSEQGKGLE*
1023 >lcl|XP_001380542.1|Plus1complement(121025178..121026209) NW_001581879 trace amine-associated receptor 5-like LOC100031228 __SEG__ Chr2 {Monodelphis domestica} MGALQEFVSEDQPLTLCYQVNGSCPRTLHPLGIQLIIYLACAIGMLITVLGNLFVVFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPFSTVRSVESCWFFGDFLCRLH
TYLDTLFCLTSIFHLCFISMDRHCAICDPLLYPTKFTVKVAFRYIMVGWGLPAAYTAFFLYTDVVEEGLGMLLDEMPCVGSCQLLFNKFWGWLNFPVFFFPCVIMISLYV
KIFIVANRQAQQISTMSKGTGTSSGQIGASKRERKAAKTLGIAVSIYLLCWLPFTIDTLVDSLLNFITPPLVFDIVIWFAYFNSACNPLIYVFSYRWFRKALKLVLSREV
FSPRTPTIDLYQD*
1024 >lcl|XP_001380545.1|Plus1complement(121039188..121040231) NW_001581879 trace amine-associated receptor 4-like LOC100031231 __SEG__ Chr2 {Monodelphis domestica} MNTPNLWKPPEVQYCFDFVNNSCPRHVRPAISVWVMYMVMISAIVMTMLGNLVVIISISHFKQLHSPTNFLILSMAITDFLMSCMVMPFSMIRSIEACWYFGRFFCRVHS
SFDIMLSTTSIFHLCFISVDRYYAVCKPLHYVTKITIPVIQVFLLISWFIPIFFAFGLIFSDLNIIGIEEFVATIDCEGLCALMFNKFWGTMSSFISFFLPGTVIVGVYI
HIFSVARKHAKQIDTLPNLKQVQGKVREKSLSKNKSKATKTLSIVMGVFILCWLPFFILIITDPYINFTVPEDLYNAFSWLGYFNSTFNPIIYGMFYPWFRKAFKMIVTG
MIFHPDSSTLSLFPAHA*
1025 >lcl|XP_001380551.1|Plus1complement(121058194..121059237) NW_001581879 trace amine-associated receptor 4-like LOC100031238 __SEG__ Chr2 {Monodelphis domestica} MNSPDLWNPSEVQYCFDFVNNSCPRHVRPAISVWVMYMVMISAIVMTMLGNLVVIISISHFKQLHSPTNFLILSMATTDFLLSCVVMPFSMIRSIEACWYFGRLFCKMHS
CFDIMLSTTSIFHLCFISVDRYYAVCQPLHYVTKITIPVIQVFLFISWSIPIFFAFGLVFSEFNIIGAEEFMATIDCEGLCTLIFNKFWGTLSSFISFFLPGTVMVGVYI
HIFSVARKHAKQIDTLPNLKQAHGKVKEKALSKKESKATKTLSIVMGVFVLCWLPFFVLTITDPYINFTTPEDLYNAFLWLGYFNSTFNPIIYGMFYPWFRKAFKMIVTG
MIFHPDSSTFSLFPAHA*
1026 >lcl|XP_001380562.2|Plus118941452..18942375 NW_001581988 olfactory receptor 5AC1-like LOC100031252 __SEG__ Chr7 {Monodelphis domestica} MMEENMTLVTEFILTGLTDRPEFQLLLFSIFLVIYLTTMVGNIGLVVLVWTDSHLHTPMYIFLSSLAFADAWSSSSVTPKMLMNFLSQDKSISILECLAQFYFFGVSATA
ECFLLAVMAYDRYAAICKPLLYPVRMSNRLCSQLVIASYTIGFLHLMIHVGLLFRLTFCRSNIIHHFYCEILPLLKISCTDPSLNALVLFIFSVFIQSFTLLTTLVSYLY
VLFAILRIKSEKGRRKAFSTCSAHLFSVSLFYGTLLIMYVCPGSGVTKNEDIMYSLFYTIIIPLLNPFIYSLRNKEVLGALRKVIKK*
1027 >lcl|XP_001380568.2|Plus1complement(121135968..121137005) NW_001581879 trace amine-associated receptor 2-like LOC100031258 __SEG__ Chr2 {Monodelphis domestica} MLPDRALYLFTFLKVAFDCSEFGNGSCPENDKSLGIRTAMYLFISGAIFITIFGNLAMIISISYFKQLHSPTNFLILSMAITDFLLGFSIMPYSMIRSVENCWYFGILFC
KIHYSFDLMLSITSIFHLCSVAIDRFYAICYPLHYSTKMTISAVKRLLLFCWSIPGTFAFGVVFSEAYADGIEGYDVLVACSSSCPVMFNKLWGTTLCMAGFFTPSSVMI
GIYGKIFAVSKKHARAINTIPENQNSQMKKEKKAAKTLGIVMGFFLFCWFPCFFTILLDPYLNFSTPSVLFDALTWFGYFNSTFNPLIYGFFYPWFRKALKYILLGKIFN
SHFQNANLFTQKESE*
1028 >lcl|XP_001380573.1|Plus1complement(121156537..121157553) NW_001581879 trace amine-associated receptor 1-like LOC100031266 __SEG__ Chr2 {Monodelphis domestica} MTFCQEAINGSCIKNSWTNIIRIPMYCVMILLILTTLAGNLMVIISISHFKQLHTPTNMLINSMAIVDFLLGFLVMPYSMVRSVEKCWYFGEIFCKLHTSTDIMLSSASI
FHLSFISVDRYFAVCDPLRYKAKISVLVVLVMIAISWAVPAIFAFGMIFLELNLKGAEELYYKHIHCKGGCFVFFSKISGILAFMTSFYIPGSIMLCIYGKIYFIAKGQA
RSIKNANQKIQNGFEEKQQLSRRKEKKAAKTLGIVMGVFLICWCPFFFCTVIDPFTDYTIPPFLNDVLIWFGYLNSTLNPMVYAFFYPWFQRALKMIFFGKVFKRNSSRC
QLFLELNT*
1029 >lcl|XP_001380574.2|Plus119039708..19040646 NW_001581988 olfactory receptor 5AC1-like LOC100031267 __SEG__ Chr7 {Monodelphis domestica} MMEENMTLVTEFVLTGLTDRPEIQLVLFPIFLMIYLTTMVGNIGLVVLVWMDSHLQTPMYILLSSLAFADAWTSSSVTPKMLMNFLSQDKSISISECMAQFYFFGASAST
ECFLLAVMAYDRYAAICKPLLYPVRMSNRLCIQLVIASYTIGCLNGMTHVGLLFRLTFCRTNIIRHFYCEILPLFKISCIDPFLNAIVLFICAISLQSFSVTTILVSYTY
VFLAILRIKSENGRRKAFSTCSAHLLSVSLFYGTLLIMYVFPGSGGAKDQDIMYSLFYTIIIPLLNPFIYSLRNKEVLAALRKVIKKVKFLK*
1030 >lcl|XP_001380580.2|Plus119066605..19067528 NW_001581988 olfactory receptor 5AC1-like LOC100031274 __SEG__ Chr7 {Monodelphis domestica} MMEENMTLVTEFVLTGLTDRPEIQLLLFPIFLVTYVTTMVGNIGLVMLVWMDSHLQTPMYIFLSSLAFADAWSSSSVTPKMLMNFLSQDKSISILECMAQFYFFGASTTA
ECFLLAVMAYDRYAAICKPLLYPVRMSNRLCSQLVIASYTLGFLHLMIHVGLLFRLTFCRSNLIHHFYCEILPLFKISCIDASLNALVLFIFALSIQSFTLMTTLVSYTY
VFLAILRIKSENGRRKAFSTCSAHLLSVSLFYGTLLIMYVFPGSGGAKDQDIMFSLFYTTIIPLLNPFIYSLRNKEVLAALRKVIKK*
1031 >lcl|XP_001380597.2|Plus119148563..19149483 NW_001581988 olfactory receptor 5AC1-like LOC100031296 __SEG__ Chr7 {Monodelphis domestica} MAEENKTVTAFILTGLTDLPELQIPLFLVFLLIYLTTMVGNIGLILLVWMDSHLHTPMYLFLSSLAFSDALTSSSVTPKMLVNFCTKSKIISLFECMAQFYFFGASATTE
CFLLAMMAYDRYVAICNPLLYPVRMSNRLCSQLVITSNIVGFLHSMIHVSLLFRLTFCKSTRIHYFYCEILQLFKISCTDSSINTLVVFVFSAFIQTFTFMIIIISYVYV
LSAILRIKSENGRSKAFSTCSAHLLSVSLFYGTLFFMYVRPGSGAAKDQDVMYSLFYTIIIPLLNPFIYSLRNKEVLSSLKKVIKK*
1032 >lcl|XP_001380603.2|Plus119171057..19171995 NW_001581988 olfactory receptor 5AC1-like LOC100031303 __SEG__ Chr7 {Monodelphis domestica} MTEENETLVIDFVLMGFTNHPGLQVLFFLVFLGIYIITMVGNIGLIVLIWMDSHLHTPMYLFLGNLALADACTSTTVSPKMLVGFITQNQMISVPECMAQLYFFSFSATT
ECCLLAAMAYDRYVAICNPLLYPVVMTNRLCSQLSIFSYIVGVLHSMFHVGLLFRLSFCHSNKIQHFFCDIMPLYKISCTDPSINVLMVFIFSGSIQAFTILTILISYTC
ILFAILKKKSQKGRSKAFSTCGAHLFSVSLYFGSLLFMYVRPRSLQADNQDMMDSLFYTIVIPLLNPFIYSLRNKEVIEALRTVLKRTIFSR*
1033 >lcl|XP_001380615.2|Plus119234544..19235485 NW_001581988 olfactory receptor 5K1-like LOC100031316 __SEG__ Chr7 {Monodelphis domestica} MAEENDTLTTDFILTGFTNHPEMKIALFVVFLIIYLVTLVGNLGLVVLISVEPRLHTPMYFFLGNLAFMDACCGCAVTPNMLVNLFSKDRMISMYECMTQFYFLCVVETS
DCFLLAAMAYDRYVAICNPLHYPIMMSKKLCFQMLLVSYIGGNLTSAVHVGFVFRLIFCRSHRINHFFCDVMPLFRLSCVDPHLNVLMMFIFSGSILVFTIVIILVSYLY
ILFTIFTMKSKEGRGKAFSTCASHFVSVSIFYGSLLFMYIRPGSVDEGDKNMPIAIFYTIVIPFLNPFIYSLRNKEVINVLKKNLKKKVSQDI*
1034 >lcl|XP_001380780.1|Plus1complement(86257612..86258826) NW_001581837 beta-2 adrenergic receptor-like LOC100031542 __SEG__ Chr1 {Monodelphis domestica} MSANLSLSIQNNSTQGGEAWMVGLGIVMSTIVLATVFGNVLVITAIARFQRLQTVTNYFITSLACADLVMGLAVVPFGASHILMNMWTFGNFWCEFWTSIDVLCVTASIE
TLCVIAVDRYFAITAPFRYQSMLTKGKARVVILVVWVVSGLTSFLPIQMHWYRASHKEALSCYEKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKKQLQK
IDKSEGRFHVQNSSQMEQNGRTSHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNIIPKYVYIFLNWVGYANSAFNPLIYCRSPDFRYAFQELLCFRR
SALKLYGNGYSSNSNGRSEHNGEHGSCPPEQEKEIELLYEDLPGTEGFLNCAGTVPNASADLEGQEQTLDDTPL*
1035 >lcl|XP_001380866.2|Plus1complement(88907107..88908180) NW_001581837 n-formyl peptide receptor 2-like LOC100031667 __SEG__ Chr1 {Monodelphis domestica} MENVSILLQESSLAPSEKAVDSPHPVWAALDILCIVIFGVTFILGTVGNALVIWVAGFHMPCTVNSVWFINLAIADFAFCLSLPLNMTFVILQRHWPFGRVLCKLHGAMT
NLNLFASVFLVSLFSVDRCVIVLWPLWARKHRRPSLAALGALGVWLMALAFFGISLMIKDTITYHGITYCYNNYDIWNETHGNYELWQQIVIPRYHALIIIRSLCGFVGP
MAIIGICYSLVSAKLWQNQFTLSSRPFRVLIAVVIAFFLCWLPFNILQWVEFISSLKNHQVLHTIVQRLGPIVSSLAFVNSCLNPVLYVFIGRDFREQLLRSLPVILERA
LAEEPQSKGHSSSKSQDVNLSTPHLYS*
1036 >lcl|XP_001380904.1|Plus1complement(132432084..132433331) NW_001581879 EH domain-containing protein 1-like LOC100031716 __SEG__ Chr2 {Monodelphis domestica} MSKTKGHKGSYLFLSVAQRLSKLYLEKLLPLEEMYQFGRFHSPPLTDADFDNRPMVLLMGQYSTGKTTFISHLIEQTFPCMRIGPEPTTDAFIVLMHGEVENVMPGNVAV
VDRRFPFRNLTRFGNAFLNRFNLVQIPNEFLDSISIIDTPGILAGEKQRLSRGYDFSAVLEWFAQRVDLIILLFDAHKLDISDELSQAIKSIKNNEDKMRVVLNKSDQVG
TQQLMRVYGALMWSLGKIINTPEVMRVYIGSFWSEPYVNDENSKLFEAEALDLYKDIQQLPHYSTVRKMNDLIKRARLARVHGYIIATLKKELPLFGKENKKRELITNLQ
EIFLKVQRDYHISSGDFPNVQKMQEILVSQDFTKFQNLKPKLFDTLEDMLSKDITRLMYLMREEEAATVAAIAATEAAASIVQRS*
1037 >lcl|XP_001381032.2|Plus162541745..62542722 NW_001581841 olfactory receptor 226-like LOC100031885 __SEG__ Chr1 {Monodelphis domestica} MEWRNQSGPVTEFVLLGFPAPAPVRALLFSLSLLAYLLVLTENSLIIIAVKSHSTLHKPMYFFLANMSFLENWYVTVTIPKMLAGFATGESGAGQRISFSGCMTQLYFFL
GLGCTECVLLAVMAYDRYVAICHPLRYPVIVSGRLCVHLAAGSWAGGFGISMVKVFLISRLSYCGPNLINHFLCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTG
ASYVAIAGAVMRIPSATGRQKAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNREVKQALSQTLHLHHNWGESSRKSGR*
1038 >lcl|XP_001381045.2|Plus162597961..62598917 NW_001581841 olfactory receptor 6-like LOC100031901 __SEG__ Chr1 {Monodelphis domestica} MREENITNLTEFILVGFPTTVWVQILLFILFLGTYLFVLIENLVIILTVWVNVSLHKPMYYFLATMSFLEIWYISVTVPKMLAGFLLSPNTISFLGCMTQLYFFISLVCT
ECVLLASMAYDRYVAICHPLHYPVIMTTELCIQLTSGSWVCGFSIAVAKVYFISRVSFCSNNVLNHFFCDVSPVLKLACKNFSLAETVDFSLAIVILVFPFSATVLSYGF
IISTVLHIPSAAGQRKAFSTCASHLTVVVIYYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNQEVKDAIRKTIAGGWGLFLRDSSF*
1039 >lcl|XP_001381054.2|Plus162664207..62665151 NW_001581841 olfactory receptor 2AG1-like LOC100031912 __SEG__ Chr1 {Monodelphis domestica} MELWNTTLVNSFFLIGILQDSKSPEVVCAVITLLYLIAMASNGLLLLLITLDNRLHMPMYFLLSQLSLMDLLFTSVVAPKTLVDYLCGQNTISFIGCGLQMFLALTLGGA
EDILLAFMAYDRYVAIRYPLNYMVLMRPAVCWSMVAISWLLASLSALVYTIYTMHFPFCRTQEIHHLLCEILPLLKLACADTSQYELMVYTMGVTFLLIPLSAIVASYTL
VLSAVFHMPSAQGRQKALLTCSSHLTVVGLYYGAAIFMYVLPSAYHSPRQDNILSVFYTIITPALNPLIYSLRNKDVVGALKKVLGKNSSEQRW*
1040 >lcl|XP_001381059.2|Plus162697541..62698485 NW_001581841 olfactory receptor 2AG1-like LOC100031918 __SEG__ Chr1 {Monodelphis domestica} MELWNTTLVNSFFLIGILQDSRSPEVVCAVITLLYLVAMASNGLLLLLITLDNRLHMPMYFLLSQLSLMDLLLTSVVAPKTLADYLCGQNTISFIGCGLQMFSELTLGGA
EDILLAFMAYDRYVAIRYPLNYMVLMRPAVCWSMVAISWLLASLSALVYTIYTMHFPFCKTQEIYHLFCEILPLLKLACADTSQYELMVYTMGVTFLLIPLSAIVASYTL
