SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab T    

ID / Description / Sequence
1 >lcl|NP_001075251.1|Plus15418626..5419897 NW_001867391 5-hydroxytryptamine receptor 1A HTR1A __SEG__ Chr21 {Equus caballus} MDVLGPGQGNNTTSSEGPFGTRANATGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCD
LFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLVGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR
AARFRIRKTVKKVEKKGADSRLGASPAPQRKKSANGELGSREWRQGLETSKWEFLVAPMALCSQG*RRRPLEGDRSAPNGQLQGALPLTSEAGAIPCAPAFFEKKNERNA
EAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKFCRR*
2 >lcl|NP_001075265.1|Plus1complement(6539458..6541812) NW_001867405 toll-like receptor 2 precursor TLR2 __SEG__ Chr2 {Equus caballus} MPHALWTVWVLGAVISLSKEGVPDQPSSLSCDPTGVCDGRSRSLNSIPSGLTAAVKSLDLSNNKIASVGNSDLWKCVNLKALRLGSNDINTIEEDSFSSLRSLEHLDLSN
NHLSNLSSSWFRPLSSLKFLNLLGSTYKTLGETSLFSHLTNLRILKVGNIHFTEIQGKDFAGLTFLEELEIDATNLQRYEPKSFKSIQNISHLILRMKQPVLLPEIILDT
LSSLEYLELRDTYLNTFHFAEVSDPETNTLIKKFTFRNVKITDESFDEIVKLLNYISGVSEAEFDECTLDGLGEFRTPDIDKIKVIGKLETLTIRRLRIPQFYLFRDLSS
IYSLTERVKRITIENSKVFLVPCSLSRHLKSLEYLDLSDNLMVEEYLKNSACERAWPSLQTLILRQNHLTSLGKTGETLLTLKNLTKLDISKNSFHSMPETCQWPEKMKY
LNLSSIRIDRLTQCIPQTLEVLDISNNNLNSFSLILPQVKELYISRNKLKTLPDASFLPMLLVMRISRNTINTFSKEQLDSFQKLKTLEAGGNNFICSCEFLSFTQEEQA
LDQILIDWPENYLCDSPSHVRGQRVQDTRLSVSECHRTALVSAVCCALFLSILLTGVLCHHFHGLWYMKMMWAWLQAKRKPRTAPQRDICYDAFVSYSERDSYWVENLMV
QELEHFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIDKKAIPQRFCKLRKIMNTKTYLEWPTDEAQ
QEGFWLNLRAAIKS*
3 >lcl|NP_001075388.1|Plus1complement(5821123..5822583) NW_001867380 histamine H1 receptor HRH1 __SEG__ Chr16 {Equus caballus} MTCLNSSSDLEDKMCEGNKTTIASPQLMPLVVVLSTISLVTVALNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLFTSKWPLGRPLCLFWLSMDYVA
STASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWFLSFLWVIPIWGWHHFVSQTWNRQEDKCETDFYDVTWFKIMTAIINFYLPTLLMLWFYTKIYKAVRQH
CQHRDLINGSLPSFSDVKLKPENPKVDAKKSEESPWEVLKRKPKDAGGGSVLKLPSEDPKEMKSPAVFSQEEVGEVDNLHCFPLNTVQMHTEAEGNDRGYVAINQSQSQL
EMGEQGLNMREANEMPEDQILGDSPSFSQTDLDTPPEPASGKGKPRGGSNTGLDYIRFTWKRLRSHSRQCVSGLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFC
KSCCNEHVHMFTIWLGYINSTLNPLIYPLCNENFKKTFKKILHIRS*
4 >lcl|NP_001091075.1|Plus1complement(17069004..17070146) NW_001867381 C-C chemokine receptor type 2 CCR2 __SEG__ Chr16 {Equus caballus} MDGNNTFPQFGHNMLSTSHSLLTTNIKGKDEDPTTSYDYDFSEPCRKTDVKQIAAGLLPPLYSLVFIFGFVGNMLVVLILINCKKLKSMTDIYLLNLAISDLLFLVTLPV
WAHYVTNGWVLGDEMCKLFTGLYHIGYFGGNFFIILLTIDRYLAIVHAVFALKARTVTFGVMTSGVTWVVAVFASLLGIIFTKSQKEDFSESEKESVYSCGPYFPTGWKD
FHTIMRSILGLGLPLLVMIICYSGILKTLLRCRNEKKKHKAVRLIFVIMIVYFLFWAPYNIVLSPELLPGNLWLE*L*DTQSAGPSHAGDGDAWDDALLHQPHHLRLRR*
EVQKVSLHVLPKAHCQTSLQTMPSFLWGDSRPSEFNIHSFHWGAGSLSWFV
5 >lcl|NP_001098003.1|Plus1complement(17057849..17058913) NW_001867381 chemokine receptor type 5 CCR5REC __SEG__ Chr16 {Equus caballus} MGYQTTSPFYDIDYSTSEPCQKTDVRQIAARLLPPLYSLVFICGSLGNMLVILVLIKYVKLKRVADIYLLNLAISDLLFVLTLPLWAHYAAHSWVFGNRMCQLSIGLYFI
GFFSGIFFIILLTIDRYLAIVHPVIPLKVSTVAFGVVSSGVTWLVAVFASLPGIIFTKSQKEDFLESEKESVYSCGPYFPPQWRNFHIIMITILSLVLPLLVMIICYSAI
LKTLLQCLPRKKHKAVRLIFVIMIVYFLFWAPYNIVLLLSTFQEIFGLSDFETSSRLDQDMQVTETLGMTHCCINPIIYAFVGEKFRRYLSMFFRKHIAKHLCKPRCPVF
CGKTVERVSSRNTPSAGEQELSIA*
6 >lcl|NP_001104771.1|Plus18736089..8739205 NW_001877040 toll-like receptor 8 TLR8 __SEG__ ChrX {Equus caballus} MILQPLLLTCLFLIISDSCEFFTETNYSRSYPCDEKRENVSVIAECNDRRLEEVPQTVGKYVTELDLSDNFIIHITNESFQGLQNLTKINLNHNGKARSQNENPDVNKNG
MNITDGAFLNLQNLRELLLEDNQLDKIPTGLPGSLRELSLIQNRITSVTKKNTSGLMNLEYLYLGWNCYFGNICNKTFDIEDGTFERLTNLKVLSLSFNNLSHVPPKLPN
SLRELYLSNTKIKNITQEDFKELRNLTVLDLSGNCPRCFNAPFPCTPCERDSSIQIHPLAFQDLTELRYLNLSSTSLRKVPAIWFDNMHHLKVLHLEFNYLVQEIASGEF
LTKLPSLEILDLSFNYIVTKYPKYIEISPNFSNLTSLQILHLRGYVFQEVRKEHFRPLMSLSNLKTINLGVNFIKQIDFTFFQHFPNLTVIYLSENRISPLVNDSLQNYT
NGSAFQSHILKRRSADFEFNPHSNFYHNTNPLIKPQCTAYGKALDLSLNSIFFIGQKQFKAFHDIACLNLSSNGIGQPLHGTEFSAVPHIKYLDLTNNRIDFDDDNALRE
LPELEVLDFSYNAHYFRIAGVTHRLGFIQNLTQLRVLNLSHNSIYTLTEYNMNSMSLEELVFSGNRLDLLWNAEDRRYRKIFKCLRNLTRLDLSFNNLQHIPDEAFLNLP
QNLTELYINDNRLHFFNWTLLQHFPHLHLLDLSRNKLSSLTNNLSKFSPSLRTLLLSQNKISHLPSGFFSEASGLIHLDLRFNRLKMINKTTLQTKTTINLAVLELGGNP
FDCTCDIGDFRRWMDENLNIAIPRLADVICASPGDQRGKSIVSLELTTCVSDAIAAILCFFTFFITVTVMLAALAHHWFYWDVWFIYHMCLAKIKGYRSLSTSQTFYDAY
VSYDTKDASVTDWVINELRFHLEESEEKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTIFVLTKKYAKNWNFKTAFYLALQRLMDENMDVIVFILLEPVLQHSQYLRLR
QRICKSSILQWPDNPKAEGLFWQSLKNVVLTENNSRYNNLYVDSIKQY*
7 >lcl|NP_001108006.1|Plus136259305..36260258 NW_001867410 melanocyte-stimulating hormone receptor MC1R __SEG__ Chr3 {Equus caballus} MPLQGPQRRLLGSLNSTLPATPYLGLTTNQTEPPCLEVSIPDGLFLSLGLVSLVENVLVVTAIAKNRNLHSPMYYFICCLAVSDLLVSMSNVLEMAILLLLEAGVLATQA
SVLQQLDNIIDVLICGSMVSSLCFLGSIAVDRYISIFYALRYHSIMMLPRVWRAIVAIWVVSVLSSTLFIAYYNHTAVLLCLVTFFVAMLVLMAVLYVHMLARACQHARG
IARLHKRQHPIHQGFGLKGAATLTILLGVFFLCWGPFFLHLSLLILCPQHPTCGCVFKNFKLFLTLILCSAIVDPLIYAFRSQELRKTLQEVLLCSW*
8 >lcl|NP_001116851.1|Plus13008732..3009277 NW_001867366 suppressor of cytokine signaling 3 SOCS3 __SEG__ Chr11 {Equus caballus} PAARRNLLLSAEPARHLSSSATAPDQRHFLHAQRQEPVGDQRTCASSAKGGRFLAAERPPGARNPVPRFDCVLKLVHHYMPPPGAPSLPSPPTEPSSSPSSEVPDQPPAQ
PLPGNPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL*
9 >lcl|NP_001157296.1|Plus1complement(15901376..15902524) NW_001867420 sphingosine 1-phosphate receptor 1 S1PR1 __SEG__ Chr5 {Equus caballus} MGSTSIPLVKALRSSVSDYVNYDIIVRHYNYTGKLNISVDKENGIRLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTY
KLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSFRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVIL
YCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCK
CPSGDSTGKFKRPIIAGVEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS*
10 >lcl|NP_001157484.1|Plus18951148..8952512 NW_001867379 alpha-2B adrenergic receptor ADRA2B __SEG__ Chr15 {Equus caballus} MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDR
YWAVTRALEYNTKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSHLRGPRAKGGPGGGGSKQ
PHPVPAGASASAKLPTVASCLAAAGEANGHSEPTGEKEAETPEDSGTPALPPSWPALPSSGQDQKEGVCGASLEEEAEEEEEEEEEEEEGEEECEPQALPASPASACSPP
LQQPQGSRVLATLRGQVLLGRGVATAGAQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRA
FRRILCRQWTQTAW*
11 >lcl|NP_001163810.1|Plus1843206..844558 NW_001867375 selenophosphate synthetase 2 SEPHS2 __SEG__ Chr13 {Equus caballus} MAEAAVTGVSGEAMAAAAAEGSAGPAGLSLGRGFSSYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQETLLKLLAGLTRPDARPQLGRGLVGDLEEAAQEAGLPARVEP
NPTFPTLGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMTEEEREKITPLMIRGFRDAAEEGGTAVTGGQTVVN
PWIIVGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKIKMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQN
LAKQQRNEVSFVIHNLPIIAKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATATALAPD
SSNASSEPSS*
12 >lcl|NP_001166030.2|Plus112526334..12527419 NW_001867413 retrotransposon-derived protein PEG10 isoform 2 PEG10 __SEG__ Chr4 {Equus caballus} LGPDCPPPPPPPPPNAPSSASSSSSRRGQRGQYIPNLADRRRDDLSEEINSLREKVMKQSEENNNLHNQVQKLTEENTSLREQVEPAPQDEEDDIELRGAAAAAAPPTPI
EEECPDDLPEKFDGNPDALVPFMAQCQLFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMTEMKHVFEDPQRREAAKRKIRRLRQGMGSVIDY
SNAFQMIAQDLDWNEPALIDQYHEGLSDHIQAELSRLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLSHITHHHQVDPTEPVGGARMRLTQEEKERRRKLNL
CLYCGNGGHYADNCPAKAAKASPAGNSPAPL*
13 >lcl|NP_001191989.1|Plus142865173..42866795 NW_001867379 probable G-protein coupled receptor 75 GPR75 __SEG__ Chr15 {Equus caballus} MNSTDHLQDAPNTTLLHVPHSQGGNNTALQEDLQDLIHTATLVTCTFLLTVIFCLGSYGNFIVFLSFFDPAFRKFRTNFDFMILNLSFCDLFICGVTAPMFIFVLFFSLA
SSIPDAFCFTFHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTLLLTLLLWATSFTLATLATLKTSKSHLCLPMSSLIAGEGKAILSLYVVDFTFCVAVVSV
SYIMIAQTLRKNAQVRKCPPIITVDASRPQPFMGAPVKGGGDPIQGTMPALYRNQNYNKLQHIQTHGYTKSPNQLQTPAASRLQLVSAVNLSTAKDSKAVVTCVIIVLSV
LVCCLPLGISLVQVVLSSSGSFILYQFELFGFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKK
FVDQACGPSHSKESVVSPKISVGHQHYGQSSSTPINTRIEPYYSIYNSSPSQEESIPCNLQPVNSFGFANSYIAMHYHTTNDLMQEYDSASAKQIPVPSV*
14 >lcl|XP_001488008.1|Plus11283097..1286225 NW_001867368 V(D)J recombination-activating protein 1 RAG1 __SEG__ Chr12 {Equus caballus} MAVSLTATLGLNSAPDEIQHPHIKFSEWKFKLFRVRSFEKAPEEAQKEKDSSEGKPSLEQSPAVLDKAGGQKPVLTQPAVKPHPKFLKKSHDDGKAREKAIHQASLRHLC
RICGNSFKTDGHNRRYPVHGPVDGKTQVLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCWSIMHRKFSSAPCEVYFPKNATMEWHPHTPSCDICHTARQGL
KRKSHQPNVQLSKKLKTAVDRARQARQHKRRAQARISGKGVLKKITNCSKIHLSTKLLAVDFPAYFVKSISCQICEHILADPVVTSCKHVFCRICILRCLKVMGSYCPSC
RYPCFPTDLESPVKSFLSILNSLMVKCPAEECNEEVSLEKYNHHVSSHKESKETFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKAFADKEEGGDVKSVCLTLFLLA
LRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHPFEWQPPLKNVSSNTDVGIIDGLSGLSSSVDDY
PVDTIAKRFRYDSALVSALMDMEEDILEGMRAQELDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMKITIAHGSQNVKVFEEAKPNSELCCKPLCLM
LADESDHETLTAILSPLIAEREAMKDSELMLEMGGILRTFQFIFRGTGYDEKLVREVEGLEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHES
VEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHLRKKMNLKPIMRMNGNFARKLMTKETVEAVCELIPSRERHEA
LKELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVL
KHHWLYTSKYLQKFMDAHKALKNSGFCINSQGSLEDPLGSDDSLETQDSMEF*
15 >lcl|XP_001488104.2|Plus1complement(10459440..10460366) NW_001867408 olfactory receptor 6F1-like LOC100051214 __SEG__ Chr31 {Equus caballus} MGTNNETLPHDFLLLGFPGSQALQLFLVMFFLVMYILTVSGNMTILMLVSTSHQLHTPMYFFLSNLSFLEIWYTTAAVPKALAILVGGCQIISFTSCLLQMYLVFSLGCT