VLSAVFHMPSAQGRQKALLTCSSHLTVVGLYYGPATFMYVLPSAYHSPRQDNILSVFYTIVTPALNPLIYSLRNKDVVGALKKVLGKNSSEQRW*
1041 >lcl|XP_001381093.1|Plus1complement(28429064..28432162) NW_001581988 toll-like receptor 8-like LOC100031968 __SEG__ Chr7 {Monodelphis domestica} MIPQYLSFTCLCLLVACSPEVLDHIVNSRGYPCSFRKNNSFVFADCQGCRLHSVPMIFKNVTEVDLSFNSIMEITNKSFAGLLNLTKINLNSNVDSQVENRANKRRMNIS
DGAFFNLKNLRDLLLEENLLQKIPVGLPPSLTTLSLVLNNISSISKDNMLGLTHLSSLYLGWNCFYGNGCERNVSIEDGAFEHLTNLTVLSLSFNNLLHVPTKLPPSLKE
LYLSNNKIKNISQDDLKGLENLRVLDLSGNCPRCFNSPFPCVPCENGASIQIHPDAFQNLANLTYLNLSSTSLRSIPVSWFSNMPKLKVLHLEFNYLVQEIATGGFLTKL
RNLEILDLSYNYLKNQYPFYITLSSNFSKLDSLKVLHIRGYVFQELRKKDFQSLMKLPKLQIINLGVNFISRINLTLFKDFRNLTVIYLSENRISPPVTGKYLSFAHHAI
HPRSVDTDNEPLARGIIDPHKNFYHYSRPLVKPECSSYGKALDLSLNSMFFINSLQFQSFNDVKCLNLSFNGNAQVLNGSEFLSMPHIKYLDLTHNQLDFDSDRAFQELQ
ELEVLDLSHNEHYFQIAGVTHRLGFIQNLAHLKVLNLSQNDIFTLTEHQLESDSLEELVFKGNRLDIMWMEEDNRYIKIFTNLSNLTRLDLSFNRLHTIPTEAFHNLPQS
LVELRLNNNHLRVFNWTSLQYFHNLTLLDLRCNSLFTIKPDLYESSVQTLLLGKNIISHLPDGLFSKAKNLYHLDLSYNLIKMVNKSTFHMKTSNNLKILNLRGNPFDCV
CEMGDFRKWIDENPNVTIPRLVDVICSTPGDQTGKSIMELELTTCVSDLTAIISFFFSFIITVTTMVMATFHHFFYWDIWYIYHLCSAKIKGYKSLSTSQTFYDAFVAYD
TKDTCVTDWVINGLRFQLEENEDKKVFLCLEERDWDPGIAIIDNLIQSINQSKKTIFVLTKKYAKNWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRRRIC
KSSVLKWPDNPRAEDLFWQSLKNVVLTDNDTRYNNLYVKFIK*
1042 >lcl|XP_001381382.1|Plus1complement(28739674..28740969) NW_001581894 5-hydroxytryptamine receptor 1A-like LOC100032349 __SEG__ Chr3 {Monodelphis domestica} MDGLTHSNPLPHGHADLSNQSNNTTSSDSPYDRGNNTDFSDVTFGYQVVTSVLLGSLILCAVIGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVL
NKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISLTWLIGFLISIPPMLGWRTPEDRSNPDACTISKDHGYTIYSTFGAFYIPLL
LMLVLYGRIFKAARFRIRKTVKKAEKSADSCFSTSPAPPPKKSINGEPRGKNWRRGAEPKIVGAPCVNGAVRQGEDRAALEVIEIHHYSNSKDHLTLPSDAGGVPSTTSF
EKKNERNIEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPDSLGAIINWLGYSNSLLNPVIYAYFNKDFQSAFKKIVRCKFCRQ*
1043 >lcl|XP_001381465.1|Plus1complement(156294055..156294978) NW_001581879 mas-related G-protein coupled receptor member H-like LOC100032458 __SEG__ Chr2 {Monodelphis domestica} MESTTDAQSHGNGSYLNSQSTEMILAFVSLFITLLGTAGNGFVIWFLLFHFKKNPFTVYILHLSIADLTFLLCAFTTIIGIIISYNFSTGPFKIEVFLIIFYVLVLFGYN
TGFYLLTAISVERCLSVLYPIWYQCQRSKYQSAIVCTILWVFSVFMTSLEAFMYVWEIGFSVRIYIVLQIVVLILNFLVFAPLMVISSLTLFIKVFCNLKHRQPAKLYII
IITTVILFLLFAMPCRFSLMMSNLKAINHESVRVLFPYFTLLSFVNSSVNPIVYVVVGRLRGQRTRKSLKDTLQKVFEDKSHPRVRS*
1044 >lcl|XP_001381523.1|Plus1complement(97589640..97590170) NW_001581837 SCAN domain-containing protein 1-like LOC100032535 __SEG__ Chr1 {Monodelphis domestica} MAAEPESAGPLSPAPPENEAASPVKLEEPAASRDSSKAPASLPGPVAPEASPRVPAASPPASPPAPGPAAQATSPPSPVPFPAVLEASPLAPSPAGSRPGPETFRQRFRQ
FRYHEAAGPREAFHQLRELSRQWLRPEVRTKEQIVEMLVQEQLMAILPEELRARRRGRRSDVRITG*
1045 >lcl|XP_001381576.1|Plus191176177..91178615 NW_001582021 TLR4 interactor with leucine rich repeats-like LOC100032601 __SEG__ Chr8 {Monodelphis domestica} MEVCWTVSFLLLLGSCFSLPPPPPPSEPICPERCDCQHQQHLLCTNRGLRAVPKTSALPSPQEVLTYSLGGNFIANITAFDFHRLAQLRRLDLQFNQIRSLHPKTFEKLS
RLEELYLGNNLLDGLAPGTLAPLAKLRILYVNGNEIGRLSRGSFDGLESLVKLRLDGNSLGSLPDSAFAPLGNLLYLHLEANRIRFLGKNAFAHLGKLRFLNLSGNELQP
SLRHPATFGPLRSLSTLILSANSLQQLGGRVFQHLPRLGLLSLSGNQLTHLAPEAFVGLGALRELRLEGNRLRELPATLLDPLGSLETLDLSRNDLSALHPAAFRRLSRL
RELNLRENALDSLAGDIFAASPALYRLDLDGNGWTCDCRLSGLKRWMGHWHSQGRLLTVFVQCRHPSALRGKYLDYLDDVQLQNGSCQAPAASSSSPPSVLPVVSTASGA
REEQGAPPLGGLGKPQPQQQQRWRALPGVTWDEGVQTHSNNQSGLKLSRRGPDLQHASPSSAPVDRVEEPEGTRPAWKDNGPSWSTPSFQGDASSSFAPSPASDSWQRAE
KQRLALKSQERAAPSVAQEMLPPLVSDPCDFNKFILCNLTVEAVGTDTATVRWAVREHRSPRPLDGARFRLLFDRFGQQPKFHRFVYLPERSDTATLRELRGDTPYLVCV
EGVLGGRVCPVAPRDHCAGLVTLPEAGHVGGRPGGVDYQLLTLVLLAVNALLVFLALAAWASRWLRRKLRGRRKGGAPVHVRQMYSTRRPLRSMGTGVSADFSGFQSHRP
RTAVCALSEADLIEFPCDRFMDSGGGSGGSRRDDHLMQRFAD*
1046 >lcl|XP_001381589.1|Plus1complement(165355001..165356002) NW_001581879 probable G-protein coupled receptor 31-like LOC100032621 __SEG__ Chr2 {Monodelphis domestica} MAPINCSLQDSLVEISIASLLILEFALGLMGNAIALWTFISHLKVWKPYAVYLLNLVIADLLLSVCLPFQISFYLMHKKWELGPAACRILIFLVSLSRTSGIAFLTAVAM
DRYLRVVHPRFKINSFSTQAAKIISVFVWLLVVGLAHPVLVAPKIEKNTTECPSFSPMEDLTFSNTWQEAVICFQFLLPFSLILFCNIRIIKRLQQRLLDQDKQPKLQRS
MALVTIVVVFFGICFLPSFLARILMAIFQRSESCWILQVMVHTCDITNCFTYLNSVLNPIVYCFSNPVFRYSYRKVFSTLRGRQKESQPQCSDRKDSCYTVESNGFHVKR
TWV*
1047 >lcl|XP_001381673.2|Plus115762643..15763581 NW_001581954 olfactory receptor 2A12-like LOC100032729 __SEG__ Chr4 {Monodelphis domestica} MFPASNHSSISEFLLLGFSSDSTSNRILFIIFLLLYLCSVLGNGLIILLISLDSHLHTPMYFFLSVLSLLDMGYVTTTVPQMLVHLLSSSKLISFGGCWLQMYVFGALGL
SEGIIFVVMAYDRYVAICFPLHYTLILNWNLCVRLVVGTCTCGFFLSLPHTYFTMSLPFCGPNMVNHYFCEGPSVRSLACMDTHLIEVVDFIISIFVVLVPLSLILASYV
RITMSILKIKSTQGRFKAFSTCASHLTVVTLFYGPGIYIYMRPNSNYSSERDKQVSLFYNMFTALLNPVVYSLRNKDIKAAFIKVVLQNRIA*
1048 >lcl|XP_001381678.2|Plus115842398..15843345 NW_001581954 olfactory receptor 2A5-like LOC100032735 __SEG__ Chr4 {Monodelphis domestica} MQELIWRNQSSVSEFILLGFSKEPQSRLILFTFFFLLYLSTLLGNGLIITLIYLDSRLHTPMYFFLSVLSLLDMSYVTTTVPQMLANLVHPKKTISYTGCVAQMFIFLVL
GIAECILYAIMAYDRYVAICHPLHYTLIMNRLTCAVMAAICWAIGLLGALVYTVFTMHLPYCGPNEINHFFCEVPAVLKLACADTSLNDQVDFFLGFILLLVPLSLILAS
YTRIFAAILRIRSTQGKLKSFSTCASHITVVIMFYGPAMVMYMRPGSKSSPEHDKKLALFYNVVSAFLNPIIYSLRNKDVKGAFLKIIIKKDIPQ*
1049 >lcl|XP_001381860.1|Plus1complement(108072508..108073821) NW_001581841 beta-3 adrenergic receptor-like LOC100032947 __SEG__ Chr1 {Monodelphis domestica} MAPWPHENSSLLEWPNHPTVASATTNTSGLSAAPWAAAVAGALLALAVLATVGGNLLVIVAIARTPRLQTMTNVFVTSLAAADLVVGLLVVPPGATLALTGQWPFGATVC
ELWTSIDVLCVTASIETLCALAVDRYLAVTNPLRYGSLVTKPRARAAVVLVWVVSTAVSFAPIMSQWWRVGADAEAQSCHSNPFCCAFASNLPYALLSSSVSFHLPLLIM
LFVYARVFAVATRQLRQLRRELGRFPPEEPSPSLLPPSQERPCAPPGGVHSCGRRPARLLLLREHRALRTLGLIMGTFTLCWLPFFVANVVRALGGPTLVPSTAFLALNW
LGYANSAFNPLIYCRSPDFRSAFRRLLCRCDRRLYARPRSPSPRRCLPRSPEASPVPTAGVAGTVKAAQSQGIEDGTETIEQGGRVRSPWEEQREVTQTALCPQLEG*
1050 >lcl|XP_001381881.1|Plus1182168022..182169164 NW_001581879 sphingosine 1-phosphate receptor 1-like LOC100032972 __SEG__ Chr2 {Monodelphis domestica} MGSTSVPSVKAFPSSVSDYVNYDIIVKHYNYTGKLNSSAEGGLKVTSVLFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKL
TPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSFRSFLLISACWVISLILGGLPIMGWNCIGYLHSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYC
RIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSAFIACWSPLFILLLLDVGCKVNTCKILYKAEYFLVLAVLNSATNPIIYTLTNKEMRRAFVRIMSCCKCP
SRDSGAKFKRPIIGGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS*
1051 >lcl|XP_001381915.1|Plus1189814681..189815817 NW_001581879 protein arginine N-methyltransferase 6-like LOC100033018 __SEG__ Chr2 {Monodelphis domestica} MSLPKKRKTDAADGGGGEGSAGEEEDGGERDPGGPGEAQESEQGARDRLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWASLRGKTVLDVGAGTGILSVFCAQAGARR
VYAVEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLHESMLASVLHARAKWLKEGGLLLPASAELFLAPINDRTLEWRLGFWGEVKQRYGV
DMSCLEGFATRCLMGHSEIVVQGLTGEEVLARPQRFAQLQLDRDDLQQELQAGVGGRFSCRCYGSAPMHGFALWFQVTFPGGDGEKPLVLSTSPFHPETHWKQALLYLDE
PLQVEQDTDISGEITLSPSRDNPRHLRVLLRYKVGDQEEKTKDFRMGD*
1052 >lcl|XP_001381944.1|Plus1complement(192624352..192625833) NW_001581879 amphoterin-induced protein 1 AMIGO1 __SEG__ Chr2 {Monodelphis domestica} MQHQSGCRGIWLLPLSLFLSSLGVARTGRSLLSCPTGCLCASNILSCTKRGLSNVPQSLPRYTAFLDLSHNNLTHLRAQWTTIHLIHLQSLFLSHNHLHFISTEAFTPVP
GLRYLDLSSNHLKTLDESLFSELKNLEVLLLYSNQIVEVDRSAFDDMVNLQKLYLSQNQIARFPVELVKDRSKLPSLTLLDLSSNKLKLLPTADLQDLPAWMKNGLYLHN
NSLSCDCEIQKLFTHWQYRQLSSVTDFQEDLYCMYSKKMYSVFNITTLNCSEFKECAFEAYLGESLIISCDTKQQGMTKEWVTPNNEKVLNEVGNGTVKVLQNGSLQFEH
IRVEDQGLYTCYAVGEAFNETLSVEVKVHNFTRHGPHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRAGERPTSHQGDSLSSSMLSTTPNHDPMAGGGGKDSGFDR
RVAFLEPTGPGQGQNGKLKPGNTLPVPEGAKGQRKMSDPESVSSVFSDTPIVV*
1053 >lcl|XP_001381953.1|Plus1192698011..192699360 NW_001581879 probable G-protein coupled receptor 61-like LOC100033064 __SEG__ Chr2 {Monodelphis domestica} MESSPIPQPSGNSSTLGLPPLPQGPPRVNGSPEVRYRDVASESVALFFMLLLDLTAVAGNAAVMTVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDDALF
GETACRLYLFLSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVCVWVKAVAMASVPVLGRASPGPPDFPPGCSLQWSLSAYCQLFVVVFAVLYFLLPLL
LILVVYCSMFRVARVAAMQHGPLPTWMETPRRRSESLSSRSTMVTSSGPPRTTPHRTFGGGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSAQPLPTQQVESVVTWIGYF
CFTSNPFFYGCLNRQIRGELSKQFVCFFKPSPEEELRLPSREGSIEENFLQFLQGTGCATEPWAPQTPISPKQEPPAVDFRIPGQIAEETSEFLEQQLPSDITVSDGYLH
PTLSPQPEP*
1054 >lcl|XP_001382061.2|Plus1125837289..125838614 NW_001581841 alpha-2B adrenergic receptor-like LOC100033192 __SEG__ Chr1 {Monodelphis domestica} MDSPEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDR
YWSVSRALEYNSKRTPRRIKGIILTVWLIAAFISLPPLIYKGDKGKKPGGRPQCKLNEEAWYILSSSIGSFFAPCLIMILVYLRIYLIAKRRNRQGPHSKQAPGDGDTGP
SAPVGTSIISKLPPSILPAVGEANGHSKPPGEREGGEQMGDPTSPSTPPNQSSVGPEDGSQKQEEEEEEEEEEEEEEEEECGPPALPTSSPPQGTPNFQPPQGSQVLATL
RGQVLLARGPASLGLQPWRRRTQMNREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRQWTQTA
W*