EYFLLAAMAYDRYLAICYPLHYGVIMNSLLSAQLALASWVCGFLAIAVPTALISNLTFCGPHTINHFFCDIAPWIALACTSTRGVELVAFVIAFVVILSSCLITLVSYIY
IISTILRIPSASGRSKAFSTCSSHLAVVLIWYGSTIFLHVRTSIKEALDLTKAVHVLNTVVTPVLNPFIYTLRNKEVRETLLKKWKGK*
16 >lcl|XP_001488128.3|Plus1complement(1413657..1415192) NW_001867386 PWWP domain-containing protein 2B-like LOC100051318 __SEG__ Chr1 {Equus caballus} MQLGTGTPPPPCGDPHPETTGPEPPPPLVPPLPVGSLPPFPPYFEGAPFPPPLWLRNTYRQWVPQPPPRTIKRTRRRLSRNRDPGRLALSPIRLRPRQVLCEKCKSTLSP
PEASPGPPATPKARRGLGSGPGHDREPQKPEDPAGGGDTVSAATARRSKRERREVDKARVPRSPVIKISYSTPQGKGEVVEIPSRVHGSLEPFCPPQAPHGGGQDPEPPR
DRPPGGPSASIPKLKLTRPGPPGADLPPPKIRLKPHRLGAGEQEPVYRAELVEELNGHGRGPRASSPALLAAGPAPGGLVDLSSGSSGEDDDFKRGPQGKHGPTGLAFLA
TCPKRTDCASESVWSSDSLDESKSSSSEVPSPDTCDLSSGDGVSVPSSSKDARQTVPPLTVRLHTQSVSTCVTEDGRTVAVGDIVWGKIHGFPWWPARVLDINLSQKEDG
EPSWQEAKVSWFGSPTTSFLSISKLSPFSEFFKLRFNRKKKGMYRKAITEAANAARLVAPEIRELLTQFET*
17 >lcl|XP_001488155.2|Plus110394601..10395545 NW_001867408 olfactory receptor 2W3-like LOC100051428 __SEG__ Chr31 {Equus caballus} MDGTNGSTQGNFILLGFSDRPHLERILFVVILIAYLLTLVGNTIIILVSRLDFHLHTPMYFFLTHLSFLDLSFTTSSIPQLLYNLSGGDKTISYTGCAIQLFLFLGLGGV
ECLLLAVMAYNRFVAVCKPLHYMVIMNPCLCMALVSVAWGCGMANSLAMSPVTLLLPRCGNHHVDHFLCEMPALIRMACVNTAAIEGTVFVLAVGIVLSPLVFILASYGY
IMRAVLQIQSVSGRQKAFNTSGSHLTVVSLFYGNIIYMYMQPGNSSSQDQGKFLTLFYNIITPLLNPLIYTLRNKEVKGALRRLLLGDREVGKK*
18 >lcl|XP_001488157.1|Plus1complement(15920962..15923097) NW_001867424 zinc finger and BTB domain-containing protein 39 ZBTB39 __SEG__ Chr6 {Equus caballus} MGMRIKLQSTNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYEVAERLG
MEDLLRACHSTFPDLESTAVAKPLTGTSESHAGTLSCSAAEPPQPLGELRGTGEHLGPDRNYVLPSDAGGSYKEEERNLTSDTNHSLPLPQQPLPPKTEDHDAPASFPSV
PSVVTQPILGTVSMGIQTSASSCQPYKVQSNGDFSKNSFFTPDNAIDITTGTNSCLSNSDHSRDPGFGQMDELQLEDLGDDDLQFEDPTEEIGTAEEVIELSDDSEDELT
FGENDNRENKAMPCQVCKKVLEPNIQLIRQHARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTFHRRDGIFENNIIVHPNDPLPGKLG
LFSGTASVELKCAACGKALAKDFHVVRGHILDHLNLKGQACSVCDQRHLNLCSLMWHTLSHLGISVFSCSVCANSFVDWHLLEKHMAVHQSLEDALFRCHLCSQSFKSEA
AYRYHVSQHKCNSGLDARPGFGLQHPALQKRKLPAEEYLGEELALQGQPGNSKYNCKVCGKRFAHTSEFNYHRRIHTGEKPYQCKVCHKFFRGRSTIKCHLKTHSGALMY
RCTVCGHYSSTLNLMSKHVGVHKGSLPPDFTIEQTFMYIIHSKEADKNPDS*
19 >lcl|XP_001488166.3|Plus1complement(10375876..10376838) NW_001867408 olfactory receptor 2T4-like LOC100051498 __SEG__ Chr31 {Equus caballus} MDNTMWVTNNTGWSDFILVGLFSQSKHPALLCVVIFVVFLMTLFGNTILILLIYSDAHLNTPMYFFISQLSLMDMMYISVTVPKMLMDQVMGVNKISAPECGVQMFLYLT
LVGSEFFLLAAMAYDRYVAICHPLHYPILMNHRMCLLLVSGCWFLGSVDGFMLTPVTMTFPFCRSQEIHHFFCEVPALMKLSCSDTSLYETLMYLCCVLMLLIPVIVISS
SYSFILLTIYKMNSAEGRKKAFTTCASHMTVVILFYGAAVYTYMLPSSYHTPEKDMIVSVFYTILTPVLNPIIYSLRNKDVTGALKKMLNVESVFQETIK*
20 >lcl|XP_001488175.2|Plus110832464..10833396 NW_001867368 olfactory receptor 8I2-like LOC100051520 __SEG__ Chr12 {Equus caballus} MAEKNFTEVTLFILSGFTNHPELQVGLFLMFLFIYLFTVLGNLGLIMLIRIDSHLHTPMYFFLSNLAFIDIFYSSTITPKALVNFQSKQKVISFVGCFVQMYFFVGLVCS
ECFLLGSMAFDRYVAICNPLLYSMVMSQKMCTWLGVIPYMIGFTNSMISICVISSLSFCDSTINHFFCDTTALLALSCVDTFSTEMVIFVLAGCTLLSSLLIITITYTAI
ISAILRIQSVAGRQKAFSTCASHLIGVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNALLRFIHRKRFP*
21 >lcl|XP_001488202.2|Plus110336657..10337652 NW_001867408 olfactory receptor 2T8-like LOC100051641 __SEG__ Chr31 {Equus caballus} MVKILSSIYPFAVLLFFEILENGNTTSGFILLGLFNHTEAHPFLFVMVLTIAFTSLLGNALMLLLIHQEPHLRTAMYFLLSQLSLMDMMLVSTIVPKMAADYLTGKKSIS
PAGCGLQIFFLLTLGGGECFLLAAMSYDRYVAVCHPLQYPVLMSPQLCLRMTLGSWFLGAADGLMQAATTLSFPFCSAHEIDHFFCEAPTVVRLACADISVFEYVMYICC
VLMLLVPLSLILTSYSLILTAVLQKRSREACKKAFATCSSHLAVVGLFYGAAIFTYMRPKSYRSANHDKVVSAFYTIFTPVLNPLIYSLRNREVKGALRKCMGQWAALSH
N*
22 >lcl|XP_001488212.1|Plus1complement(4058119..4060041) NW_001867368 leucine-rich repeat-containing protein 4C isoform 1 LRRC4C __SEG__ Chr12 {Equus caballus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLVK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
23 >lcl|XP_001488272.2|Plus110934936..10935877 NW_001867368 olfactory receptor 8K5-like LOC100051914 __SEG__ Chr12 {Equus caballus} MSQQNLTLLTEFILMGVTRQPELQVPLFGIFLIIYTVTVVGNLGMIIVTQVDSHLHTPMYFFIKHLAFIDLGNATVICPKMLVNFVVDKNTISYYACATQLAFFLMFIIS
EFFILSAMAYDRYLAICNPLLYNVIMSRRLCHVLVGIPYVYSTFQALMFTTKIFTLTFCGSNIISHFYCDDLPLLLMLCSNAREIELLIIIFSALNLISSLMVVLVSYIL
ILIAIFQMHSTEGRKKAFSTCGSHLMVVVVFYGSLLFMYMQPKSTHSFDTDKMASVFYTLVIPMLNPLIYSLRNKEVKNAFHRVFKNQCKLCS*
24 >lcl|XP_001488274.1|Plus1972740..973828 NW_001877047 type-2 angiotensin II receptor AGTR2 __SEG__ ChrX {Equus caballus} MKGNFTLATISRNITSSLHFGLVTISGNESAFNCSHKPSDKHLDAIPVLYYIIFVIGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWL
FGPMMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFI
IPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVVNSCEVIAVIDLALPFAILLGFTNSCINPFLYCFVGNRFQQKLRR