1055 >lcl|XP_001382094.1|Plus1133555799..133557805 NW_001581841 complement component C1q receptor CD93 __SEG__ Chr1 {Monodelphis domestica} MGTALLPLILLLLNQMLFSTRSWAEASNEEEEEAAAVCAGTACYTAHWDKLSASEAQLSCSTNGGNLATVKNEEEAQHIQEALAQLPDREAPGRTVKFWIGLQREKGKCM
NPDEALKGFSWVGGAENTSYSNWQKEPMSTCISKRCASLSVDLSASSLAAAHSVPKWTESPCGTTDSPGRNIEGYVCKFSFKGMCHPVALGGPGEVTYTTPFGATSTSLA
AVPFASAASVNCGYGDERKSHYLVCKERNPNQFDWGTSGPICASPNHGCAFNNGGCQQECLEGGDGSFLCGCRPGYRLLDDLVSCVPRDPCHPNPCRGKAKCSPGGHGKH
YECLCPAGFKPTPNRLDCDDVDECDRIPCAQDCVNTPGSFHCTCRPGYEPQGHNGMECWDVDECAEGRSPCAQLCNNTEGSFQCTCHKGYVATGEDGTQCQDVNECDDEG
NPCESLCFNIQGSFRCGCLPGWNLAPNGVSCIANHTMSVLPSDDQEKDEKERKIISDVEKKKGEKEKEKENSDSSSPVLDTIKRLEVTPGVSIPYNEASTVGRLSQQSNP
PITQSLPRPPTFSRKPKLQLISSTVYPTEITTDGGLHKGKSLANGSDGDTDGQKFLLFYILGAVAAVLLLLAMALGLVFYRKKKTKKAMKKKSPKNAADSYSWVPEQVEN
RAIENEYR*
1056 >lcl|XP_001382095.1|Plus1133612927..133614564 NW_001581841 thrombomodulin-like LOC100033239 __SEG__ Chr1 {Monodelphis domestica} MAELGLPASPALQPGGSQCIEDDCYAVFWSPEQFTGANLVCQQFGGHLMTVRSSVAADVISLLAQGGSEISLPASRLWIGLELEQNCSHEQKGQLRGFRWVTGDTSTSYS
KWKHSGRGALCGHQCVVVSEDSASGSVELVWEEHSCDLVTEGFLCEYNYFGSCKPLNLEPSIGVNVTYSTPFGGKGADFQALPLNSHALVVPLGLDLVCKKVEDTPRWSK
ESLGPWDCRVENGGCSQICSQDNGNPECLCSQGTLSKADLRSCLTEGDLCNPGRCDQYCQLSSEAPGGYTCMCDSGYYLGEDGHSCIDVDDCALDPNPCPQKCVNTLGAF
KCECNPGFELLDSECVELLDPCFGIQCQHKCLPLEGGAYRCICKEGFMPIPDQPDRCMSFCNTSECPAICNPYNPDDCQCPDGYILDEDQMCSDIDDCAADECRGGECIN
LPGSFQCICPPPYTLSRTGQECILIEIVSGDEGSGTIPSTEATGPTTSSPVAGPIHSVVLIGIAVSILSIITVLLATICHLRKKKYSAQATLDYKCAGPTKEEVL*
1057 >lcl|XP_001382096.2|Plus1complement(133632203..133633228) NW_001581841 somatostatin receptor type 4-like LOC100033240 __SEG__ Chr1 {Monodelphis domestica} MIIIQSIYALVCLVGLVGNALVIFVILRYAKMKTATNIYLLNLAIADELFMLSVPFVASSAALRHWPFGSALCRTVLSVDGLNMFTSVFCLTVLSVDRYIAVVHPLRAAT
YRRPSVAKLINGGVWLASLLVTLPITIFADTKPTRGGQAVACNLHWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVA
VFVLCWMPFYVVQLLNLFMPSLDATANHVSLILSYANSCANPILYGFLSDNFRRSFQRVLCLRCCLLDAASAAEEEPLDYYATALKSKGGGCMCPALPCQQEPVHPEPCG
KHGTLTRTTTF*
1058 >lcl|XP_001382199.1|Plus1192007982..192008950 NW_001581841 oxoeicosanoid receptor 1-like LOC100033380 __SEG__ Chr1 {Monodelphis domestica} MSTCKLKATPALSAFLAPVLTLECIVGLVGNGFAFFIFCVHIRPWKSNTIFLLCLVIADFLLIINLPFRIDYYVNGQKWNFGPGACKANLFMMSTNRTASIIFLTAVALN
RYLKVVWPHHTLSRASARSAAQVSVGLWVLILLMNMPLLLQDHQPVYSNFSCLSFTINSTGSIPQRWHHILYVLEFFLPLGIILFSIFSIIITIRRRKLDKQAGTRRAVL
VLGVIVTVYISCFLPSIVFAIASILAQRVSNCQTLNLCTELFHGALAFTYLNSTLDPMLYLFSSPSFLHQSKVLLCRAEQSAQTCDEQEGDEGSSFYQTRFK*
1059 >lcl|XP_003339501.1|Plus18742479..8743519 NW_001581835 probable G-protein coupled receptor 33-like LOC100618549 __SEG__ Chr1 {Monodelphis domestica} MPQEVTDLNNTTAYLINMTTLRRNISFATSVSITYLATAPLLYITFIASIIANGFYLWVLRFKMKKTINTLLFFHLILSYLISSLIIPFKITSFLQSDHWSFGIAMCKVF
NSTFSLGMFASVFILSAISLDRYILTLHPVWSQKHRNIHWASSILTGIWIFATIFSIPYLIFREIHKESNGIVTCKNNYALSNNWKSQKTQTLGKGVQMVLFISRLWLGF
LLPLFIIIFCYVKVAQRMRQRRLVKSSKPFKVMVISVGSFFVCWMPYHVYQGLLISESHMQVTKLTLILTAITSSFNSFFSPTFYLFIGENFKKVFKKSIVVLFDSILHE
ESSLKQPQNPCTEVSV*
1060 >lcl|XP_003339576.1|Plus140977690..40980122 NW_001581837 protocadherin alpha-5-like LOC100026821 __SEG__ Chr1 {Monodelphis domestica} MAFSWGGGLRVWQLLFLILFHTAWEVGSGQVHYSVLEEAKHGTFVGRIAQDLGLEVGELVPRLFRVVSKGRRDYLEVNAQNGILFVNSRIDREELCGRNPICGIHLEVIV
DKPLQVFHVEVEIKDINDNPPVFLVKQQRLFILESRTADSRFPLEGASDADIGANAELLYKLSGNEHFTLDIHTNEEEAKSIELVLKKSLDREETPEHSLLLTATDQGKP
ELTGTAQLLITVLDANDNAPAFDKSVYNVRLLENIPNGTLVIRLNASDADEGVNKEIQYYFGSPVLTNVRSKFSIDSNTGEIRVNGNMDYEECNLYEIKVEAIDRSSFPL
TGHCKVMVKLLDLNDNAPQVSVTSLSLPVLEDSPSGTVIALISVSDRDSGANGQVTCFLGPLGPFTLVSTFRNYYSLVLEGSVDRESVPAYELVVTARDGGTPALWTTAS
VFVSIGDVNDNAPAFEQPVYTVFVKENNPPGCHIFTVSASDPDAQENALVSYSLVEGRVGERPLSSYVSVHSESGKVYALQPLDHEELELLHFQVSARDAGFPPLGSNVS
LQLFVLDENDNAPTLLPPHSGVSPVTELVSRSVAVGHVVAKIRAVDMDSGYNAWLSYELLPEVDTGRSPFRVGLYTGEIRTMRVLEDSDVSRHILLVLVKDHGTPILSST
ATVSVLVVENGQAFKTSSSASVVLAKAGMGQETTLMDVNVYLIIAICSVSSLLVLSLLLYVALRCSAPPKDVRGPGKPTLVCSSEVGSLSYSQQRRQKVYSWDGVTKNDL
MAFSPNLPQAPDSREGGQTQEVVMEHPGKVSSNFPLLATI*
1061 >lcl|XP_003339578.1|Plus141384107..41386479 NW_001581837 protocadherin beta-1-like LOC100617211 __SEG__ Chr1 {Monodelphis domestica} MALPPREMTRQVFFVYTFLFGGFRVVGESIRYSVAEEIPIGSFVANFAKDLGMDVKVLSSRQARLVADGLREHFLLDLKTGELVTKDRIDREVICAQIDECMVHFELLLQ
NPLKFFRAEVAISDVNDHSPQFPEDKFILKIPESTTIGTCFPLESAQDLDAGNNTLQNYTLTPSNEFFVLHTWERSDGSKYPEMLLAKSLDREEQPEFEFLLTAVDGGIP
PRTGTASIRIIVLDANDNAPVFSQSLYRATVAENSPAGSVVSTIFAADSDQGSNGEVTYSFSQNAGKSHRAFHIDPLTGEIRISKPLDFETTEYYELSVRATDGGGLSSH
CKVLVEVMDVNDNPPEVTVTSISTLLPEDSLTGTVVALFSIRDRDSGDHGRTTCSIPNDIPFTLKPTFSNYYELVTDAALDRERVSSYNVTVTAIDLGSPPLSASETVTV
QILDINDNLPLFNQSSYTMYVTENNSPSLMIGGVNATDSDSGQNAKVTYSIWPENKSSLFSSPLISINSENGQVYILKTLDYEEIKDFKVTVKASDSGSPSLSTNVTIYV
VIVDENDNAPVILYPMRNYSASYSELVPRAAEEGYLVTKVVAVDKDSGQNSWLSYQLLKATDPELFIVWSHNGEVRTARSISDRDAIKQKLIILVRDNGSPMLSTPAALD
LLLVDGFSESHIHIPDSIEEEKYDGTLTMYLIISLTLISFLFLVSITIFIVIKVYKRKQLKKRSHYHFGDANSFPRSLADITGTGTLFQTYKYDMCLASGSDNSEFKFLK
PINPSFPPQLENNEIFPKGN*
1062 >lcl|XP_003339646.1|Plus1complement(23761150..23762085) NW_001581838 olfactory receptor 2D2-like LOC100617107 __SEG__ Chr1 {Monodelphis domestica} MNQTNHSRVTEFLLLGLSDDPHMQLLLFILVLGVYLVTVLGNLLLIFLVLTDTQLHTPMYFFLCNLSTADLFFSTNIVPQALVHMLSKRKVISFIGCAAQLLLFLIFGCT
QSALLAVMSYDRYLAICDPMHYSLIMTGRLCCLLSLGCWTSGFLISIVDTTFTLHLPYQGDNKISHFFCEAPAILAIASGDTHSSKMAIFLMGMMILLAPVSLILVSYGS
IIVTVIRMKTASGRLKAFSTCGSHLLVVILFYVTGIMTYMTPKSSKEQGKLVSVFYAVINPMLNPLIYSLRNKDVKRAFRNATKRGKVCKL*
1063 >lcl|XP_003339655.1|Plus1524345..525271 NW_001581839 olfactory receptor 2D2-like LOC100617944 __SEG__ Chr1 {Monodelphis domestica} MNQTLVTEFFLLGLSDDPQTQLLLFALFLVVYLGTILGNLLLTSLVLLDSQLHTPMYFFLCNLSLADFCFSTTIVPQTLIHMLSRRKFISFRGCAVQLLSVLFFGSTQCS
LLGVMSYDRYLAICDPMHYPLIMTQKVCGLLAFGCWSSGLVASVVDTAYTLHLPYQGDNRISHYFCEPPALLVVASADTYSTEIAIFLMGVVILLFPVSMIMVSYTCIIV
SVVRMKTASGRLKAFSTCGSHLIVVIIFYGSAIINYMTPKSAKELGKITSVFYAVINPMLNPLIYSLRNKDVKRAFRNVANRRPVFRS*
1064 >lcl|XP_003339656.1|Plus1766788..767708 NW_001581839 olfactory receptor 2D2-like LOC100618282 __SEG__ Chr1 {Monodelphis domestica} MNLNNQTWVTEFLLLGLSDDPQTQLLLIILFLGVYLGTVLGSLLLIYLVLTDSHLHTPMYFFLFHLSLADLGVSTTIVPQALFHMLTRKKAISFMGCAAQLFFTLHFGST
QCSLLAVMSYDRYLAICDPMHYSLIMTGRLCGQLALVCWVCGIVVSSVDTVFTLSLPYQGDNRIAHFFCDAPVILTLASGDTHKAEVAIFFMGVVILLTPVSLILVSYGF
IIVTVIRMKTTSGRLKAFSTCGSHLLVVILFYGTLISSFMTPKTLREQMKQVAVFFVVINPMLNPLIYSLRNKEVKRAFKTAVNRK*
1065 >lcl|XP_003339700.1|Plus15724822..5725166 NW_001581841 notch-regulated ankyrin repeat-containing protein-like LOC100616914 __SEG__ Chr1 {Monodelphis domestica} MSQAELSTCSAPQSQRIFQEAVRKGNTKELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYS
ASGR*
1066 >lcl|XP_003339827.1|Plus140794561..40795511 NW_001581842 melanocyte-stimulating hormone receptor-like LOC100618641 __SEG__ Chr1 {Monodelphis domestica} MPMPGQQKRLFNSLNSTSPDTLHQAVPTNQTDISCQGLFIPDELFLTLGLVSLVENMMVVVAIIKNRNLHSPMYYFVCCLALSDLLVSVSNLLETSVMLLLEKGVLMIQM
PMLQQLDNVIDVLICGSMMSSISFLGAIAVDRYISIFYALRYHSIVTPCRAKGVLAGIWVSSAFSGTLFISYYNHNAVLLCLIGFFLSMLGLMVVLYIHMFIQACQHARR
IARLHKRHAIHQLSTLKGAITLMILLGIFFLCWAPFFLHLTLIVLCPKHPTCSCYFQNFNFFLILIICNSIIDPLIYAFRSQELRKTFKEVILCSW*
1067 >lcl|XP_003340054.1|Plus140071851..40072762 NW_001581861 olfactory receptor 4K3-like LOC100618713 __SEG__ Chr1 {Monodelphis domestica} MDRGNQSVVSEFVLLGLTDSWELQICLFLLFSVIYLATVLGNILIMTTVIADSHLHSPMYFLLANLSFVDLWLSSVTIPKAIIDFFRESKTISFGTCMWQVVFVHFAGGG
EMVLLVTMAYDRYVAICKPLHYTTIMSQQRCIWLVVISWAIGLVHSISQLAMIVDLPFCGPREIDSFFCDLPLVIELACMDTYILGSLVNADSGFLATACFILLLISYVY
ILLTVRHHSTDGVYKALSTCTAHIMVVLIFFVPCIFIYLCPLNIPSVDKFLAVFYAVFTPLLNPSIYTLRNKEMKEAMKRLSM*
1068 >lcl|XP_003340056.1|Plus1complement(40361549..40362481) NW_001581861 olfactory receptor 4K14-like LOC100619212 __SEG__ Chr1 {Monodelphis domestica} MDHQNYSVVSEFVLRGLSNSLQLQLFFFVFFSLVYIATVLGNLLIVVTVISEPRLYSSPMYFLLGNLSFLDMWLASFATPKLIKDFLSEMKLISFGGCMAQIFFLHFIGG
AEMVLLVTMAYDRYVAICKPLHYLTIMSWRTCIGLVMISWTIGFIHSISQIAFTVNLPYCGPNIVDSFFCDLPRVIELACTDTYVLGILMIAHSGLLSISCFLLLMISYT
IILVTVQQHSSRSASKALSTCSAHIMVVTIFFGPCIFIYLWPFSRFSVDKVLSVFYTIFTPLLNPIIYTLRNEDMKTAMKKLRIQHKFFH*
1069 >lcl|XP_003340062.1|Plus140950073..40951086 NW_001581861 olfactory receptor 11G2-like LOC100616772 __SEG__ Chr1 {Monodelphis domestica} MFPSVLSTDSVPLNMSGGNRVTEFILLSFPCPREMQILLFGVFSLTYVLTLMGNGSIIWAVRLDHQLHTPMYILLAHFSFLEICYVNTTVPNMLANFLSETKTISFTACF
LQFYFFFSTGITEPFFLSLMAFDRYLAICQPLHYPTIMTGHFCIKLVLFCWVTGFLCFPLPIYFMTQLPFCGPNVIDHFICDPGPLLALTCVHSPKLELSFSIIPSLAIF
LTFPFILGSYALVFRAVLQVPSAAGRKKAFSTCGSHLTVVSLFFGTVLVMYITPTSGHITTTQKIVTLFYSVFTPLVNPLIYSLRNKEMKTALKKVQLAMKILPNKWDSV
SKPALKS*
1070 >lcl|XP_003340073.1|Plus1complement(44917265..44918200) NW_001581861 olfactory receptor 6C4-like LOC100619010 __SEG__ Chr1 {Monodelphis domestica} MGNSTTITEIILQGLTDACEFQMLIFVGLLLTYIITLLGNFLIIVVTLMDHRLHTPMYYFLRNFAVLEIWFTSVIFPKMLNNILTGNKTISLLGCFLQCFLYFFLGTTEF
LLLAVMSFDRYVAICNPLRYATIMSKRVCVQLVLSSWLGGFLLIIVPSCITFQQPFCGPNVINHFFCDNFPLLELICADTSLVELIGFLGANVSLLGTLSVTASCYGHIL
YTILRIPSAKERQKAFSTCSSHIIVVSLFYGSCIFMYVRAGKGSEGEDLNKVVAILNTVVTPMLNPFIYTLRNKQVKLVISEKVGKWISQV*