MFRVPITWLQGKRERVSCRKSSSLREMETFVS*
25 >lcl|XP_001488293.1|Plus1complement(1302558..1303676) NW_001867379 probable G-protein coupled receptor 45-like LOC100050078 __SEG__ Chr15 {Equus caballus} MACNSTSIETYEYLLLNESNVSDSGVTTPPAPLRISLSILMMLMIVVGFLGNAVVCIIVYQRPAMRSAINLLLATLAFSDIMLSLCCMPFTAITLITVHWHFGDYFCRLS
ATLYWFFVLEGVAILLIISVDRFLIIVQRQDKLNPQRAKVIIAVSWALSFCVSAPSLAGWTSVEVPTRAPQCVPGYTELPANRAYVVTLVVAVFFAPFGVMLCSYLCILH
TVRKNAIRVHNQSDSLDLRQLTRAGLRRLQRQQQVSVDLSFKTKAFTTILLLFVGFSLCWLPHSVYSLLSVFSRTFYCSSSFYTTSSCILWLSYLKSVFNPIVYCWRIKK
FREACVELLPQTFQILPRVPERIRRRIQPSTVYVCNENQSAV*
26 >lcl|XP_001488306.2|Plus110969027..10969986 NW_001867368 olfactory receptor 1044-like LOC100052037 __SEG__ Chr12 {Equus caballus} MAQINCTQVSEFILVGLTDHQELKMPLFVIFLSIYLFTVAGNLGLILVIRADARLNTPMYFFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFNACAAQLGFFLAFMTA
ECLLLDSMAYDRYVAICNPLLYMTVMSPRICIQLVPVPYSYSFLVALFHATLTFSLSYCHSNIINHFYCDDMPLLRLTCSDTHSKQLWIFACAGIMFISSLLVVFVSYMY
IISAILKMRSAEGRRKAFSTCGSRMLAVTIFYGTLIFMYLQPSSYHSLDTDKMASVFYTAVIPMLNPLIYSLRNKEVKEALKKVVIYRKQTFVFMKLRK*
27 >lcl|XP_001488341.2|Plus1complement(11008792..11009724) NW_001867368 olfactory receptor 5M9-like LOC100052157 __SEG__ Chr12 {Equus caballus} MQNFTAVTKFILVGLTSRQELQLIFFVVFLLVYMITLLGNIGMIILISISPQLQSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIALVLVEV
YILAVTALDRYMAICKPLLYGSKVSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEVNHFYCADPPLIKIACGGVHIKEYTMIVIAGINFTYSLSVLLTSYTLIV
IAVLRMHSADGSRKAFSTCGSHLTAVTMFYGTLIFMYLRQPTEDSLEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVGKAIIKAKLGQ*
28 >lcl|XP_001488363.2|Plus1complement(11016065..11016997) NW_001867368 olfactory receptor 5M3-like LOC100052217 __SEG__ Chr12 {Equus caballus} MLNFTNVTEFILLGLTSHREWQVLFFIIFLVVYLITLVGNIGMIVLVKISPQLNSPMYFFLSHLSFVDVCFSSNITPKMLENLLSETKTISYAGCLIQCFFFIALVHVEI
FILAIMVLDRYMAIGNPLLYGSKMSRVVCIRLIYFPYIYGFVISLAATLWTYGLYFRGKIEINHFYCADPPLIKLACAGTFVKEYTMIILAGINFTYTLTVVIISYLFIL
VAILRMQSVEGRRKAFSTCGSHLTAVIIFYGTLIFMYLRHPTEESVEQGKMAAVFYTTVIPMLNPMIYSLRNKDVKDAMNKVISRTCLIK*
29 >lcl|XP_001488380.2|Plus1complement(11039140..11040072) NW_001867368 olfactory receptor 5M9-like LOC100052341 __SEG__ Chr12 {Equus caballus} MPNFTDVTEFILLGLTSRQELKVLFIVVFLLVYMITLLGNIGMIILISISPQLQSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIALVHVEV
YILAVMAFDRYMAICKPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADPPLIKIACGGVHIKEYTMIVIAGINFTYSLSVLLTSYTLIV
IAVLRMPSADGRRKAFSTCGSHLTAVSLFYGTLIFMYLRRPTEDSVEQGKMVAVFYTTVIPMLNPIIYSLRNKDVKEAVNKAIIKANLGQ*
30 >lcl|XP_001488411.3|Plus1complement(11055758..11056699) NW_001867368 olfactory receptor 5AP2-like LOC100052454 __SEG__ Chr12 {Equus caballus} MKKVQGRNQTEVTEFILLGLSDNSDLQVVFFELFLLIYMATMVGNLGMIVLIKIDPSLHNPMYFFLSSLSFVDASCSSSVTPKMLVNLVADNKAISFNGCAAQFYFFASF
LGTECFLLAVMAYDRYAAIWNPLLYPVLISGRICFLLVATSFLAGFGNAAIHTGMTFRLSFCGRNSINHFYCDTPPLLKLSCSDTHINGIVIIAFSSFIVISCVMIVLIS
YLCILIAILRMCSLEGRHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKIVSVFYTAVIPMLNPLIYSLKNKDVKEALKKILQKYIL*
31 >lcl|XP_001488452.1|Plus115913642..15914862 NW_001867424 G-protein coupled receptor 182-like LOC100052618 __SEG__ Chr6 {Equus caballus} MSVMPSVGPGPSEGFTTAPTSDLEEIHNWNELLHFFNHTLPECEMELDENTKRVVLFVLYLAIFVVGLVENILVICVNWRCSGQAGLLSLYILNMAVADLGIVLSLPVWM
LEVTLDYTWLWGNFFCRFTHYFYFTNMYSSIFFLVCLSVDRYVTLTNSSPSWQRHQHKVRRAVCAGVWVLSAIIPLPEVVHIQLVESSEPMCLFLAPFETYSTWALAVAL
SSTVLGFLLPFPLIAVFNVLMACRLQKAGWPEGRRHCLLVCAYVAVFVICWLPYHVTLLLLTLHGTHVSLHCYLTHLLYFFYDIIDCFSMLHCVVNPILYNFLSPSFRGR
LLNAVVHYLPKVQAREGRHASSSSSSTQHSIVITKEDMQPTAAGHPNLNFQAPNTSSIPAPRTLQPAEADSSRLHQ*
32 >lcl|XP_001488470.2|Plus111096268..11097185 NW_001867368 olfactory receptor 1013-like LOC100052683 __SEG__ Chr12 {Equus caballus} MERGNHTVTEFILVGFTTDPVMQLILFVVFLGVYSMTVVGNTTLLMLICNDSRLYTPMYFFIGNLSFLDLWYSSVYTPKILMTCISEDKTISFAGCIAQFFFSAGLAYSE
CYLLAAMAYDRYVAISKPLLYSQAMSIKLCVFLVAASYLGGFITSSIITKRTFAMEFCSDNVIDDFFCDLLPLVKLACGRKDGYQVVLYFLLASNVITPTVLILASYLFI
IATILRIRSPQGRLKAFSTCSSHLISVTLFYGSILYIYSRPRSSYSLDRDKIVSIFYTVVFPMLNPMIYSLRNKDIKEALNKLFK*
33 >lcl|XP_001488510.2|Plus111118144..11119073 NW_001867368 olfactory receptor 1013-like LOC100052788 __SEG__ Chr12 {Equus caballus} MERSNQTVTEFILVGFTTDPVMQLVLFVVFLGVYSVTVVGNTTLIMLICNDSRLHTPMYFFIGNLSFLDLWFSSVYTPKILATCISDDKSISFAGCAAQFFFSAGLGYSE
CYLLATMAYDRYVAISNPLLYAQAMSRRLCICLVMYSYTGGFVSAILLTSNTFTMDYCGDNVIDDFFCDVPPLVKLSCDVKESYQAVLYFVLASNAIAPAVLILASYLFI
IGAILRIRSTQGRLKAFSTCSSHLISVTLYYGTILYSYSRPSSSYSLERDKMVSTFYTVVLPMLNPMIYSLRNKDVKDAVRKLFRLTQS*
34 >lcl|XP_001488546.2|Plus1complement(11834129..11835076) NW_001867368 olfactory receptor 8J3-like LOC100052898 __SEG__ Chr12 {Equus caballus} MDPGNFPWVTEFILTGISNRPELQIPLFFVFLVIYGLTVAGNLSIITLTSVDSGLQTPMYFFLRHLAIINLGNSTVIAPKMLVNFLAKKKTTFYYECATQLGMFLVFIVA