1071 >lcl|XP_003340092.1|Plus1complement(40408810..40409748) NW_001581861 olfactory receptor 4K1-like LOC100618848 __SEG__ Chr1 {Monodelphis domestica} MEWSNKSVVTEFILLGLSSSWGLQLSLFFVFSLFYGAAVLGNLLIILTVITDSRLHSPMYFLLSNLSFIDVCQATFATPKMIADFLNEHKTITFEGCMSQIFFLHVFGGS
EMVLLVAMAYDRYIAICKPLHYMTIMSRRVCTVLVSVSWAIGILHSASHLVFTVNLPFCGPNKVDNFFCDLPLVIKLACLDTYFLEILVLTNSGLLSLICFILLLISYTI
ILVTVRSRSSTGTSKALSTLSAHVTVVVLFFGPLIFIYIWPFDSFPIDKFISVFFTVFTPFLNPIIYTLRNEEVKAAMRKLRSRHIGSKQIS*
1072 >lcl|XP_003340178.1|Plus1complement(503127..503903) NW_001581870 hypothetical protein LOC100616734 LOC100616734 __SEG__ Chr2 {Monodelphis domestica} MSAPPRQPALPWPWLLLLLPLLLPAPPSRARGDSVPPAPPPPPSPEPEAEPGPDPPWCPYKVLSEGQEAGSGRLCFRSPEPDFRCQQRLCKAYRSAGRTLVANVLRNSSV
LLQWRPPPAAPARELRGFALNCSWDGSYTRFQCDRVQLGASCRDYLVPDVHDSVRYRLCLQPLLRRPRREPPRPGAPPAPTPPPPPPPPAECVEFAAEPAGMRDIVIAMT
AVGGSICVMLVIICLLVAYITENLMHPAFGRPRGRRQP*
1073 >lcl|XP_003340196.1|Plus1<60289589..60290539 NW_001581871 guanine nucleotide-binding protein G(s) subunit alpha-like LOC100029582 __SEG__ Chr2 {Monodelphis domestica} HVNGLNAEEKKMKIQDIKNNIKEAIETIVTAVGNLAPPVELANPENQFRIDYILNLANQIDFDFPPEFYEHTKTLWQDEGVKACYERSNEYQLIDCAQYFLDKIDVVKQN
EYTPSDQDLLRCRVLTSGIFETKFQVDKVKFHMFDVGGQRDERRKWIQCFNDVTAIVFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLA
EKVLAGKSKIEDYFPEFARYTTPDDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL*
1074 >lcl|XP_003340200.1|Plus163034593..63035534 NW_001581871 olfactory receptor 6N1-like LOC100616874 __SEG__ Chr2 {Monodelphis domestica} MDTGNWSKVTEFIILGFPHLQGVQTYLFLLLLLIYLVTVLGNLLIFLVVRLDAKLHTPMYQFVSVLSLLELGYTAATIPKMLANLLSKKKTISFSGCLLQIYFFHSLGAS
ECYLLTAMAYDRYLAICRPLHYPTLMTPTLCTKMAAGCCLGGLAGPIVEISLVSRLPFCGPNHIQHIFCDFPPVLSLACTDTSINVMVDFIINSCKILATFLLILTSYVQ
IIRTVLRIPSAEGKRKAFSTCASHLTVVLIFFGSILFMYVRLKKSYSLDYDRALAVVYSILTPFLNPFIYSLRNKEIKDAVRRLLQRTRMLHI*
1075 >lcl|XP_003340202.1|Plus163225452..63226408 NW_001581871 olfactory receptor 6K2-like LOC100617171 __SEG__ Chr2 {Monodelphis domestica} MDTSNWTTAQEFIFSVFPVDWGNAVTCFVPLLFIYAFILIGNLIIIMVVQLNVHLHTPMYFFISILSFLEIWYTTSTIPIMLSSLLSERRSISLNVCMVQLYFFHSTGIS
EMCLLVAMAFDRYLAICKPLHYPTIMTPRLCVQLTLICCVCGFITPLPEVVWISTLPFCGSNHLEHVFCDFLPLLRLACTDTRAIVLIQVVDVVHAMEIVADIFLILLSY
AGIVAVVLRIHSAEGRRKAFSTCASHLTVVSLFFSTVGLTYLRFSDTHSLIWDTAIALSFTVLCPFFNPIIYSLRNKEIKEAIKKYMSQSKIFSHKAR*
1076 >lcl|XP_003340205.1|Plus1complement(63585534..63586466) NW_001581871 olfactory receptor 10X1-like LOC100617528 __SEG__ Chr2 {Monodelphis domestica} MSINKTLLEEFILVGFSIYPDWQVVLFVTFIFLYLLTLTGNLAIMAITWMDHTLHTPMYLFLSALSFSETCYTLTIIPKMLVDLLAKDRSISIPGCGLQMCFFLGLGGTN
CVILTVMGLDRFLAICNPLRYPIFMTNKVCGQLVASAWIGGFFISLTETTLIFWGSFCGPNFIKHFFCHMRAVIKLSCQNRDITEVVITIIPVSGLLGTFLFIVLTYVFI
LSTVLKIPSAEGRKKAFSTCASHLTVVIIHFGFASIVYLKPEAEEGDDTLMSVPYTVVTPFLSPLIFTLRNKDMKNALKKVLDKKFSLTK*
1077 >lcl|XP_003340206.1|Plus1complement(63668629..63669561) NW_001581871 olfactory receptor 10X1-like LOC100617652 __SEG__ Chr2 {Monodelphis domestica} MSINKTLLEEFILVGFSVYPDWQVVLFVTFLFLYLLTLTGNLAIMALTWVDHTLHTPMYLFLSALSFSETCYTLTIIPKMLVDLLAKDRSISIPGCGLQMCFFLGLGGTN
CIILTVMGLDRFLAICNPLRYPIFMTNKVCGQLVASAWIGGFFISLTETTLIFWGSFCGPNFIKHFFCHMRAVVKLSCRNRDITEVVVTIISVSGLLGTFLFIVLTYVFI
LSTVLKIPSAEGRKKAFSTCASHLTVVIIHFGFASIVYLKPEAEEGDDTLTAVPYTVVTPFLSPLIFTLRNKDMKNALKKVLDKKFSLTK*
1078 >lcl|XP_003340227.1|Plus162517414..62518355 NW_001581871 olfactory receptor 10J4-like LOC100617922 __SEG__ Chr2 {Monodelphis domestica} MPRPNYTVVNEFTFEGFSSFRWQNRLILFVVFLGLYLMTLTGNGIIVTIIRLDRHLHIPMYFFLSVLSISETCYTLAIIPRMLADLLSPQQPIAIPECATQLFFYLTFGI
NNCFVLTAMGYDRYVAICNPLRYSIIMRKSVCAQLACGSWGIGLGMAIIQVTSVFGLPFCDATVISHFFCDVRPLLKLACVDTTINEIINFVVSVCVLVLPMGLVFISYV
LIISTILKIASAEGRKKAFATCASHLTVVIIHYGCASIIYLKPKSQSSLEQDRLISVTYTVITPLLNPVVYSLRNKEVKDALHRALGKKTLSS*
1079 >lcl|XP_003340366.1|Plus18971498..8972433 NW_001581876 olfactory receptor 2Y1-like LOC100618888 __SEG__ Chr2 {Monodelphis domestica} MRQFNTSSQDFILLGFSDWPHLEHLLFVIILIFYLLTLVGNTAIIVVSNLFPQLHTPMYFFLCHLSFLDLCYTTSIVPQLLVNLHGFDRTITKGGCVAQLFISLALGSTE
SVLLVVMAFDRYAAVCRPLHYTTIMQPWLCLLLASISWFGGFVNSVAETGLMMAMPLCGLRYLDHFFCEMPVFLKLACKDTKDTEAKMFVARVIILVLPASLLLVSYVYI
IQAVLNIKSAEGQRKAFETCGSHLMVVFLFYGSAIYTYLQPTHNYSTSHGKFIALFYTIITPMLNPLIYTLRNKDMKAALRKVIKRKRALG*
1080 >lcl|XP_003340399.1|Plus1complement(293843..294796) NW_001581878 putative olfactory receptor 2W6-like LOC100617279 __SEG__ Chr2 {Monodelphis domestica} MRAMEKINDSSEYGFILVGFSDRPKLELILFTINLTLYSVAVLGNTTIILVSILDPRLHTPMYFFLANLSFLDLCFSTSCIPQMLVNLWGPDKTISYAGCAVQLFSFLSV
GGIECILLAVMAYDRYAAVCKPLHYMVIMHPRLCLQLVAVAWGSGLVNAIVMSPLTMTLSRCGRRHVNHFLCEMPALIKMACVDARAVEMLAFTFAIPIVLMPLFFILVS
YGYIAAAVIRIKSAAGRKKAFNTCSSHLTVVSLFYGSIIYMYMQPGNSSSQDKGKFLTLFYNLVTPMLNPLIYTLRNKEVKGALKKVFGRQKEARER*
1081 >lcl|XP_003340417.1|Plus1complement(1021023..1021964) NW_001581878 olfactory receptor 12D2-like LOC100619724 __SEG__ Chr2 {Monodelphis domestica} MPNHTSVNEFLLLGITDIRELEPFLFAVFLIIYILILIGNGAILVIVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLDNFLSTHKTISFVGCIIQLHFFHFLGSTEA
ILLGVMAFDRFMAICNPLRYTILMNHEVCLCLAAATWITGFFHALLHSIMTSRLTFCGSNHIHHFFCDIKPLLDLACGNTELNQWMLETVTGTIAMSPFFFILLSYFYII
SFLLFKSRSCSMLQKALSTCASHFIVVILLYVPVVFTYIRPSSGSSMNHDRIVAIMYSVVTPVLNPLIYTLRNKDVKGALNKAMRKKLWSKQL*
1082 >lcl|XP_003340418.1|Plus1complement(20875124..20876059) NW_001581878 olfactory receptor 12-like LOC100617074 __SEG__ Chr2 {Monodelphis domestica} MERNFSDVTEFILLGFRVSPELQIILFLVFLLIYVVILVANIGMTVLIKMDPRLHTPMYFFLRNLSYLDLCYSTVIAPQTLTNFLSSSKTISYNSCAAQFFFFAFFVTTE
GFLLAVMAYDRFTAICSPLLYPVRMSQSLCIRLVAGSYFGGCINSMVQTGFTFSLQFCGENRIDHFFCDISALIKISCVDTFLNEIVLFILSAVIIISTSLVILVSYSYI
LTAVLKIPSTRGRRRTFSTCGSHIAVVSLFYGTVFFMYAQPGALSSPEKSKVVAVFYTLVIPMVNPLIYSLRNKDVKESVKRILGKKRSSQ*
1083 >lcl|XP_003340475.1|Plus146395916..46396872 NW_001581879 olfactory receptor 14A2-like LOC100618929 __SEG__ Chr2 {Monodelphis domestica} MGNLTVVTGFLLMGFSNTSDLQILHAMFFLLIYLVALIGNLLIFTLISLDGCLHTPMYFFLKNLSFLDLCLISVTVPKSIANSLSHSCSISYLGCVLQLFLVILFAGSEI
SILTVMSYDRYIAICQPLHYETIMNKESCVKMAVASWFSGGVVGTMYSASTFSLPFCGSREIHQFFCDVPSLLRISCSEKHMVVYVSVFIGLGLVIFCCISIIISYGHIF
STVLKIPTTQGRSKAFSTCLPHLIVFIVFVITGSMAYLKPHLDSDSVLDLLLSMFYTVVPPTLNPVIYGLRNKDMKTSITKFIAWKHSSERLMKLSFP*
1084 >lcl|XP_003340477.1|Plus146752458..46753414 NW_001581879 olfactory receptor 14A2-like LOC100619512 __SEG__ Chr2 {Monodelphis domestica} MANFTMTTGFLLMGFSDIWELQILHAMFFLLIYLVALIGNLLIFTLISLDRKLHTPMYFFLKNLSFLDLCLISITVPKSIANSLSHNCSISFLGCVSQLFLMMLFAASEL
FLLTAMSYDRYVAICLPLHYEVLMNGEICMKMAAASWLSGGFFGALYSVTTFTLPFCGSKEIHQFFCDVPSLLRISCSHSHLAVDVTMTFGFGLGIFCSICITVSYSHIV
STVLKIPTTEGRSKAFSTCLPHLFILMVFITTGIIAYLKPPQESDSVIDLLLSLFYTVVPPTMNPIIYSLRNKDMKAALRKLIAWKYFSKELIPKAFP*
1085 >lcl|XP_003340557.1|Plus11297137..1298111 NW_001581881 olfactory receptor 5V1-like LOC100618062 __SEG__ Chr2 {Monodelphis domestica} MKDIKERGNQTLVTEFIFLGFSNHPELRGLFFLIFLLIYLVTLLGNLLILTAIRINPALHTPMYYFLSNLSFLDICYTSTTVPIMLVNFFREKKTIAYEGCLSQLFFLVT
FAGSECVLLAAMAYDGFIAICHPLRYPVLMSKKVCAYLAAGSLLCGLVNSMIQTGLTAILTFCGPNQISHFLCDIPLLLKLSCSDTSVNEFALYVSSATIALSPCLFIIV
SYMFIISAILKIQSTQGRHKAFSTCASHFTVVIIFYGTGTFNYDQPSSDYSLDVDVLVSVLFCIFTPMLNPLIYSLRNKEVKVALRKLCEGYILSRDSFVQISF*
1086 >lcl|XP_003340558.1|Plus11320766..1321740 NW_001581881 olfactory receptor 5V1-like LOC100618103 __SEG__ Chr2 {Monodelphis domestica} MKDIKERGNQTLVTEFIFLGFSNHPKLQGLFFMIFLLVYLITLLGNLLLLSAIRINPALHTPMYYFLSNLSFLDICYTSTTIPIMLVNFFREKKTITYEGCLSQLFFLVT
FAGSEGVLLAAMAYDRFIAICHPLRYLVLMSKKVCACLAAGSWLCGLVNSMIHTGLTATVTLCGPNQINHFLCDIPLILKLSCSDTSVNEFALYVASATIGLSPCLFTAV
SYMLIISAILKIQSAQGRYKAFSTCASHFTVVVIFFGTANFNYDQPSSGYSLDMDILVSVLFCIVTPMLNPLIYSLRNKEVKVALRKLCEKYILHRGFSVQISS*
1087 >lcl|XP_003340742.1|Plus11744148..1745326 NW_001581903 sphingosine 1-phosphate receptor 5-like LOC100619027 __SEG__ Chr3 {Monodelphis domestica} MVGSEVIVLHYNYTGKLNEARYDPGGGLRADAAVFLAVCGFIVLENLAVLLVLWRHKKFHAPMYLLLGSLTLSDLLAGAAYTVNILLSGARTLHLSPALWFAREGGVFVT
LAASVLSLLAIALERHLTMASRRPAPIHRRGRTLLLAGAAWLASLLLGLLPGLGWNCLGHLAQCSTVLPLYAKPYVLFCVLAFLVILVAIFGLYTRIYCQVRSNARKLQL
RAGSGGALSTRRLPKSLALLRTVTVVLVAFIVCWGPLFLLLLLDVACPARACPVLLQADYFLGLAMANSLLNPIIYTLTSRDLRRALLRLFCCYHRCCCCCRCCCYKPLH
PGPGGGEGGASGRRRLPPILECSTSKSERSSNRHEGLDTSVSTGNATPTRTPVKTEVQKTTD*
1088 >lcl|XP_003340784.1|Plus1complement(2423581..2424399) NW_001581905 testis-specific serine/threonine-protein kinase 6-like LOC100616823 __SEG__ Chr3 {Monodelphis domestica} MSGDKLLNELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGIRHPHIVHVFEFIEVCNGKLYIVMEAAGTDLLQVVQRSGHIPCA
QARELFGQIVGAVRYLHDHHLVHRDLKCENVLLSPDERRIKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGL
PRRQKRGVLYPDGLELAERCKALIAELLQFSPSARPSAGQVARNSWLRGEAC*
1089 >lcl|XP_003340841.1|Plus13577512..3578492 NW_001581916 mas-related G-protein coupled receptor member X3-like LOC100618782 __SEG__ Chr3 {Monodelphis domestica} MAESPTSEQLESVPDTTVETSTNWSLDLLTEIAEEFVSVKWTEILSLVIALFGLVGNSIVLWLLGFRTQRSPFLVYILNLAAADALFLGSHFVLCLWDIVGDLDFLILDL
LELCILNLSYCVGLSMLAAISTERCLSVLFPTWYRCHRPKHTSAAVCAFLWALQGLIRGAFVALYFLNKNHLDNLYLVLSFVQSGWFLLLTCVLGVSSLTLVLRVQCSSQ
RRRPPRLYVLVLLSVLLFLLCGLPWGFFYVVWIFSRFPLMSHGLSRLLACVNSSANPFIYFFLGRQWRRRGREPLRVVLQRALGEEPVAGDGARDTSHSNTLDELS*
1090 >lcl|XP_003340844.1|Plus1complement(4397316..4398332) NW_001581916 mas-related G-protein coupled receptor member X1-like LOC100619624 __SEG__ Chr3 {Monodelphis domestica} MAESPTPEHLESVRDTTVQPTTHWSLDPPAEAPGEFILRYWIEILSLVIALVGLGGNSIVLLLLGFRTRRSPFSVYILNLAAANSLFLGSYFSLYLWRIVGDLNRFVLVL
LWFCILNMSYCVGLSLLAAISTERCLSVLFPLWYRCHRPKHRSVVVCAILWALPGLFWGVFGALYFLNKNHFYDCYLVLSFVQFIWFLLLTSVLGVSSLTLVLRVQCSSQ
RRRPPRLYLLVLLSVLLFLLCGLPWGIADAVRYFSGFGLMSYEISSLLACVNSGANPFIYFFLGSQWRRRGREPLRVVLQRALGEEQVGGDGGGTLPTPRLRMNNPEDEN
KMLRQGSP*
1091 >lcl|XP_003341005.1|Plus11919855..1920793 NW_001581928 olfactory receptor 2AT4-like LOC100617175 __SEG__ Chr4 {Monodelphis domestica} MDTKACNSSDGSPIFFYLMGIPSLPKSLFLPVFFIFLILYLLVIIGNFLLLVAVVVDSKLHKPMYFFLTNLSALDILFTTTTIPRMLSLFLLGDRILSFPACFLQMYFFH
SFSCTEAFILVVMAYDRYEAICHPLHYTVRMTPQVNVKLAASAWLAALLLPIPAVVQSSQMAFGTLVQVLHCFCDHLAVVQASCSDPTFQTFLGFCCAMAVSFTPLLLVV
LSYARILISILKISSKEGRAKAFSTCTSHLLVVGTYYTSIAVSYVAYRADLPVDFHIMGNVVYAILTPVVNPLIYTLRNKDVKAAITKFMIP*
1092 >lcl|XP_003341015.1|Plus1complement(8477727..8478677) NW_001581928 olfactory receptor 51F2-like LOC100617862 __SEG__ Chr4 {Monodelphis domestica} MSYHSNNNASSLIFLLTGIPGLEDTHAWLSIPFCCLYLTALSGNGMILFVIITESSLYEPMYYFLSMLSTTDLGLCISTLVTMLGIFWFNAREISFHACVAQTFFIQLFT
VMESSVLLAMAFDRFVAICNPLRYATILTYSCIIKVWFVILFRGTVILTPLVLLLKRLSFCRSHVLHHSYCFHPDIIQLSCSDNKINSVLGLTALIITAGVDSLFILLSY
VLIIKTVLSIASPEERHKAFSTCISHIGAVAIFYIPLISLCFVHRFGKRAPPYVHTLMANVYLLIPPVMNPIIYSVKTKQIRKAIHKVLLPKGSHV*
1093 >lcl|XP_003341016.1|Plus1complement(8603374..8604321) NW_001581928 olfactory receptor 51F1-like LOC100618070 __SEG__ Chr4 {Monodelphis domestica} METSSNLTSLLSTFYLTAIPGIEEAHAWISIPFCCLYTIALLGNSMILLVIITEQSLHEPMYFFLSMLSATDLGLTVSTMSTTLSVLWFDARDITIDGCIVQMFFLHGFT
FMESGVLVAMAFDRFVAICDPLRYTTILTNARITQLGVAMFIRMIVLMLPLLLLFKKLSFSHSNGLSHSYCYHPDVIKLSCSDTKVSSIYGLAALILSTGIDTPCIVLSY
ILIIRSVLSIASPKEQKKAFSTCGSHIGVVAIFYIPSISLSLTHRYGQMAPKIVHTMMANIYLMLPPVLNPIIYSMKTTQLRKVMGKVDSIVSLE*
1094 >lcl|XP_003341018.1|Plus1complement(8892229..8893194) NW_001581928 olfactory receptor 51F2-like LOC100618610 __SEG__ Chr4 {Monodelphis domestica} MVALTNSTTLSLTFFLTGIPGLEDIHIWVSIPFCCLYVIALSGNSMILFVIITEQSLHEPMYYFLFMLSTTDICLSLSTLPTTLGVFWFNAQEITLDSCISQLFFIHFLT
IMESSVLLAMSFDRFIAICDPLRYSTILTPIRIIQFGLMMILRGSVVMTPVLLLLKRLSFCKNNILSHSYCYHPDVIKHSCSNTRLNSIYGLIAILLTFGLDAPLIILSY
VLIIHSLLSIASPHERQKGFNTCVSHIGAISIFYIPLISLSSVHRWGHKAPPFVHTMMSNAFLLLPPVLNPIIYSIKTKQIRKVICKIFRKMESRSNVSQF*
1095 >lcl|XP_003341020.1|Plus12150846..2151796 NW_001581929 olfactory receptor 52H1-like LOC100619396 __SEG__ Chr4 {Monodelphis domestica} MMATFNLSSYNPSFFILVGIPGLEKFHIWIAIPFCTIYLVAIVGNCVLLYLIAVEHSLHEPMFFFLSMLAKTDLILSSTTMPKLLSNLWFGDKKITFLGCLTQMFFLHFS
FVVDSAILLAMAYDRYVAICSPLRYTTILTHQVITKIVVGIIFRSFCVILPAVFLLKRLPFCRTRIIPHTYCEHIGVARLSCADISINIWYGVSVLLVTVVSDIVLIAVS
YTIILSAVFRLPSRGARQKALGTCGSHVCVILMFYTPAFFSILAHRFGHDVPRHVLILFANFYVAIPPALNPIVYGVKTKQIRDKILLLFSPKGTQ*
1096 >lcl|XP_003341022.1|Plus1550699..551649 NW_001581929 olfactory receptor 52A1-like LOC100617296 __SEG__ Chr4 {Monodelphis domestica} MEISNNSFLDPMTVTLVGIPGLEHLQFWIGFPFCVLCIVALMGNVLLLTIIPTERTLHQPMYIFLAGLAATDLGLCAAIAPKMLAIFWFSAYTMAFDACLIQLFFIHALQ
GMESGILLAMAFDRYVAICDPLRHSAILTPTIMSRMILVVAVRAVVLVGLLPILIRRLHFFHTTIIAHSYCEHMAVVKLLAGNVRINRSFGLFVAFAILGFDMIFVLISY
TLIIWTVFHLPQKEARLKALNTCTAHIFVFLEFYVLAFFSFFSHRFGHVAPFVHILLSTIYLLVPPALNPIVYGVKTKEIRVRVARIFFQKDNSLQ*
1097 >lcl|XP_003341024.1|Plus1673093..674028 NW_001581929 olfactory receptor 52R1-like LOC100617529 __SEG__ Chr4 {Monodelphis domestica} MIAINRTNLHPTSFFLLGIPGLEAAHIWISIPFCLMYILAVVGNCTLLFIIKTDPSLHEPMFLFLSMLSVADLMLTTTTMPKMLSLFWFNDGEIRFEACLTQVFLIHALS
NMESGIILAMAFDRYVAICNPLRHSTILTITVIQSLGLAILLRGIVLLGPHPFMLRWLPYCRTNIIPHTYCEFMGLIKLACAPTKIPRAYSLFVAFITGGLDFIIIICSY
VFILRTVFRLPSSEARMKTLGTCGSHVWVILISYTPAYFSFLTHRFGHNIAPSIHIFVANIYVLVPPMVNPIIYGVKTKQIRDRFLKFFKE*
1098 >lcl|XP_003341026.1|Plus1984247..985191 NW_001581929 olfactory receptor 51V1-like LOC100021412 __SEG__ Chr4 {Monodelphis domestica} MSTLLSPNLSSSTFLLTGFPGLELYYSWIAIPFSSIYAIVLLGNCIILHVIRTEPSLHQPMFYFLAMLAFTDLCMGLSTIHTVLGILWGFSHDIGLNACIAQTYFIHGLS
CTESGVLLAMSFDRFIAICNPLRYTTILTNTRVIQSGLFILLRSALSILPVIIRLKFFHYCHHHVLSHSFCLHQDLLRLACSDIRFNSFYALALVICTLLLDSLLILLSY
ILILHTVLAIASHEERLKSFQTCISHICAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNIYILFPPLMNPIIYSIKTKQIRIRMQRIFFFKRD*
1099 >lcl|XP_003341030.1|Plus1complement(1327096..1328064) NW_001581929 olfactory receptor 52Z1-like LOC100618852 __SEG__ Chr4 {Monodelphis domestica} MVKYGFPLQNDTNLQDVRYILIGIPGMEDSHTWISIPICLMYFIAIVGNSFLIFLITTERSLHEPMYLFLSMLALADILLSTTTAPKMLAIFWFHSGAISFGNCVVQMFF
IHCIFAAESAILLAMAFDRYVAICHPLRYTTILTPSVIVKIGVAAVVRGFLICFPFVFLVYRLTYCGHNIIRHSYCEHMGIARLACDNIKVNIIYGLTIALISTGLDVLL
IIVSYSLILHAVFYIPSWSARLKALNTCGSHICVILMFYTPAFFSFFAHRFGGHTIPRHIHILVANLYVVVPPMLNPIIYGVKTKQIQDRAVQVFSSMRTCC*
1100 >lcl|XP_003341036.1|Plus1complement(1795389..1796342) NW_001581929 olfactory receptor 52D1-like LOC100619932 __SEG__ Chr4 {Monodelphis domestica} MSAANNSNSLPTTIFLTGIPGLEPVYMWISIPFCAMYLVALIGNLILILVICTDHSLHTPMYLFLCLLSFSDLAISSTTVPKMLAILWFHAGQITFGGCLAQMFFVHSIF
ALESSILLAMAFDRYVAICNPLRYTTILNHGVIVRIGFAGLIRSVAIVSPFIFLLRRLPYCEHHIMAHTYCEHMGIARLACADITVNIVYGLTVALLAMGLDSVLIAVSY
CIILHAVFRLPSRDARRKALGTCGSHIGVILVFYIPAFFSFLTHRFGCHRVPRHVHIFLANLYVLVPPVLNPIIYGAKTKEIRVRLLRLMSPGQDFV*
1101 >lcl|XP_003341041.1|Plus1complement(2891910..2892851) NW_001581929 olfactory receptor 52E4-like LOC100618224 __SEG__ Chr4 {Monodelphis domestica} MLPFNDTEFHPISFLLLGIPGLEHFHIWIGFPFCFAYLIAIMGNITILLVIKNEHSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFDLKEIIFGSCLTQMFCIHMFT
SMETIVLVAMAFDRYVAICLPLQYSRILTNKIIGIIAGLAVLRSLSMVAPLVFLVLRLPFCGHHIIPHTYCEHMGIARLACASIRVNIFYGLGALSVILLDVILIAISYT
CILQAVFRLPSWDARFKALNTCGSHICVILAFYFPALFSFLTHRYGKNIPQYIHIFLANLYVVIPPALNPIIYGVRTKQIREQVFRIFQKESL*
1102 >lcl|XP_003341042.1|Plus1complement(2919238..2920179) NW_001581929 olfactory receptor 52E4-like LOC100618316 __SEG__ Chr4 {Monodelphis domestica} MLPFNDTEFHPISFLLLGIPGLEHFHIWIGFPFCFAYLIAIMGNITILLVIKNEHSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFDLKEIIFGSCLTQMFCIHMFT
SMETIVLVAMAFDRYVAICLPLQYSRILTNKIIGIIAGLAVLRSLSMVAPLVFLVLRLPFCGHHIIPHTYCEHMGIARLAFASIRVNIFYGLGNISIILLDVILIAISYT
CILQAVFRLPSWDARFKALNTCGSHICVILAFYFPALFSFLTHRFGKNVPQYIHILLANLYVVIPPTLNPIIYGVRTKQIREQVFRIFQKESL*
1103 >lcl|XP_003341047.1|Plus13149296..3150243 NW_001581929 olfactory receptor 56A3-like LOC100618838 __SEG__ Chr4 {Monodelphis domestica} MILPSNSSSPTEVSEFLLNCFVRSPSLQRWLSLPLSLLFLLAMGANATLLITIRLEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLLIFWFDLRPISFLACFLQMYIMNC
FLGMESCTFLIMAYDRYVAICHPLRYPAIITDEFVAKAALFILARNIFFTMPIPILSGMLNYCHSNVVENCICANLSVSKLSSDDITVNRLYQLAGGWTVLGSDFILIFL
SYSFILRAVLKLKAKGAAAKALSTCGSHFILILFFSTILLVLILTHVAKKMVSPDVPILLNILHHVIPPALNPIVYGVRTQEIKQGILKLLRKGL*
1104 >lcl|XP_003341049.1|Plus1898001..898957 NW_001581929 olfactory receptor 51G2-like LOC100619842 __SEG__ Chr4 {Monodelphis domestica} MMSVPNSTENTFSTFLVTGIPGLEAMYMWLSIPFSAMFLVTLAGNITIMLVIWTERSLHVPMYFFLAMLAASDLGLSLSTFPTMLRIFWLKVQEMSLPACFIQMFFIHTF
QDFESAVILAMAFDRVVAISKPLHYASILTSGVITKIALAILIRTVAVQVPLPILLRRLRFCRSTVLSHSYCLHPDIIKLSCSNTRINSIFGLFVVLSTMGLDFLLILFS
YILILKTVLSIASHGGRLKALNTCISHLCAVVLFFTPMICLSMLHRFGPKLPSHIYVLIANMHFLIPPVMNPIVYVVKTKQIRDTIIKVFHRKGPEES*
1105 >lcl|XP_003341050.1|Plus1complement(1078918..1079877) NW_001581929 olfactory receptor 51L1-like LOC100619918 __SEG__ Chr4 {Monodelphis domestica} MAEFNSSSSLSTIFYLIGIPGYEELYHWISIPFFILYMIGIMGNCTILHIVRTDPSLHEPMYYFLAMLSLTDMGMSLPTLVSVFRVLWSISNEIEFNICVIQMFFIHTFS
LTESAVLLAMAFDRYVAICHPLRYSTILTPKRIIRIGITAILRSSLSITPLMIRLAYFPFCHSHVLSHSYCLHQDMIRLACADTKFNVIYGVVGIIILWGFDALGILISY
IFILRSVLSIASQKERLKALNTCASHICAVLILYVPMIGVSLVHRFAKHASPLVHIFMAHIYLLVPPILNPIIYSVKTKQIRVGIIRLLLPKRIHSSWG*
1106 >lcl|XP_003341098.1|Plus11546480..1547379 NW_001581940 free fatty acid receptor 1-like LOC100617163 __SEG__ Chr4 {Monodelphis domestica} MDFSPQLSFALYAAAFTLGLPLNVILLSEAVSHARLRLTPSLVYILHLACSDLLLAASLPLKAAEALAEGSWPLPASLCPAFALTHLVLLYAGGCFLAALSAGRYLGAAF
PLGYQAIRRPCYSWGVCVAIWGLLLFHLGLVFGLGIQEGLEDNSTNSFGMTIPINGSPICLEAWDPIRSGPARLSISLLLFFLPLTITAFSYMGCLRALVHSGLSRSRKL
RAARVAGGALLTLLLCLGPYNISHVASFVKPDVGSQWRQLGLIMGAWSTVLNPLVSGYLGNRAAKRGGTVGTQGGTAQK*
1107 >lcl|XP_003341154.1|Plus1complement(1450834..1451775) NW_001581950 olfactory receptor 2G6-like LOC100619275 __SEG__ Chr4 {Monodelphis domestica} MKTNNSQDGFVLLGFSDKPRLETILFVVILVFYILNVVGNMTIILVSCLDPKLHTPMYFFLTNLSFVDLCLTTCIAPQLLVTMGKKDKIMSYSGCVVQLYVSMGLGSTEC
IILAVMSYDRYAAVCRPLHYAVIMHHQLCLSLAATAWLSGLVTSLIQCSLTIQLPRCGHNQLDHICCEVPVLIKLACVDTTFNEAELFVASVVFLVVPVSLILVSYGYIA
QAILRIKSATGRQKAFGTCSSHLVVVIIFYGTIIFMYLQPVKSKSKDQGKFVSLFYTVVTPLLNPLIYTLRNKDVKGALRKLVLGKSLESEKL*
1108 >lcl|XP_003341155.1|Plus1complement(1462689..1463633) NW_001581950 olfactory receptor 2G6-like LOC100619311 __SEG__ Chr4 {Monodelphis domestica} MEQNDTSQGDFILLGFSDKPQLEIILFAVILVFYILNLVGNMTIILASSMDPKLHTPMYFFLTNLSFVDLCLTTTVAPQLLFTMRSKDKTMSYNGCVAQLYVAMGLGSTE
CILLVVMAYDRYAAVCRPLHYAVIMHPQLCLLLAATAWLSGLITSLIQCSLTIQLPLCGHNKLDHIFCEVPVLIKLACVDTTFNEDELFVASVVFLVVPVSLILISYGYI