EVLMLAVMAYDRYVAICNPLLYMMVVSRQVCLVLVSLTYLYSFSTAVVASSSVFSVSYCSSNVINHYFCDTVPLLALSCSDTYFPETLVFVSAAADLVLSMIVVLVSYFN
IILSILRIRSSEGRKKAFSTCASHMMAVTVFYGTLLFMYVQPQTNHSMDTDKMASVFYTVVIPMLNPMIYSLRNKDVKSALKRFLTNPCSSFKSM*
35 >lcl|XP_001488591.2|Plus1complement(11216355..11217296) NW_001867368 olfactory receptor 5G3-like LOC100053045 __SEG__ Chr12 {Equus caballus} MEDTNQTAVTEFLFLGLTDHLPQQIVLFVTILSVYLVTLGGNLGMIALIWFDPKLHSPMYFFLSHLSFVDMCSSSSIAPKMLCDNFAGKKSISFMACAAQMWFFALFIAT
ECSLLASMAYDRYLAIGKPLLYTLIMSHRVCVQLVVGPYATGLISTTHTIFTFCLPFCGPNIINHFFCDISPLLSLACADTRINKLLLFILAGAIGVLSGLIIIISYICI
LAAILKIRTADGRRKAFSTCSSHLAVVSILYGTLFFIYVRPGSDSSLDINKVISLFYTVVIPMLNPLIYSLRNKEVKDAFRRKFERKNSLIGK*
36 >lcl|XP_001488651.2|Plus112939413..12940354 NW_001867424 olfactory receptor 9K2-like LOC100053235 __SEG__ Chr6 {Equus caballus} MGDKGGDNHSEVTDFILVGIRVHPELHSLLFLLFLIVYGMVLLGNLSMIGIIVTDPRLNTPMYFFLGNLSIIDLSYSTVIVPKAMVNILSQKKTISFTGCVAQLFLYALF
MVTEAFVLAAMAYDRFIAICNPLLYTVRMSRNLCIQLVAGSYLCGWVSSILQISATFSMSFCASRVIDHFYCDSNPIEKISCSNIFINKMVSLSLAVLIILPTIVVIAVS
YMYIVSTVLKIRSSEGRKKAFSTCSSHLGVVSLLYGTVSFVYLTPPNNPELRKVASVCYILFTPMLNPLIYSLRNKDVKDAMRKVLWRNKVLL*
37 >lcl|XP_001488666.2|Plus1complement(11280650..11281594) NW_001867368 olfactory receptor 4P4-like LOC100053284 __SEG__ Chr12 {Equus caballus} MENRNNITEFFLLGLSQKKEIELLCFLLFLFCYIAILIENLLVMISLTCSQLINQPMYFFLSYLSLSDLCYTSTVTPKLIIDLLAEKKTISYNGCMTQLFTMHFFGGIEV
FILTGMAYDRYVAICKPLHYTVIMSRQKCDVIIAASCAGGFLHSFGQFLLTIFLPYCGPNEIDHYFCDVYPLLKLACIDTSRIGLLVIANSGLMGLVTFVVLLISYTVIL
YTVKSYSAENRHKALSTCSSHITVVVLFFVPLLFIYIRPATTLPEDKVFALFYTIIAPMFNPLIYTLRNTEIKNAIKKLWFRIIQSKEINGKTP*
38 >lcl|XP_001488720.2|Plus111322834..11323793 NW_001867368 olfactory receptor 5D13-like LOC100053427 __SEG__ Chr12 {Equus caballus} MTLNEGNQSSVTTFILLGFSEYPHLQAPLFLLFLTIYTVSVVGNFGIIVITRINPKLHTPMYFFLRHLSFLDICYSNVFTPKLLEILVVEDRTISFKGCMVQFFIGCTFV
ITEMFMLAVMAYDRFVAVCNPLLYTVAMSHKLCTLLVAGAYMCGGICSLTLTYSLLELSFCGSNIINHFGCEYSAILSLSCSDLYFSQMTCLVISTFSEACSLLIILSSY
MVIVVTIIKMPSTGGLRKAFSTCASHLTAITIFHGIILLLYCVPNFKSSWLLVKVSTVFLTIMIPMLNPLIYSLRNKDVKETVRGLINSKLLYPSIQFK*
39 >lcl|XP_001488791.2|Plus1complement(619737..620714) NW_001867395 olfactory receptor 2T33-like LOC100053599 __SEG__ Chr24 {Equus caballus} MEKRNTTSDFILLGLFKHTGPHLFLFMVVLTMTIASLMGNALMLLLIYWDPQLHIPMYFLLSQLSLMDVMLVATIVPKMAADYLTGKKSISPAGCGLQIFVSLTLGGGES
FLLAAMSYDRYVAVCHPLRYPVLMSQQLCLRMTLGSWFLGAADGLMQAAATLSFPFCGTHEIDHFFCEAPMLVRLACADTSVFENVMYVCCVLMLLVPFSLILTSYSFII
TAVLQMRSREACKKAFVTCSSHLAVVGLFYGAAIFTYMRPKSYRSAKLAKVVSAFYTIFTPVLNPLIYSLRNSEVKGALKKVAGEMCKFKMTANLVSFFKLFNAK*
40 >lcl|XP_001488819.2|Plus111397410..11398360 NW_001867368 olfactory receptor 5L1-like LOC100053672 __SEG__ Chr12 {Equus caballus} MSEENCTTVTEFVLLGLSDAPELRAFLFLLFLLIYGVTVLANVGMIALIRFSSQLHTPMYFFLSHLSFVDFCYSTVIMPKMLSNILNKEKVISFLGCMVQFYFFCMCAVT
EVFLLAVMAYDRFLAICNPLLYTITTSQKFCMFLVSGCYLYGIVCSLVHLCLALEIPSYRSNVVDHFFCDLPPLLTLACYDISINELVVFIVTTFNEIFTIMIIFTSYLF
ILITVLKMHSAEGRCKAFSTCASHLAAIVVFHGTILFIYCRPSSGNSMDTDKAATVFYTVVIPMLNPLIYSLRNKDVKEAVKKVLGSKLPFEKLFS*
41 >lcl|XP_001488858.2|Plus113067455..13068390 NW_001867424 olfactory receptor 12-like LOC100053767 __SEG__ Chr6 {Equus caballus} MKSHLGKNYSEVTEFILLGFRTPPKIQILLFLVFLLLYVATVVGNISMITVTKMDSRLQMPMYFFLRNLSYLDLCYSTVIAPKTLANFLSNEKKISYSGCAAQFFFFALF
VTTEGFLLPVMAFDRFSAVCSPLLYPVHMSQKVCVQLVTGSYICGCINSMIQTSCTFSLHFCGENRSDHFFCDVPALIKISCADTFVNEIVLFILSALIIITTTNVILAS
YASILSTVLKIPSTHGRSKTFSTCDSHIAVVSLFCGTVFFMYAQPGAISSPEQSKIIAVLYTLVIPMLNPLIYSLRNRDVKDAVKRILHRR*
42 >lcl|XP_001488859.2|Plus1complement(11412460..11413398) NW_001867368 olfactory receptor 5W2-like LOC100053768 __SEG__ Chr12 {Equus caballus} MAVENCTVFTDFIFLGLSDRKDVQQGLFVLFLLVYGTTLIANLGMILLVNVDARLHTPMYYFLSNLSFCDVCYSSTVSPKMLTDFLSEQKRIPYSLCAIQMYSFGAFADV
ECLMLAAMAYDRYVAICNPLLYTVAMSRRVGTQLVAIAYIVGLVDSAIHTCCTFQLPFCNSNIINHFFCDIPPLLALSNSDTSINEIIMFTFIGCVVGSSIVTVLLSYSY
IITTILRMNSAEGRQKAFSTCASHLTAVAIFYGTLLFMYFRPSSSYSMGTDKMASVFYTVVIPMLNPLIYSLRNKDVKGALKKAINTKVCSG*
43 >lcl|XP_001488902.2|Plus1complement(11458947..11459909) NW_001867368 olfactory receptor-like protein OLF1-like LOC100053872 __SEG__ Chr12 {Equus caballus} MKTTQTTEFIAGNYTLVTEFILLGFPTRPELQIVLFLVFLTLYGLILMGNIGLMMLIRINPHLQTPMYFFLSNLSFADLCYSSVTVPKMLVNFLSVNKSISYYGCTLQFY
FFCTFADTESFILAVMACDCCVAICNPLLYTVVMSRSICIWLIVLSYIGDNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTSINELLLSTYGSSVEIICFI
IIVISYFFILLSILKIRSSSGRRKTFSTCASHLTSVVIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAAKKAIKLKVASL*
44 >lcl|XP_001488927.2|Plus113103087..13104034 NW_001867424 olfactory receptor 12-like LOC100053922 __SEG__ Chr6 {Equus caballus} MKTELSRNYSAVTEFILLGFRTPPKIQILLFLVFLLLYVATVVGKISMITVTKMDSRLQMPMYFFLRNLSYLDLCYSTVIAPKTLANFLSNEKKISYSGCAAQFFFFSMF
VTTEGFLLAVMAFDRFSAICSPLLYPVHMSQKVCVQLVTGSYICGCINSMIQTSFTFSLHFCGENRLDHFFCDVPALIKISCADTFVNEIVMFILSALIIITTTNVILVS
YASILSTVLKIPSTHGRSKTFSTCGSHIAVVSLFYGTVFFMYAQPGAISSPEQSKIIAVLYTLIIPMLNPLIYSLRNRDVKDAVKRILHRKWFSH*
45 >lcl|XP_001488988.2|Plus1complement(13150415..13151356) NW_001867424 olfactory receptor 10C1-like LOC100054063 __SEG__ Chr6 {Equus caballus} MSGNKSLCTRFTFVAFSSLAELQPVLFLVFLILYLFTVGGNLIIICLIGLTPSLHTPMYFFLVNLSFLEACYITSVVPLMLVHLLAETKTISVRGCAAQMYVFTILGLTE
CCLLAAMAYDRFVAICHPLHYTLRMGPRVCLKLAAACWTTGVVVESAQTTWILSLPFCGTGKIQHFFCDIMPVVKLACVDTSQNEIVLFAVSVLFIMSPCFLILCSYTRI
LVTILRIPSAAGRRKAFSTCSSHLLVVSLFFGTALFTYLQPKTAHTPETDKATALMYTVVTPALNPVIYTLRNKEVKEAFQRVTQRNPLRQMA*
46 >lcl|XP_001489023.1|Plus1complement(34836657..34837604) NW_001867383 protein sprouty homolog 2 isoform 1 SPRY2 __SEG__ Chr17 {Equus caballus} MEARAQSGSGSQPLLQAPRDSGRQRGEPDPRDVLTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSAQHKHERLHGLPEHRQPPRLQHSQVHASARAPLSRS
ISTVSSGSRSSTRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVC
CVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT*
47 >lcl|XP_001489053.2|Plus1complement(13178749..13179690) NW_001867424 olfactory receptor 10C1-like LOC100054214 __SEG__ Chr6 {Equus caballus} MSGNQSLCTRFTFVAFSSLAELQPVLFLVFLILYLFTVGGNLIIICLVGLTPSLHTPMYFFLVNLSFLEVCYITSVVPLMLVHLLAETKTISVRGCAAQMYVFTILGLTE
CCLLAAMAYDRFVAICHPLHYTLRMGPRVCLKLAAACWTTGVVVESAQITWIFTLPFCGTGKIQHFFCDVMPVVKLVCVDISHIKIMFFAVSVLFIMSPCFLILCSYMRI
LVTIFRIPSAAGRRKAFSTCSSHLLVVSLFYGTALFTYLQPKTAHTPETDKATALMYTVVTPALNPVIYTLRNKEVKEAFQRVTQRNPLRQTA*
48 >lcl|XP_001489054.3|Plus111610778..11611707 NW_001867368 olfactory receptor 10A7-like LOC100054215 __SEG__ Chr12 {Equus caballus} MIKTNFTVTEFVFLGLSSHPKMQFILFIMFLLFYLLTLAGNIIIITIIQIEPPLQTPMYFFLANLSFLDICYTSTNVPQMLFNMVGKKKTISFSRCATQMYFSLSFGMIE
CVLLGVMAYDRYVAICHPLHYTVIMNQITCVQLAAISWSSSFLSSLIINVLTLSLPYCGPNVLNHFFCEVPSVLRLACTDTSFTELVVFIFSIIIVFIPFLLIIVSYAQI
LLSVLRMQSASGRHKALSTCASHLTVVTLFYGTAIFMYMRPQSKSTRAGGKIIAVFYTVITPMLNPLIYSLRNQDVKGVIKRAIARQRT*
49 >lcl|XP_001489071.2|Plus1complement(13202465..13203406) NW_001867424 olfactory receptor 10C1-like LOC100054256 __SEG__ Chr6 {Equus caballus} MSGNQSLCTRFTFAAFSSLAELQPVLFLVFLILYLFTVGGNLIIICLVGLTPSLHTPMYFFLVNLSFLEVCYITSVVPLMLVHLLAETKTISVGGCAAQMYVFTILGLTE
CCLLAAMAYDRFVAICYPLHYTLRMGPRVCLKLAAASWTTGVVVESAQTTWIFSLPFCGTGKIQHFFCDIMPVVKLACVDTSHNEIVVFAVSVLFIMSPCFLILCSYMRI
LVTIFRIPSAAGRRKAFSTCSSHLLVVSLFYGTALFTYLQPKVAHTPETDKATALMYTVVTPALNPVIYTLRNKEVKEAFQRVTQRKPLRQTA*
50 >lcl|XP_001489072.2|Plus1complement(11619304..11620236) NW_001867368 olfactory receptor 1019-like LOC100054258 __SEG__ Chr12 {Equus caballus} MDKENHSIVTEFIFMGVTQDPQLQIIFFGVFLLVYLINVVGNVGMIILIITDTQLHTPMYFFLSNLSFVDLGYSSAIAPRMLADFLTKYKVISFSSCATQFAFFVGFVDA
ECYVLAAMAYDRFVAICRPLHYSTLMSKRVCLVLMLGSYLAGLVSLVAHTSLTFSLSYCRSNIINHFFCEIPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAF
ILIAIIRMRSAEGRLKAFSTCGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAAFKKLIGRKSQ*
51 >lcl|XP_001489091.2|Plus113218777..13219712 NW_001867424 olfactory receptor 6C4-like LOC100054306 __SEG__ Chr6 {Equus caballus} MGNQTSVKEFILLGLTNDAELQAVLFLFLLLTYVLSVMGNLTIIILTLLDFRLQTPMYFFLRNFSILEISFTSVFVPKMLVNIGTGDKTISFAGCFTQYFFAILLGGTEF
YLLAAMSYDRYVAICKPLHYTTIMSRRLCIQLVLCSWFSGVLVVIVPHTMTLQLPFCSSNIINHYYCDYIILLKLSCSDTHFIEVIAFVTSAVTLIFTLMLVILSYTYVI
KTILRIPSVQQRKKAFSTCFSHMIVVSLSYGSCIFMYINPSVKDAATFNKEVAVLNTSVAPLLNPFIYTLRNKQVKTAFKDMVRKIIFSRK*
52 >lcl|XP_001489092.3|Plus111634659..11635600 NW_001867368 olfactory receptor 5AP2-like LOC100054307 __SEG__ Chr12 {Equus caballus} MKEVQHRNQTEVTEFILLGLSDNSDLQVVLFGLFLLIYMATLVGNLGMIVLIKIDPCLHTPMYLFLSSLSFVDASYSSSVTPKMLMNLVAENKAISFNGCAAQFYFFGSF
LGTECFLLAMMAYDRYAAIWNPLLYPVLMSERICFLLIATSFLAGFGNAAIHTGMTFRLSFCGSNRINHFYCDTPPLLKLSCSEIHINGLVIMAFSSFNVISCVMIVLIS
YLCILIAILRMPSLESRHKVFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKIVSVFYTVVIPMLNPLIYSLKNKDVKWALKKILQKHIL*
53 >lcl|XP_001489112.2|Plus111648501..11649439 NW_001867368 olfactory receptor 1030-like LOC100054355 __SEG__ Chr12 {Equus caballus} MLKKNYTAVTEFILLGLTDRAELKPVLFVVFLVIYLITVIGNTTMIFLIRSDPKLHTPMYFFLSHLSFVDLCYASNVTPQMLINFLSKIKTISFTGCFIPFHFFIALVIT
DYYMLTVMAYDRYMAICKPLLYSSKMSRCVCFSLVATPYIYGFANGLAQTILMLRLSFCGPNEINHFYCADPPLLVLACSDTYVKETAMFVVAGSNLTCSLTIILISYIF
IFIAIMHIHSAEGRRKAFSICGSHLTAVTIFYGTLFCMYLRPPSEASVEQGKIVAVFYIFMSPMLNPLIYSLRNKDVKRAMRKVIQKKLFAK*
54 >lcl|XP_001489125.1|Plus1complement(37778612..37780702) NW_001867383 SLIT and NTRK-like family, member 1 SLITRK1 __SEG__ Chr17 {Equus caballus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSA
RNKPPANGLPCPGGCSCDHIPGSGLKINCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