TQAILRIKSAAGRRKAFGTCSSHLVVVIIFYGTITFMYLQPAKSKSKDQGKFVSLFYTVVTPLLNPLIYTLRNKDVKGALRKLILEKTIRSEKL*
1109 >lcl|XP_003341157.1|Plus11671581..1672516 NW_001581950 olfactory receptor 14C36-like LOC100619702 __SEG__ Chr4 {Monodelphis domestica} MSNFTTVTEFLLMEFSDIRELQIFYSFLLFLIYSAGLMGNLLIVIITTFDRRLHTPMYFFLRNLSMVDACYLSITAPQASVNSLVNNRVISVTGCAAQVFLMVFMGYVEF
ALLTVMARDRYVAICHPLHYPVIMSPRVCMQMTLTCLITGFMYAGFHTGYTFRLSFCHSNVVHQFFCDIPSLLRISCSDTFSNKLSLIVSELIVGAGCYTFITASYVHIF
STVLKFPLKEDQKKAFSTCIPHITVVSFFVISGAYVYSQPSSDSMSFKNIIISVFYTIIPPFLNPIIYSLRNKQIQDAMGILMKRNIFIKK*
1110 >lcl|XP_003341158.1|Plus11691778..1692719 NW_001581950 olfactory receptor 14C36-like LOC100619740 __SEG__ Chr4 {Monodelphis domestica} MSNYTTVTEFLLMGFSDIRELQIFYSFLLFLIYSAGLMGNLLIVIITTFDRRLHIPMYFFLRNLSMVDACYLSITAPQASVNALVNNRIISVTGCAAQVFLVVFIAYVEL
TLLTVMARDRYVAICHPLHYPVIMSPRVCLQMTLTCLITGFMYAAFHTGYTFRLSFCQSNLVHQFFCDIPSLLRISCSDTFSNKLSLIVCELVVGAGCYAFITASYVRIF
STVLKFPVKEDQKKAFSTCIPHISVVSLFVISGSYVYFQPPSDSGSFNDIILSVFYTVIPPFLNPIIYSLRNKQIKDAIRILMTRTLSLRNKT*
1111 >lcl|XP_003341209.1|Plus115723527..15724465 NW_001581954 olfactory receptor 2D2-like LOC100619530 __SEG__ Chr4 {Monodelphis domestica} MFPASNHSSISEFLLLGFSSDSTSNRILFIIFLLLYLCSVLGNGLIIILISLDSHLHTPMYFFLSVLSLLDMGYVTTTVPQMLVHLLSSSKLISFGGCWLQMYVFGALGL
SECIIFVVMAYDRYVAICFPLRYTLILNWDLCVRLVLGTCTCGFFFSLPHTYFTMSLPFCGPNMVNHYFCEGPSVRSLACMDTHLIEVVDFVISIFMVLVPLSLILASYV
RITMSILKIKSTQGRFKAFSTCASHLTVVTLFYGPAIYIYMRPNSNYSPERDKQISLFYNVFTALFNPVVYSLRNKDIKAAFIKVVVRNRIA*
1112 >lcl|XP_003341299.1|Plus1111915119..111916057 NW_001581961 olfactory receptor 148-like LOC100618367 __SEG__ Chr4 {Monodelphis domestica} MKMKNHTGLIEFTLLGIPHTEGLETMFFVIFFFIYLFTLVGNSLILMAILSSSNLHTPMYFFLGFLSIFDIFFPSVTSPKMLLYLSGQSQAISYRGCASQLFFYHFLGCT
EGVLYSVMAYDRFVAICHPLRYMVIMNSRLCVILVVAACMVGCIDATILTAFTFSLPYCGPNKVDHYFCDIPAIIPLACADSSLAQRVGFTNVGLLALTLFFTILVSYTR
IGIAILRIRSAEGRSKAFSTCSAHLTAILCAYGPVIIIYMQSTPNPLLGAVVQILNNLVSPMLNSLIYSLRNKEVKKALKKVLYRSGIFVEV*
1113 >lcl|XP_003341303.1|Plus1112478592..112479539 NW_001581961 olfactory receptor 6T1-like LOC100619160 __SEG__ Chr4 {Monodelphis domestica} MKTENWTQVTEFVLLGFPKSWALQVMLFLGLLVTYMVTVTGNLLIIVLSWSDRRLHTQMYFFLRNLSLLEMMLVSVVVPKMLVSLLTRDYTISFAGCILQSYIYFLLGTT
DFFLLAVMSLDRYLAICRPLHYETLMSGPICSRLVLASWLAGFLWILWPTILMASLPFCGPNGIDHFFCDSWPLMELSCGDTQLLELVAFLLSAALLLGSLTLTSSSYAF
ILATIFRAPTATERKKAFSTCASHLTVVVIFYGSSIFLYIRTSEAQSMLLNKAVSALNCIISPLLNPFIFSLRNDKVKQALRDAMRWHRTMGTRS*
1114 >lcl|XP_003341341.1|Plus1complement(112508485..112509420) NW_001581961 olfactory receptor 8D4-like isoform 1 LOC100619141 __SEG__ Chr4 {Monodelphis domestica} MGRGNQSEVTEFILAGLTDEPELQLPFFFMFLVIYMVTVVGNMGMIILIGISSHLHTPMYYFLSSLSVLDVCYSSVVTPQMLVGFLFEDKTISYPRCMTQLFFFCIFVIS
ECYMLAAMAYDRYVAICSPLLYNTIMSPQVCSLLVVFVFSVGLIDAVIHTGCILRLPFCGSNIISHYFCDIVPLIKLSCASTYLDELLIFVIGGFNMIATSLTIIISYAF
ILSSILRINSKEGRSKAFSTCSSHIMAVTVFYGSLMSMYLKPASSSNLAQEKVSSVFYTTVIPMLNPLIYSLRNKDVKNALKKLIQKKISS*
1115 >lcl|XP_003341356.1|Plus1complement(9394345..9395373) NW_001581963 olfactory receptor 8D4-like LOC100619741 __SEG__ Chr4 {Monodelphis domestica} MSNNGKYYFVYCVSSFLHRVASLKLCKTMASLNHSTVTLFILEGLTDQPELQVFLFVLFLGIYVVTVVGNLGMILLIGIGPQLKSPMYYFLSNLSFVDLCYSSAITPKLL
VNFIEDKNIISYNECMTQLFFFCFFIVSECFMLTAMAYDRYVAICSPLLYNVIMSQRVCCFLATAVYTMGTFAALVHTSSMVRLSFCGPNIIKHYFCDIIPLLKLSCSST
YLNELLLVVVGMFNVFSTTIAIFISYAFILSSILSIQSAEGRSKAFSTCSSHLAAVAIFYGTMIFMYLKPPSSSNMTQEKVASVFYTTVIPMLNPLIYSLRNKDVKDVLK
KIMRCTMHNTSM*
1116 >lcl|XP_003341409.1|Plus1complement(22993923..22994897) NW_001581965 casein kinase I isoform alpha-like LOC100619142 __SEG__ Chr5 {Monodelphis domestica} MNISTIPKAELIFGGKYKLVRKIGNGSFGDIFLAVNITNGEEVAVKLESQSSKHPQLFFEVKLYKILQGGVGIAHMRWYGREKGHNVLVMDLLGPSLEELFNVCSRKFTL
KTVLMLADQMISRVQYLHTKNFIHRDIKPDNFLIGTGRHCNKLFIIDFGLAKKYRDSKTKEHIPYRKDKNLTGTARYASINAHLGIEQSRGDDMESLGYVLMYFNRTSLP
WQGLKAATRKQKYEKIVEKKMSTSVDSLCKGYPHEFATYLTYCKGLHFEEAPDYLYLRQLFRSLFKSLNYQYDYLFDWTVLKERDAQETASSSQNQPPQTSTFD*
1117 >lcl|XP_003341481.1|Plus138368901..38371312 NW_001581969 toll-like receptor 6-like LOC100617999 __SEG__ Chr5 {Monodelphis domestica} MCTTKLWFIPDPPIINTFHFVLIFVLILGSVIQHSSQNEFIGNYSNSHLSHVPHHLSPKTTVLDLSLNNITEIQIEDFKLLPKLRVLILSHNRIQHLNISVFKFNQDLEY
LDLSHNNLWDISCHLLMNLIHLDLSFNEFEFLPICEEFSNLSQLDFLGLSAKRIQKSDLLPVSHLNLSNILLDLERFGGAKDKLETLPVLNTKKLQIIFPPNRAFFMQLN
ISVNNLRSLQITNINLNNDKCSVFTDFLSKVIHNSKSLNLTLYHIEDTWKCFVEILQFLWHKPIEYLYIYNLTLVGKIGFELFTYNETLLKGLKIEFINIKVYIFLQSNI
YNIFSNMNINMLTITDSRMLHMSCPFKPSPFQYLNFANNLFPDTIFPDCKNLSLLQTLILQKNKLTHLSKIAGMTEKMKSLKHLDLSQNSISYDEEKKNCSWSESLLVLN
LSSNELTESVFRCLPPSITVLDLYRNKIKSIPKNISNLESLQELNIAFNFLVDLPGCSTFSSLSVLIIQHNSVSHPSAHFFNSCQNIKSLQAEDNPFLCTCELREFSKNM
ATLSSQVVSGWPHSYKCAFPDNYKGTHLKDFHLSPLSCNIVLLLITIVIVVLVFVIVTTFFCVYFDLPWYLRMIFQWARMRRRARNIPLDELEKEVQFHAFISYSELDSP
WVKHELLPNLEQEEIRICLHERNFVPGKSIVENIINCIEKSHKSIFVLSPNFIQSEWCHYELYFAHHKLFHERSDNLILILLEPIPQYNIPAKYHKLKALMARRTYLEWP
KEKGKQALFWANIRAAFNRKLTLVEEANDVEII*
1118 >lcl|XP_003341521.1|Plus123477124..23478068 NW_001581971 olfactory receptor 5A1-like LOC100616863 __SEG__ Chr5 {Monodelphis domestica} MFIAKEKNSTSVSIFFFLGFSDHPKLQVILFVTFLGIYLVTLFWNLSLILLIKIDTHLHTPMYFFLSNLSFIDICYSSSVAPKMLSDFFKGQKTISFVGCATQFFFFVGT
GLTECCLLAAMAYDRYAAISNPLLYTVIMSPNLCTKMVAGAYVGGFLSSLIQTSSIFQLYFCGPNLINHFFCDLPPVLALSCSDTFLSQMVNFLVVVAVGGTSFLILLIS
YGYIVAAVLKIKSVEGRYKAFNTCASHLIVVTLLYGTALFMYLRPSSSYSLSRDKVVSVFYSIVIPMLNPLIYSLRNREIKAALKKVLEKKRFS*
1119 >lcl|XP_003341533.1|Plus113995900..13996829 NW_001581971 olfactory receptor 4B1-like LOC100619788 __SEG__ Chr5 {Monodelphis domestica} MAITNNVTQLIFTGLFQDREAQRVSFIVFLPMYMATMLGNGLIILTVNMNKSLSSPMYFFLSHLSLVEICYSSTIVPKFISGLLTENKTISLDGCMTQIFFFHFFGVAET
LLLTVMAYDRYVAICKPLHYTTLMNRPVCHVLVFSSWVGGMFHSGIQIVITVQLPFCGPNVIDHYLCDLHPLYKLACTDTFVEGIIVFANSGVFAVISFLFLVSSYVVIL
VHLRNQSAEGRRKALSTCASHITVVLLFFGPAIFLYLRPSSTFTEDKLVSVFYTVVTPMLNPIIYTLRNAEVKNAMRRLWVKKVNLGGE*
1120 >lcl|XP_003341535.1|Plus114104528..14105457 NW_001581971 olfactory receptor 4B1-like LOC100619987 __SEG__ Chr5 {Monodelphis domestica} MAITNNVTQLIFTGLFQDREAQRVLFVVFLPMYMATMLGNGLIILTVNTSKSLSSPMYFFLSHLSLVEICYSSTIVPKFISGLLTQNITISLDGCITQLFFFHFFGVAEI
LLLTVMAYDRYVAICKPLHYMTIMNRPVCHVLVFSSWLGGMFHSVVQILITVQLPFCGPNVIDHYFCDLHPLFKLACTDTFVVGIIVFANSGLFSVISFLFLVSSYVVIL
VHLRNQSAEGRRKALSTCASHITVVLLFFGPAIFLYLRPSSTFTEDKLVSVFYTVVTPMLNPIIYTLRNAEVKNAMRRLWVKKVNLGGE*
1121 >lcl|XP_003341541.1|Plus115966882..15967826 NW_001581971 olfactory receptor 4P4-like LOC100618039 __SEG__ Chr5 {Monodelphis domestica} MEAKGNVTQFILFGLSYDPNIQIFCFFLFLFCFVSLILGNFLILISIHCSHLFHQPMYYFLSHLSSMDIYYTSSVTPKLIADLLTEKKTISYGYCMFQVFSMHFFGSIEV
FILTAMAFDRYVAICKPLHYMVIMSRKKCNLLVLAAWAGGAVHSLPQLSMTLKLHFCGPNEIDHYFCDIFPLLKIACTDTYITGVLVVLSSGIIALGIFVILFVSYAMIL
WTLRTHSAEGRRKALSTCGSHFTVVILFFVPAIFSYIRPPTTYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRKVWCQKIWGKGNVKHMD*
1122 >lcl|XP_003341549.1|Plus1complement(16980904..16981812) NW_001581971 olfactory receptor 10AG1-like LOC100620044 __SEG__ Chr5 {Monodelphis domestica} MEEFILLGFSEYPNVQRFLFVVFLFIYISILLGNGLIIIITNVESSLQTPMYYFLGNVSFVEMCYTSNILPRMLVNIWRQRRSISLLSCAAQLCFFLILGVTESFLLAVM
AYDRYVAISKPLYYPIIMNHKMCMKMVVDSWVSGIPVMIMQTYHVFSVPFCGSNKLNHIFCDMPPLIKLACGDISGGEFFLFVDCFLFGLIPFLMILMSYIRILGTILKL
SSTTGISKAFSTCSSHLIVVCLFYGSGLIAYFQSESSSSGSIEKIFSVFYTIVTPMINPMIYSLRNKDFIAAMKKLFSKWRG*
1123 >lcl|XP_003341551.1|Plus1complement(17254920..17255858) NW_001581971 olfactory receptor 10AG1-like LOC100617288 __SEG__ Chr5 {Monodelphis domestica} MESTDKIIKVNFTEVDIFVLLGFSDQSNIKSLLFCIFLIIYTSILIGNGLIILIIKFDQALQTPMYFFLGNFSFLEICYTSVTLPRMLKDFWNKNRDISLLSCAIQLCFF
LILGVTECLLLTVMAYDRYVAICKPLYYPLIMNHKTCVQLVVGAWISGIPIQIGQVYQLFSLTFCDSNKLDHVFCDFPPLLKLACGDTTMNEISFYADALLFGVVPFLLI
LNSYIRIITTILRLPSELGRSKAFSTCSSHLIVVSLFFISASISYFQPKSNQSRGTGKVLSLFYTIVTPLFNPMIYSLRNKDFIISIKKLLY*
1124 >lcl|XP_003341552.1|Plus1complement(17281336..17282280) NW_001581971 olfactory receptor 10AG1-like LOC100617328 __SEG__ Chr5 {Monodelphis domestica} MAEVNITLALEFFFLGFADLPNLQGFLFLIFLIIYLSILIGNGLIIVITKLEPSLQTPMYFFLGNFSFLEICYTSVTLPKMLIDLWTQKRKISFLGCATQLFFILILGVT
ECFLLSVMAYDRFVAICKPLYYTLIMNHTMCVWLVIGSWIIGIPILIGLTYQIFSLPFCGSNKLEHVFCDIPPLLKVACGDISMEEYSIYVDAGIFGMFPFLFISGSYAK
IIAAILKLPSSKGRYKAFFTCSSHLIVVTLYFGSAGISYLMPNSSHSTVTEILFSLFYTILTPLFNPLIYSLRNKDFIVAMRKLLPKCVGLRNT*
1125 >lcl|XP_003341553.1|Plus1complement(17358825..17359769) NW_001581971 olfactory receptor 10AG1-like LOC100617440 __SEG__ Chr5 {Monodelphis domestica} MEDRKNEAKANDSVLVEFILLGFANLPHHQGFLFVIFLVIYMSILVGNGLIMVITKMDPNLQTPMYFFLSHFSFLEICYTSVTLPRMLSNLLTQKRNISFLSCAIQLCFF
LILGGTECFLLAVMAYDRYVAICMPLNYPVIMNSKTCIQLVVGSWISAIPVQIAETYQIFSLHFCGSNKLNHFFCDAPPLLKLACGDISINELYSYAGAILFAIPFLLIL
VSYIKIITTIQKLPSAMGRQKAFSTCSSHLMVVGLFFGSGMISYFLPKSKKSSGIDKILSLIYSTVTPVFNPLIYSLRNKDVILALKKYILKLS*
1126 >lcl|XP_003341554.1|Plus1complement(17437907..17438854) NW_001581971 olfactory receptor 10AG1-like LOC100617563 __SEG__ Chr5 {Monodelphis domestica} MEDGNNAAKANDSILVEFILLGFPNLPNHQGFLFSIFLFIYMSILVGNGLIMVITKMDPNLQTPMYFFLSHFSFLEICYTSVTLPRMLRNLLTQKRNISFLSCAIQLCFF