55 >lcl|XP_001489162.2|Plus111668592..11669536 NW_001867368 olfactory receptor 5M10-like LOC100054453 __SEG__ Chr12 {Equus caballus} MSSQNHTVVMEFILLGLTDDPVLEKLLFVVFLVIYLITLAGNLCMIVLIRTNSHLQTPMYFFLSHLSFVDICYSSNVTPNMLYNFLSDQKIISYAGCFTQCLLFIALVIT
ELYILASMALDRYVAIYSPLHYSTRMSKNLCVSLVTVPYTFGFLNGLSQTLLTFHLSFCGSLEINHFYCADPPLLLLACSDTYVKKMALFVVAGFTLLSSLFIILLSYIF
IIAAILRIHSAEGRYKAFSTCGSHLTTVTIFYGTLFCMYLRPPSEKSVEESKTVAVFYTFLSPMLNPLIYSLRNKDVIQAIQQIKGNLFHKIAV*
56 >lcl|XP_001489173.3|Plus14647418..4648389 NW_001867393 melanocortin receptor 3 MC3R __SEG__ Chr22 {Equus caballus} MNASCCLLSAQPTLPNSSEHLAASSFSNQSSSGFCEQVFIKPEVFLALGIISLMENILVILAVVKNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVNSNYLTFED
RFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALALIVAIWVCCGICGVVFIIYSESKMVIVCLITMFFAMLLLMGTLYVHMFLFARLHVKR
IAALPPADGAAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLILIITCPRNPYCVCYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFKEILCSCHGMNLG*
57 >lcl|XP_001489184.2|Plus111684763..11685701 NW_001867368 olfactory receptor 1030-like LOC100054498 __SEG__ Chr12 {Equus caballus} MLKKNYTAVTEFILLGLTDRAELQPVLFVIFLVIYLITVIGNVSMILLIRSDPKLHTPMYFFLSHLSFVDLCYATSVTPQMLINFLSKRKSISFTGCFIQFHFFIALGIT
DYYMLTVMAYDRYMAICKPLSYSSKMSRCVCFSLVATPYIYGFANGLAQTILMLRLSFCGPNEINHFYCADPPLLVLACSDTYVKETAMFVVAGSTLTCSLTIILISYIF
IFTAILRMHSAEGRHKAFSTCGSHLTAVTIFYGTLFCMYLSPPSEASVEQGKIVAVFYIFVSPMLSPFIYSLRNKYVNRAMRKVIQKKLFAK*
58 >lcl|XP_001489201.2|Plus111697055..11697993 NW_001867368 olfactory receptor 1030-like LOC100054541 __SEG__ Chr12 {Equus caballus} MIRRNSTLVTEFVLLGLTDRPELQPILFTLFLAIYLITVGGNLGMLVLIRVDSRLHTPMYFFLASLSCLDLCYSTNVTPKMLVNFLSEKKTISYVACLVQCYFFIPMVIT
EYYMLAVMAYDRYMAICNPLLYSSKMSKGVCIRVIAGPYVYGFLSGLLETMWTYRLIFCGPSIINHFYCADPPLIRLFCSDTFIKETSMFVVAGFNLSNSLLIILISYIF
ILFAILRMHSAEGRHKAFSTCGSHLLSVTVFYGTLFCMYVRPPTDKSVEQSKIIAVFYTFVSPMLNPIIYSLRNKDVKQAFQKLIRKNVHLK*
59 >lcl|XP_001489216.2|Plus113273826..13274776 NW_001867424 olfactory receptor 10A7-like isoform 1 LOC100054585 __SEG__ Chr6 {Equus caballus} MICENNTRVTEFVLLGFTNNPEMQVSLFVLFLLVYTATLFGNFLIVSVTSVDPALHTPMYFFLRNLSLLEVCFTLVMVPKMLVDLVSPRKIISFVACGTQMYFFFFFGSS
ECFLLSMMAYDRFVAICNPLQYSVIMNRSLCWWMAIVSWMSGIPVSMLQTAWMMALPFCGPNTIDHFFCDGPPVLKLVTKDTTTYEMQALASTLLFIMFPFSLILVSYTR
IITTILRMPSATGRQKAFSTCSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTVITPMLNPIIYSLRNNEVKGAVKRTISRKVLQKLDLF*
60 >lcl|XP_001489229.3|Plus195197579..95198781 NW_001867387 LOW QUALITY PROTEIN: leukotriene B4 receptor 1-like LOC100051017 __SEG__ Chr1 {Equus caballus} MATNITSPVTPSSVSGMVIPLLAIILLSVALAVGLPGNGFVVWSILVKMRKRSVTALLVLNLAVADLAVVLTAPFFLHFLARGTWIFGSAACCLFHYVCGVSMYASVLLI
TAMSLDRSLAVALPFVSQKIRTKRIAWRLLAGLWVVSFLLATPVIVYRKVTSGRNNRTLICFPVYPSEGHRAFHLLFEAITGFLLPFLVVVASYSDIGRRLQARRFRRSR
RTGRLVVLIILTFAAFWLPYHVVNLADAGRVLAGKASGSGLVGHRLFLARQVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKMLEGTGSEMSSTRRGGTLNLTVKG
APTSPEPAPSESLTLSTNPLE*SEPKWAWGYGDGGMPPCQPDPISVPQEENSCWGWSGRRGGGEGRVRAE*
61 >lcl|XP_001489230.2|Plus1<13287001..13287789 NW_001867424 olfactory receptor 6C4-like LOC100054626 __SEG__ Chr6 {Equus caballus} RNFSILEISFTSVFVPKMLVNIGTGDKTISFAGCFTQYFFAILLGATEFYLLAAMSYDRYVAICKPLHYTTIMSRRLCIQLVLCCWFSGFLVVIVPHTMTLQLPFCASNI
INHYCCDYIILLHLACSDTHFIEVIEFAAAAATLIFTLMLVILSYVYIIRTILRIPSVQQRKKAFSTCFSHMIVVSLSYGSCIFMYINPSVKDAATFNKEVAVLNTSVAP
LLNPFIYTLRNKQVKIAFKDMVRKIMIFFKKVKLSEIKYYNK*
62 >lcl|XP_001489241.1|Plus1complement(60349051..60350052) NW_001867381 p2Y purinoceptor 14-like LOC100050149 __SEG__ Chr16 {Equus caballus} MNATTTGPCSWDPLITQQVIPALYLVVFVVGILLNGVSAWVFCYVPSSKSFIIYLKNIVVADFLMSLTFPFKILSESGLGPRQLSVFVCKFSAVFFYVNMYVGIVFFGLI
SFDRYYKIVKPLLTSVMQSVNFSKLLSVMVWVLTLFLAVPNSILTKWSVRDVRGIKCMDLKNTLGQKWHKASNYIFVGIFWMVFLLLIVFYTAITRKIFKSHLKSRKNSI
WVKKKSSRNIFSIMFVFVVCFVPYHIARIPYTQSQTEAHYSCRSKEILHHVKEFTLLLSAANVCLDPVIYFFLCQPFREILCKKLHVPLKAQQDSDACKTKTGNTTQEST
DIL*
63 >lcl|XP_001489250.1|Plus1complement(1187087..1189225) NW_001867416 leucine-rich repeat neuronal protein 2 LRRN2 __SEG__ Chr5 {Equus caballus} MRLFVAPLLLAWVAGATAAVPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFLTAVPPALPVGTQTLLLQSNSIVRVDQSELAYLANLTELDLSQNSFSDARD
CDLRALPQLLSLHLEENQLSRLEDHSFAGLASLQELYLNHNQLYRIAPRAFAGLSNLLRLHLNSNLLRAVDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVL
AGMSLQEISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFIHPRA
FHHLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIRCDCVIRWANATGTHVRFIEPQSTLCAEPPDLQRLPVREVPFREMTDRCLPLISPRSFPSSLQVVSGES
LMLHCRALAEPEPEIYWVTPAGVRLTAARAGRKYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRAPLQPGRGKGWRLELRVQETHPYHILLAWVPPPN
TVSTNLTWSSTSSLRGQGATALARLPRGTHSYNITRLHQATEYWACLQVAFADAHTQLACVWTRTKEAAPCHRALGDRPGLIAILALAVLLLAAGLAAHLGTGQPRQGVR
GRPLLPAWAFWGWSAPSVRVVSAPLVLPWNPGRRLSRSSEGETLSPPLLQNS*