LILGGTECFLLAVMAYDRYVAICIPLNYPIIMNSKTCIQLVVGSWISAIPVQIAETYQIFSLHFCGSNKLDHVFCDVPPLLKLACGDISINEFYSYAGAILFAMIPFIMI
LVSYIKIITTIQKLPSAMGRQKAFSTCSSHLMVVALFFGSGMISYLLPKSKKSSRIDKILSLIYSTVTPVFNPLIYSLRNKDVILALKKYILKLS*
1127 >lcl|XP_003341558.1|Plus1complement(17769961..17770902) NW_001581971 olfactory receptor 10AG1-like LOC100618109 __SEG__ Chr5 {Monodelphis domestica} MAGENVSFVVEFILLGFYNLPNLQGVLFGVFLVIFMYILIGNGLIVVITRVDPALQTPMYFFLGNFSFLEICYTSAIVPRMLSDLWTQKRQISLLACAVQLCFFYIMAAL
EFLLLGIMAYDRYVAICKPLYYSIIMNNKVCNMLILGSLILAIPVMIGETYQIFTLPFCGSNELNHLFCDVTSLLKLACADTSVNEFSLYIICVVLGFAPFLLILISYIR
IINTILKLQSVGRQKAFSTCSSHLIVVVLFYGSVIITYIQPKSIHSAEKDKMLSLLYTIVTPVFNPMIYTLRNKDVITSLKKIITKGLLSIRK*
1128 >lcl|XP_003341561.1|Plus1complement(18114008..18114952) NW_001581971 olfactory receptor 5F1-like LOC100618683 __SEG__ Chr5 {Monodelphis domestica} MSRGNHTTVTEFILLGLTDSTELQIILFVLFLLIYTLTMIGNAGMIMLIKTDSQLHTPMYFFLTSLSLTDIVYSSTITPKMLTDLLSERKIISFAGCFLQMYVFIALITT
ECILFGLMAYDRYVAICNPLLYTVIMSKTVCLKMATGAFTAGFLNSIIHTSYISSLSFCGSNVIHHFFCDSPPILKLSCSDTQMNEMIIFICAGINMLGTLLIILTSYIY
ILFSILRLHSVDGRRKAFSTCASHLTAIVIFYGTEIVTYLCPSSSYSPTQGKVLSVFYTVVIPMLNPLIYSLRNEEVKRALKNVIFRKRSLIII*
1129 >lcl|XP_003341567.1|Plus118860416..18861354 NW_001581971 olfactory receptor 5M9-like LOC100616781 __SEG__ Chr5 {Monodelphis domestica} MPSPNYTDVTEFILLGLTSRQELQVMFFVIFLVVYVITLVGNIGMIMLISISPQLQSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSKTKTISYVGCLIQCYFFIALVYV
EVYILAVMAFDRFMAICNPLLYGSKMSRTVCIRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADPPLIKIACGGIHIKEYTMIVIAGINFTYSLSVVLISYTF
IVVAILRMRSAEGRKKAFSTCGSHLTAVTMFYGTLIFMYLRRPTEESVEQGKMVAVFYTTIIPILNPMIYSLRNKDVKEAMNKAIQRSCLMK*
1130 >lcl|XP_003341569.1|Plus118918150..18919109 NW_001581971 olfactory receptor 1038-like LOC100023784 __SEG__ Chr5 {Monodelphis domestica} MARSNHSEVTEFLLLGLTTRPELQVILFLMFLIIYSVSVVGNLGLILLIQVSSHLHTPMYFFLSHLAFVDFCFTSTITPKMLVNFVQETNVISFHACAIQVFCFISFVAL
EMFLLAVMAYDRFVAIGNPLLYTVTMSRRHCLQLVSVPYVYCFSVALFHTIITFHFSYCASNVINHFYCDEVPLLALSCSDTHVKEILIFAFAGFDMICSLLIIIISYVF
IIAAILRIRSTKGQLKAFSTCGSHMMAVTIFYGTLMFMYLQPRSNHSLDTDKMTSVFYTTMIPMLNPLIYSLRNKEVKEAVRKILGNTFSVVYLRVIGK*
1131 >lcl|XP_003341572.1|Plus118993156..18994115 NW_001581971 olfactory receptor 1038-like LOC100617117 __SEG__ Chr5 {Monodelphis domestica} MAKFNFTQVTEFILKGITDRPELQAPLFIIFSAIYIVTVVGNLGLIILIRIDSRLHTPMYFFLSHLAFVDFCYSSAITPKMVANFVVEKNTISFNACATQLGCFLTFMIT
ECFLLASMAYDRYAAICNPLLYSVIMSQKVCIQLVAVPYIYSFLVALFHTIVTFRLSYCGPNVINHFYCDDIPLLALSCSDTHTKELLIFAFAGFDMICSSSIVLISYIF
IIAAILRIRSAEGRLKAFSTCGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKEALKKTRGKGSEILKILQSRK*
1132 >lcl|XP_003341573.1|Plus119075928..19076887 NW_001581971 olfactory receptor 1038-like LOC100021065 __SEG__ Chr5 {Monodelphis domestica} MAKFNFTQVTEFILKGITDRPELQAPLFVIFLAIYIVTVVGNLGLIILIRMDSRLHTPTYFFLSHLAFVDFCYSSVITPKMMANFVVEKNTISFNACATQLGCFISSIIA
ESYILASMAYDRYVAICHPLLYSVIMSPKLCLLIVVILYVYSFLVSLSNTIVTFCLVYCGSNVINHFYCDDVSLMPLSCSNTHTKQMLIFAFAGFNTISSLSIILISYIF
IIAAILEDSFCRGRFKAFSTCGSHMVTITILYGTIIFMYLQPKSKDSLETDKIAPVIYTVVIPMLNPVIYSLRNKDVKEALKKTVVKGCNTLKMLQSRM*
1133 >lcl|XP_003341575.1|Plus1complement(19216882..19217844) NW_001581971 olfactory receptor 5M8-like LOC100617479 __SEG__ Chr5 {Monodelphis domestica} MSGNVTTKPEFVLLGLTCRVELQVLFFVLFLTIYIITVVGNMGMMVLVRITPQLHTPMYFFLSHLSFADLCFSSTVSPKMLETLVVEKATISYSACLVQCYFFIALAHVE
MYILAVMAFDRYMAIHNPLLYGSKMSPTVCTFLISVTYVYGSLMGLMETMWTYSLSFCGPNEINHFYCADPPLIKLACSSTYRKETSMFVVAGFNLTFSLLIILISYLYI
FPAIFRIRSADSRRKAFSTCGSHLTAVTIFYATLFFMYLTPPSETSVERGKMVAVFYTTVIPMLNPMIYSLRNKDVKEALSKQLFRKEFCKQISVLSCIK*
1134 >lcl|XP_003341579.1|Plus119507114..19508058 NW_001581971 olfactory receptor 9G4-like LOC100617928 __SEG__ Chr5 {Monodelphis domestica} MSVEVGNRTTLNEFILIGVSANPQMQLVFFIIFLALYLVTLAGNMTLVILIRIDSRLHTPMYFFIGNLSFLDFWYTSVYTPKILATCISEDKRISLAGCGAQLFFSCVVA
YTECYLLAAMSYDRYVAICNPLLYSAAMSKPLCVGLVAGSYIGGFMNAIAHTANTFRLKFCGKNIIDHFFCDAPPLVKMSCTDTKVYEKVLLGVVGFTVLSSILAILISY
FNILLAILRIRSATGRWKAFSTCASHMISVMLFYGSLLFMYSRPSSTYSLEKDKLAALFYTVVNPLLNPMIYSFRNKDVKEAFKKAIQNIQTPR*
1135 >lcl|XP_003341580.1|Plus1complement(19535164..19536093) NW_001581971 olfactory receptor 1013-like LOC100618051 __SEG__ Chr5 {Monodelphis domestica} MEKGNHTVTEFILVGFTQDPVMQLVLFVLFVMVYSVTVVGNISLIILIYTDSRLHTPMYFFIGNLSFLDLWYSSVYTPKIMVTCVSEDKSISFAGCVAQFFFSAGLAYSE
CYLLAAMAYDRYVAISNPLLYAQAMSRWLCICLVGISYIGGFVNAIILTSNTFTLNFCGDNIIDDFFCDVPPLVKLACNVKDSYQEVLYFLLASNVITPTVLILASYLFI
IAAILRIQSTQGRQKAFSTCSSHLISVTLYYGSILYIYSRPSSSYSLERDKIVSSFYTVVFPMLNPMIYSLRNKDVKEALKKLCKITTS*
1136 >lcl|XP_003341582.1|Plus1complement(19638907..19639851) NW_001581971 olfactory receptor 1009-like LOC100618257 __SEG__ Chr5 {Monodelphis domestica} MANGNYTRVTEFIFVGLKYHPKLQVALFVLFLSFYLCNLTGNLGMIFLIRIDARLHTPMYFFLSHLSFVDISFSSVVAPKMLRDFFEERKTISFLGCALQQWFFGFFVAT
ECFLLASMAYDRYVAICNPLLYSVAMSQRLCIQLVSGPYAAGFTSTMTHTTAAFRLPFCGPNVINHFFCDISPLFTLICADISVNKIVLFILAGLVLVFSGLIILVSYIY
ILIAILRIRSAEGRRKAFSTCSSHLTAVSILYGTLFFIYVRPSASFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKDAIHRTVAKIKFCINN*
1137 >lcl|XP_003341590.1|Plus121141548..21142489 NW_001581971 olfactory receptor 9I1-like LOC100619789 __SEG__ Chr5 {Monodelphis domestica} MAEQNHTTVTEFILIGFTDHPKLVVILFLVFLSFYLITLMGNMGMVLLIRLDSRLHTPMYFFLSHLSLLDACYSSVIVPQILVTLVTGRTSISYNSCATQFFFFTVCAGT
ECFMLAVMAYDRYVAVSNPLLYSSAMTLGTRWGLVAGAYGGGLSGAILRTACTFTLSFCGPNQINFFFCDLPPLLQLSCSDTTTSQTLILFGSFLILINAVIILVSYLFI
IRAILRIKTVGGRAKTFSTCASHLTAVMLFFGTIVFMYWRSNSGKSPEEEKVVSVFYTVVIPMLNPIIYSLRNKEVNAAFRKVIGRFQVSQEM*
1138 >lcl|XP_003341591.1|Plus1complement(21302967..21303929) NW_001581971 olfactory receptor 10Q1-like LOC100616677 __SEG__ Chr5 {Monodelphis domestica} MVPPNSIHLNQSGPTEFVFRMFTTSTRIQALLFLLFFLLYMMILCGNTAIIWVVFTHTSLHTPMYFFLSNLSFLEICYTTSVVPLMLSNMLGAQKPIPLAGCGTQMFFFV
TLGSTDCFLLAVMAYDRYVAICHPLHYTLIMTQKLCTQMVVGSLGLALFLSLQLTALIFTLPFCGHRREINHFLCDVPPVLRLACADTRVHQAVLYVVGILVLTVPFLLI
CISYVFITTTILRIRSAEGRRRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYTFVTPLLNPLIYTLRNKDVKGALKKSMSSKAASETP*
1139 >lcl|XP_003341592.1|Plus1complement(21438990..21439952) NW_001581971 olfactory receptor 10Q1-like LOC100616991 __SEG__ Chr5 {Monodelphis domestica} MSSSNTFNLNQSGPTEFVFQVFTTSRKIQALLFCFFLLLYIMILCGNTAIIWAVYTNSSLRTPMYFFLSNLSFLEICYTTTVVPLMLSNIFGGQRPIPLAACAAQMFLFC
SLGGTDCFLLTVMAYDRFVAICHPLHYTLIMTQKRCIQLVLVSLVLAVFLNLQLTTLVFNLPFCGHQLQINHFLCDVPPVLRLACGDTRVHQAVLFVVGIIALTIPFVLI
SISYIFIANAILHINSAEGRRRAFSTCSSHLCVVLLQYGCCTLVYMRPRSSTSEDEEWQLALVYTFVTPLLNPLIYTLRNKDIKDALKKSMSCKILSETP*
1140 >lcl|XP_003341596.1|Plus1complement(22322923..22323879) NW_001581971 olfactory receptor 5B12-like LOC100618487 __SEG__ Chr5 {Monodelphis domestica} MTSMENRSEVNEFILVGLTDAPELQIPLFIMFTFIYFITLVGNLGIVALISWDSCLHTPMYFFLSNLSLVDFGYSSTVSPKVMSGLLTGDKIISYNGCATQLFFVGAFAT
TESFLLASMAYDRHAAVCKPLYYTTTMTSTVCAYLASGAYICGFLTSSIVIGNTFSLSFCRSNVVHHFFCDIPPLLILSCSDIHFIESVFFILGSFTAFFPFLVIFTSYL
LIFITILKIHSSEGRQKAFSTCGSHLTAVSIFYGTIIFMYFQPSSSHSMASDKMASVFYTVIIPMLNPLVYSLRNKEVKNSFWKAMGRKRRQLDNSFN*
1141 >lcl|XP_003341597.1|Plus122356536..22357465 NW_001581971 olfactory receptor 5B12-like LOC100618574 __SEG__ Chr5 {Monodelphis domestica} MENCSEVKEFILAGLTDTPELQVPLFIIFTIIYLLTLVGNVGMIVLILWDSHLHTPMYFFLSILSLSDLGYSSTITPKVMAGFLPGDKTISYNGCATQMFFFGLFATVES
YLLAAMAYDRQAAVCKPLHYNTTMTANVCAYLAIGSYFCGFLTSSIHTGNIFSLHFYNSNMIHHFFCDVPPLLVISCSITYINELVVFFAVGFDVFFALFFILKSYFSIF
IAILRMRSAEGLQKAFSTCASHLTAVSIFYGTIIFMYLRPSSSHSMDTEKVVSVFYTIIIPMLNPLVYSLRNKEVSNAFRKIIGRQSLH*
1142 >lcl|XP_003341600.1|Plus1complement(22506738..22507682) NW_001581971 olfactory receptor 5B12-like LOC100618978 __SEG__ Chr5 {Monodelphis domestica} MENSSEVKEFILVGLTDAPELQVPLFMMFMVIYVITVVGNLGMVVIISWDSRLHTPMYFFLSNLSLVDFGYSTAITPKVMAGFLTGNNIISYNGCAAQMFFIAVFATAES
YLLAAMAYDRHAAVCKPLHYTTTMTSSVCVRLVIGSYICGFVNSSIHTGDIFSLHFCNSNVIPHFFCDFPALVALSCSDTHITELVIFFVVAFNVFFAIFTILVSYLFIF
VAILRMRSAEGRQKAFSTCASHLTAVSIFYGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKSAFIKLSQGAKSSLGLSS*
1143 >lcl|XP_003341601.1|Plus1complement(22545296..22546231) NW_001581971 olfactory receptor 5B12-like LOC100619072 __SEG__ Chr5 {Monodelphis domestica} MENRSEVNEFILIGLTDAPELQVLLFIMFTVIYLITLVGNLGMVVLIFCDSNLHTPMYFFLSNLSLMDFGYSTAITPKVMAGFLTGDKVISYNACATQFFFFVAFSTVES
YLLAAMAYDRHVAVCKPLHYMTTMTSKVCVSLAIGSYVCGFLNSSIHTRDTFSFDFCSSNVIHHFFCDFPALVALSCSDTHTSELIIVFVVGFNAIFSILVILLSYLFIF
IAILRMHSAEGRQKAFSTCTSHLTAVFIFYGSAIFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPLVYSLRNKEVKKSFFKISERAKSSFV*
1144 >lcl|XP_003341605.1|Plus124854328..24855320 NW_001581971 olfactory receptor 14I1-like LOC100617205 __SEG__ Chr5 {Monodelphis domestica} MTNFTIITEFVFMEFANIRELQVLHAIFFLLIYLATMMGNFLTITAVVTDSHLHAPMYFFLSNLSLLDICYISVTLPKFIVNTLMGIQSISLLGCNTQIFFFLFFGSTEF
AFLMTMSYDRFVAICHPLHYGVIMTPARCLGAAVGSWFMGIVYSALHTGNMFRLPFSGSNVIHQFFCDIPQILKVAASNVYNTEYLLLAISSCFLLLCFVFLIISYARIF
SNVLKIPSVEGRYKALSTCSPHLIVLLLFLLSAIIAVLGPTSEESSIQSLLIAMAYTVLPPFMNPIIYSLRNKKIKVVLIRIIKMALFLRKDVSNPKKIKKIRKGGWEVE
*
1145 >lcl|XP_003341606.1|Plus115229762..15230691 NW_001581971 olfactory receptor 4C12-like LOC100618560 __SEG__ Chr5 {Monodelphis domestica} MDNGRNVTEFILLGLTQNPKLQKVIFLVFLALYMVTLAGNLLIVVTITTSHTLGSPMYFFLAHLSFLDTIYSSSSAPKLIADCLHEKKVISFSGCMVQVYAEHIFGGTEI
ILLMVMAYDRYVAICKPLHYMTVMSRKLCVILMVVAWTGGFLHATIQILFTIWLPFCGPNIIDHFMCDLYPLLNLVCMDTHNLGLFVALNSGFICLLNFLFLMASYIVIL
HSLKNYSLAGRRKALSTCVSHITVVVLSFLPCIFVYLRPAVTLPIDKAVAVFYTMISPLLNPLIYTLRNTEMKNAMRRLWSKKVNSHNK*
1146 >lcl|XP_003341622.1|Plus1complement(601389..602525) NW_001581973 mas-related G-protein coupled receptor member X3-like LOC100016554 __SEG__ Chr5 {Monodelphis domestica} MATLPGPQKRRSRAEETLTFDLLNWRTLLGNPLMHFHVFLSSEHLRGEGFLPLEPSTMAVSSTPGQQEYVPDNTTETISNGTLVPESVGKDDLRKWLNILSLVIAPVGLV
GNGLVLWLLGFRIQRNHFSVYILNLAAADALVLGSFFVFYPWETVKAHLLYLLEDCILYMFYCVSMSLLAAISTERCLSVLFPIWYRCHRPKHTSAAVCAGIWALALLFW
GGYLGVCFHLGCPKFWDDIGHLLAAWFIPVTSVLCVASLTLVLRVQCSSRRRQPPRLYLLVLLTVLVFLLCAVPLGIKIFLWSLSVFDFMPFRLALLLACVNSSANPFIY
FFLGSRRRRRGREPLGVVLQRALGEEQESEIGDRDVSHTQTLDTSSLG*
1147 >lcl|XP_003341641.1|Plus135763424..35763873 NW_001581976 calmodulin-like LOC100016775 __SEG__ Chr6 {Monodelphis domestica} MADQLTEEQITEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGIIDFPEFLTLMARKMKDTDSEEEIREAFHVFDKDGNGYISAAELRHVM
TNLGEKLTEEEVDEMIREADIDGDSQVNYEEFVQMMTAK*
1148 >lcl|XP_003341701.1|Plus1complement(48355065..48355385) NW_001581978 hypothetical protein LOC100619937 LOC100619937 __SEG__ Chr6 {Monodelphis domestica} MNYGNPPPYSDPGPTAPYPPYPQQPQGYPSSGPYPPGPPGPYPPPNAGYPYQGYPQYCWQGGPPPEAPQTTVYVVEDQRRDDSDQTTCLTACWTALCCCCLWDMLT*
1149 >lcl|XP_003341710.1|Plus1200025..200954 NW_001581979 putative olfactory receptor ENSP00000348552-like LOC100618274 __SEG__ Chr6 {Monodelphis domestica} MNGGNESIVLEFLLLGLSKHPKIEIFLFVLCLGIYLVILLGNSSLIILSIMDSNLHTPMYFFLSNLSFMDIFGTSSFLPLMLVNFLSVRKTISFAGCALQMYLTHALGTT
ECVLLAMMAYDRYVAICNPLRYTIIMNTRVCVQLAALSWIVGTINSLVQTILALRLSFCGNNIIDHFFCEILAVLKLACVDISLNAFVMMMAVLLVTMTPMLLILISYVF
ILATILRLNSAEGRKKAFSTCSAHLAVVIIFYGTILFMYSKPKAKDPDSDKLIALFYGAVTSMLNPIIYSLRNKEVKAAVKKVISSIRT*
1150 >lcl|XP_003341715.1|Plus1140073..141011 NW_001581979 olfactory receptor 13J1-like LOC100616679 __SEG__ Chr6 {Monodelphis domestica} MEIVNDTIIIEFFLKGFSNYPRLESLLFVLCLVMYLVTLVGNGIIVAISVLDSHLHTPMYFFLSNLSFLDICYTSTFIPLMLVNFLSKRKTISFIGCAVQMCLSLSTGST
ECILLAMMAYDRYVAICYPLRYPIIMSKRVCLGMAAFSWILSLMKSIMETVIAMQMPFCGHNVVSHFTCEILAILKLICVDTSLNEIIMLVGSIILLPIPVMLIFVSYIF
ILSTILSMNSTEGRHKAISTCSAHLTVVIIFYGTIIFMYMKPKSKEAQISDELFTVLYAVVTPMLNPIIYSLRNKEVKEAVKKLLKKKYFST*
1151 >lcl|XP_003341717.1|Plus1559379..560320 NW_001581980 olfactory receptor 13D1-like LOC100617534 __SEG__ Chr6 {Monodelphis domestica} MDKRNNTAVTEFFLIGLSKYPSLQMFLYMICLVMYLVILWGNSILIIISILDLRLHTPMYFFLGNLSFLDICYTSTSVPQILANFMSERKSISFTRCALQMFMSLGLGST
ECLLLAVMAYDRYVAICNPLRYTIIMNKLLCVQMAAWTWIIGCLNSLLQTMLAMMMPFCGNIIDHITCEILALLKLICVDISLNVFIMTIASIIFLISPLLFIFFSYVFI
LSTILRIKSSEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKDTKTSDEIIALSYGVVTPMLNPIIYSLRNKEVKGAMKKVLFRNLFSRKI*
1152 >lcl|XP_003341726.1|Plus1377387..378328 NW_001581980 olfactory receptor 13C2-like LOC100616680 __SEG__ Chr6 {Monodelphis domestica} MEGVNWTSRKEFVLLGFSDYPKTEMFIFILCLIMYIVILMGNSIIIVLTILDCHLHTPMYFFLSNLSFLDICFTSFFVPKMLTNFLSENKTISFYGCMIQMYITLSMGST
ECVLLATMAYDRYVAICNPLRYPIIMKKRLCVQLVVTSWVIGFLDSAMETALIIGLPFCGKNIINHFACELLAILKLVCVDISLNEIILLIDSITFTFSPLLLIITSYIF
ILSTILRINSAEGRKKAFSTCSSHLTVVTVFYGTILFIYMKPRSKNSIADKFITLFYSVMTPMLNPIIYTLRNKEVNRAMRNVLKRLTFMRGL*
1153 >lcl|XP_003341727.1|Plus1415658..416599 NW_001581980 olfactory receptor 13C2-like LOC100616725 __SEG__ Chr6 {Monodelphis domestica} MEGVNWTSRKEFVLLGFSDYPKTEMLIFILCLIMYLVILMGNSIIIVLTILDCHLHTPMYFFLSNLSFLDICFTSFFVPKMLTNFLSENKTISFYGCMIQMYITLSMGST
ECVLLATMAYDRYVAICNPLRYPIIMNKRLCVQLVITSWVIGFLDSAMETALVIGLPFCGKNIINHFVCELLAILKLVCVDISLNEIILLIDSMTFAFSPLLLIITSYIF
ILSAILRINSAEGRKKAFSTCSSHLTVVTVFYGTILFIYMKPRSKNSIADKFITLFYSVMTPMLNPIIYTLRNKEVNRAMRNVLKRLTFVRGL*
1154 >lcl|XP_003341728.1|Plus1438703..439644 NW_001581980 olfactory receptor 13C2-like LOC100616763 __SEG__ Chr6 {Monodelphis domestica} MEGVNWTSRKEFVLLGFSDYPKTEMLIFILCLIMYLVILMGNSIIIVLTILDCHLHTPMYFFLSNLSFLDICFTSFFVPKMLTNFLSESKTISFCGCMIQMYITLSMGAT
ECVLLATMAYDRYVAICNPLRYPIIMNKRLCVQLVVTSWVIGFLDSAMETALIIGLPFCGKNIINHFACELLAILKLVCVDISLNEIILLIDSITFVFSPLLLIITSYIF
ILSAILRINSAEGRKKAFSTCSSHLTVVTVFYGTILFMYMKPRSKNSIADKFITLFYSLVTPMLNPIIYTLRNKEVNRAMRNVLKRLIFVRGL*
1155 >lcl|XP_003341733.1|Plus1complement(5845784..5846722) NW_001581980 olfactory receptor 15-like LOC100617842 __SEG__ Chr6 {Monodelphis domestica} MGGTNMSSFKGFILKGVSDHPQLEMIFFVVILFSYLLTLMGNLTIILISRLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLMNLWGPDKTISYGGCITQLYVFLWLGAT
EALLLLVMAFDRYIAICRPLHYVTTMIPRLCWQLAAIAWLGGLGNSLIQSTFTLQLPLCGHQEVDNFLCEVPALIKLACGDTNLNQALLNGVCAFFTAVPLSIILISYGY
IARAVLKIPSAAGRRKAFNTCGSHLIVVFLFYGSAIYAYLLPAKSSSQDRGKFISLFYSVVTPMVNPLIYTLRNKEVKGALRRLLGKGREQG*
1156 >lcl|XP_003341837.1|Plus119191115..19192068 NW_001581988 olfactory receptor 5K1-like LOC100619413 __SEG__ Chr7 {Monodelphis domestica} MAENNTLTTEFILTGFTNHQELKILLFILFLIIYLITMIGNIGLVILISIEPQLHSPMYLFLGNLALMDAFSSCAVTPKMLINFFSKDRLISLHECMAQFYFLCFSESSD
CFLLAAMAYDRYVAICNPLHYPIMMSKKLCIQMIIGSLIAGNLHSMIHVGFLFRLTFCKSHQVNHFFCDVLPLYRLSCTDPYINELMIFIFSGSIQVFTIGVVLVSYVYI
IYTILRMKSKEGRGKAFSTCASHFISVSIFYGSLLIMYIRPGAVNEGAIDIPVAIFYTIVIPFLNPFIYSLRNKEVISILRKIMEKNSGKFGTKFVH*
1157 >lcl|XP_003341844.1|Plus118981041..18981964 NW_001581988 olfactory receptor 5AC1-like LOC100618902 __SEG__ Chr7 {Monodelphis domestica} MMEENMTLVTEFVLTGLTDRPEIQLVLFPIFLMIYLTTMVGNIGLVVLVWMDSHLQTPMYIFLSSLAFADACTSSSVTPKMLMNFLSQDKSISISECLAQFYFFGASAST
ECFLLAVMAYDRYAAICKPLLYPVRMSNRLCSQLVIASYTLGFLHLMIHVGLLFRLTFCRPNLIHHFYCEILPLFKISCIDPSLNALVLFIFALSIQSFTLMTTLVSYTF
VFLAILRIKSEHGRSKAFSTCSAHLLSVSLFYGTLLIMYVFPGSGGAKDQDIMNSLFYTIIIPLLNPFIYSLRNKEVLAALRKVIKK*
1158 >lcl|XP_003341845.1|Plus119009227..19010150 NW_001581988 olfactory receptor 5AC1-like LOC100618937 __SEG__ Chr7 {Monodelphis domestica} MMEENMTLVTEFVLTGLTDRPEVQLVLFPIFLVIYVTTMVGNIGLVVLVWMDSHLHTPMYILLSSLAFADAWTSSSVTPKMLMNFLSQDKSISISECMAQFYFFGASVTA
ELFLLTVMAYDRYAAICKPLLYPVRMSNRLCSQLVIASYTLGLLHLMIHVVLLFRLTFCQPNIIHHFYCELFPLLKVSCIDPFLNSLVAFIFSLFIQSFTLMTILVSYTF
VFLAILRIKSENGRSKAFSTCSAHLLSVSLFFGTLLIMYVCPGSGVAKDQDIMFSLFYTIIIPLLNPFIYSLRNKEVLGSLRKVIKK*
1159 >lcl|XP_003341846.1|Plus119080899..19081837 NW_001581988 olfactory receptor 5AC1-like LOC100619073 __SEG__ Chr7 {Monodelphis domestica} MMEENMTLVTEFVLTGLTDRPEIQLVLFPIFLVIYVTTMVGNIGLVVLVWMDSHLHTPMYILLSSLAFADAWTSSSVTPKMLMNFLSQEKSISISECMAQFYFFGVSAST
ECFLLAVMAYDRYAAICKPLLYPVRMSNRLCIQLVIASYTIGCLYVMIHVGLLFRLTFCRSNIIHHFYCEILPLFKISCTDPSVNAIVLFICALSIQSFSVMTILISYTY
VFLAILRIKSETGRRKAFSTCSAHLLSVSLFYGTLLIMYVFPGSGGAKDQDIMYSLFYTIIIPLLNPFIYSLRNKEVLAALRKVIKKIKFLK*
1160 >lcl|XP_003341866.1|Plus153055148..53056215 NW_001581989 G-protein coupled receptor 183-like LOC100617796 __SEG__ Chr7 {Monodelphis domestica} METNFTTPFSTLANMTCDLYAHRNVAKFLMSLHYSTVFIIGLLGNLLALSVIFQNRRKINSTTLYSTNLVISDILFTTALPTRIAYYAMGFDWKIGESLCRITALIFYIN
TYAGVNFMTCLSIDRFLAVVHPLRYNKMKRIKHAKCVCIFVWILVFAQTLPLLIHSMSREENGRTTCMEYPNFEEIDHLPWILLGACLIGYAIPLVIILICYSQICCKLF
QTAKQNPLTEKSGVNKKALNTIIFIIIVFIVCFTPYHVAIIQHMIKKLQKEPDCKEQHIFQISLHFTVCLMNFNCCMDPFIYFFACKGYKTRVMKMLKRQVSVSISSAVR
SAPDENSREMTENQTMIHSKSLNGR*
1161 >lcl|XP_003341920.1|Plus112433186..12434214 NW_001581995 p2Y purinoceptor 12-like LOC100618708 __SEG__ Chr7 {Monodelphis domestica} MSDFDNFTNGTGNHSLCTRDYKITQVLFPLLYTVLFVVGITMNSLAMGIFFQIPSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGAGPLRAFVCQVTSVIFYFTMYI
SISFLGLITIDRYQKTTRPFKTSNLNNPLGAKILSAVIWIFMFLLSLPNMILTNKKPVHLNVKKCAFLKSDFGLVWHEIVNYICQVIFWINLLIIIVCYTLITKELYRSY
VRTRGVGKAPKKTVNVKVFIVIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFYLCKSFRNSLMSMLRHRNAPIASAQEIRNKG
QDNSSPSEEIPL*
1162 >lcl|XP_003341979.1|Plus15285152..>5287113 NW_001582006 YTH domain-containing protein 1-like LOC100020111 __SEG__ Chr8 {Monodelphis domestica} MAANNQEEKDGDLNVLDYILTEEHEQDNNLCNPEMEQDQNVENDSKRKCDQIETTQSKSQKSAGHSRQLTLKPLRITISDNKRIIRTNTNENCQRSERAEGKSHLSGELY
KSQPEKTSVRKRDLQRRTESSTPDDSQRIRQDVDRWHSRSRLSSKEVGSEEYDYETGSSDSSKEHENCRKNEKEGMEEEEEWDDETKDETNRGEKDKQDKRNQKERNNYD
TRSEANDSYSETVSFTEGSVRSGPSTDGSDEKKEGRKRARGIASIVFHRSTSFVSASERKHNKSASSFHADQTRRLKYILRDARFFLIKSNNYENISLAKARGIWSTLPT
NERKLNAAFRSARNVILIFSVRESRKFDGFARLSSESHHGGSPIHWVLPESMNPKMLGGVFKIDWICRHELPFTKSAHLTNSLNEYKPVKIGCDGQEIDFECGTQLCLLF
CPDESVDLYQVIHKMHHKRRMHSQFHSRGRPSHQESGQYVRRHQSEDYDIHNSRKKPRIDYTPGFHQRPGHIKDPPYQEAYRRFSGVPRDVFLNRSNNDYLGTFYDRRSP
SPRQGMSPYLEIEQSSYHPYYQDHAPPFQDSYSGRQPIPREARHRDKQVCDYMWGHDFLHKTQAIVSGRRSRSCKRDGDRKCEYSRYIRRNREKDQWKERRREE
1163 >lcl|XP_003341984.1|Plus1complement(135256..136218) NW_001582011 olfactory receptor 10C1-like LOC100617986 __SEG__ Chr8 {Monodelphis domestica} MLSSEPMMRENQTLCTKFIFVAFSSLGELQPVLFVVFLAIYTFTVLGNLVIIFLIWVSPSLHTPMYFFLTNLSFLEMCYITSVVPQLLVHLLVEPKTMSVSRCAAQMYIF
TILGLTECCLLAAMAYDRFVAICYPLRYTLLMGPRVCLQLAVASWTIGMVVEIAQTTWIFTLPFCGTGKIQHFFCDIMPVVKLACVDTSQNEIVMFSVSVLFIMSPCLLI
LCSYARILIAILRMPSAAGRHKAFSTCSSHLLVVSLFYGTALFTYLQPKAAHTPDTDKATALMYTVVTPALNPVIYTLRNKEVKGAFWRIARRHPLNQAA*
1164