64 >lcl|XP_001489256.3|Plus113312139..13313080 NW_001867424 olfactory receptor 6C1-like LOC100054671 __SEG__ Chr6 {Equus caballus} MRNQTEITEFILLGLSDDPKLQVVILVFLLITYTLSITGNLTIITLTLLDSHLQTPMYFFLRNFSLLEISFTTVSIPKFLGTIISGDKAITFNDCIVQLFFFILLGVTEF
YLLAAMSYDRYIAICKPLHYMTIMNRRVCTLLVFSSYLVSFLIIFPALMLLLNLDYCKSNIIDHFTCDYFPLLQLSCSDTKFLEIMGFSCAVFTLMFTLALIFLSYMYIV
RTILKIPSPSQRTKAFSTCSSHMIVISISYGSCIFMYIKPSAKDRVSLSKGVAVLNISVAPMLNPFIYSLRNQQVKRAFLGMVRKTIFHKQMK*
65 >lcl|XP_001489273.3|Plus138718051..38719109 NW_001867395 b1 bradykinin receptor-like LOC100054699 __SEG__ Chr24 {Equus caballus} MASRTLLEFQSSNQSQLLPPNATSCDNLQEAWDLLHRVLPAFIIAICFCGLGGNLFVLSVFLLPRRRLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFHWPFGALLCR
VVNGVIKANLFISIFLVVAISQDRYCVLVHPMASRRRRRRRQAQAICVLIWVMGGLLSVPTFLLRSIKTVPELNISACVLGLPHEAWNFARIVELNVLAFLLPLAAIVFF
NYHILASLRVQTEVSRTRHGGPTDGKTTVLILVLVATFLVCWTPYHLFAFLEFLFQVRAVRGCFWENFIDLGLQCANFFAFINSCLNPVIYVFVGQLFRTKVWELYKQCT
PRSLTPMSSSRRKEILQLFWRN*
66 >lcl|XP_001489288.2|Plus111745089..11746021 NW_001867368 olfactory receptor 5M9-like LOC100054722 __SEG__ Chr12 {Equus caballus} MPNFTDVTQFILLGLTSHQKLKVLFFVVFLLVYMITLLGNIGMIILISISPQLQSPMYFFLSHLSFVDVCLSSNVTPKMLENLLSETKTISYVGCLVQCYFFIALVHVEV
YILAAMAFDRYMAICKPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADPPLIKIACGGVHIKEYTMIVIAGISLTYSLSVLLTSYALIV
IAVLRMPSADGRRKAFSTCGSHLTAVSLFYGTLIFMYLRRPTEDSVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVNKAIIKANLGQ*
67 >lcl|XP_001489309.2|Plus113335042..13335980 NW_001867424 olfactory receptor 6C74-like LOC100054771 __SEG__ Chr6 {Equus caballus} MRNHTTVRTFILLGLTDDLQLQVVIFLLLFFTYMLSVTENLTIIALTLLDSHLKMPMYFFLRNFSFLEILFTTVCIPKFLVSMATGDKTISYNSCAAQMFFTILLGATEF
FLLAAMSYDRYVAICKPLHYTTIMNSRLCSLLVFASWLAGFIIIFPPLLVGLQLDFCAVNTVDHFFCDVFPILQLSCTDTDLVELMALLSAILTLLVTLVLVILSYTNII
KAILKIPSSQQRKKAFSTCSSHMVVVSISYGSCIFMYVKPSAKGRVSLNKGVALLSTSVAPMLNPFIYTLRNKQVKDAFKHMIKRIEFFSLK*
68 >lcl|XP_001489316.1|Plus1complement(60334389..60335348) NW_001867381 probable G-protein coupled receptor 171-like LOC100050352 __SEG__ Chr16 {Equus caballus} MTNSSTFCPVYRDLEPFTYFFYLVFLVGIIGSCFAAWAFTQKNTNRRCISIYLVNLLTADVLLTLALPVKIVVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSI
DRCLQLTHSYKVYRIQEPGFAKMISTVVWLMVLLIMVPNMVIPIKDIEEKPNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRKLYRHKDNEDYPNVKR
ALINILLVTAAYIICFVPYHIVRIPYTLSQTEVISDCPTRIALFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVAETFTSRKETKAQKGKSSCENDA*
69 >lcl|XP_001489339.2|Plus113356525..13357478 NW_001867424 olfactory receptor 6C1-like LOC100054816 __SEG__ Chr6 {Equus caballus} MRNHTEITEFILLGLSDDPKLQVVIFVFLLISYMLSITGNLTIITLTLLDSHLQTPMYFFLRNFSLLEVSFTTVSIPKFLSTIISGDKAISFNDCMAQLFFLILLGVTEF
YLLAVMSYDRYIAICKLLHYMIIMNRRVCIFLVFASWLASFLFMFPALMLFLNLDYCRSNIIDHFTCDYFPLLQLSCSDTKFLEIMGFSYAVFILLFTLALIILSYVYII
GTISRIPSTSQRTKAFSTCSSHMIVISMSYGCCIFVYIKLSANDRVSLSKGVAVLNISVAPMLNPFIYSLRNQQVKRALMDMARKTLFFSSKRTDTV*
70 >lcl|XP_001489370.2|Plus1complement(40776..41717) NW_001867391 olfactory receptor 7A17-like LOC100054881 __SEG__ Chr21 {Equus caballus} MEPGNDTQISEFLLLGFSEEPELQPLIFGLFLSMYLITVFGNLLIILATISDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTESKAITYEDCITQIYFFTLSAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNLRLCGLLVLVSWIMCILNSLLQSLMVLQLSFCTNLEIPHFFCELNQMVQLACSDTFINNMVMYFAAVLMGGGPFAGILYSYSK
IVSCIRGISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAATHSSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRALKAFFVKETTKLS*
71 >lcl|XP_001489406.2|Plus113393177..13394115 NW_001867424 olfactory receptor 6C65-like LOC100054952 __SEG__ Chr6 {Equus caballus} MPNKTSVREFILLGLTDDPELQAVTCFFMLFTYLLSVSGNMTIIMLTLSNVCLKTPMYFFLRNFSFLEISFTTVCIPRFLISIAVGDKTISYNACMTQVFFLILLGSTEF
FLLAVMSYDRYVAICKPLHYTTIMSNKVCIRLVISSWLAGFLTIFPPVIMGLQLDFCDSNIIDHFTCDSSPMLLIACTDTAFLELMAFFLAVFTLMVTLALVILSYTLIL
RTILKFPSAQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALSKGVAVLNTSVAPMLNPFIYTLRNQQVKQALREFIKKVLLSNKN*
72 >lcl|XP_001489426.3|Plus113408817..13409755 NW_001867424 olfactory receptor 6C2-like LOC100054995 __SEG__ Chr6 {Equus caballus} MKNHTAITTFILLGLTEDPQLQVLVFIFLFLTYVMSITGNLTIIALTLMDSHLKTPMYFFLRNFSILEISFTTVYIPRFLYSLSTGDNTITYNACGSQIFFIGLFGATEF
FLLAAMSYDRYVAICKPLHYMAIMSNRVCAILVLCCWVSGLVIIITPLGMGFQLEFCVSNAIDHFGCDAAPLLKISCSDTWFIEQTIIICAVLTFVITLIGVILSYVFII
RTILRFPSAQQRKKAFFTCSSHMTVVSITYGSCIFIYIKPSAKEGVDVNKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFSDTIERIACLAHQ*
73 >lcl|XP_001489478.2|Plus1complement(13444501..13445436) NW_001867424 olfactory receptor 6C2-like LOC100055082 __SEG__ Chr6 {Equus caballus} MRNHTATTFILLGLTDDPQLQGLLLIFLFFTYLLSVTGNLTIVSLTLVDSNLKTPMYFFLQNFSCLEILFTSTCVPRYLYNLSTGDKTITYCACAIQAFFADLFGVTEFF
LLATMSYDRYIAICQPLHYTTIMSSTVCKTFILCCWMAGLLIILPPFSLSQNLEFCDSSVIDGFLCDVSPFLEISCSDTWVVEQMVIVCAVLTFITTLLCVVLSYICIIK
TIIRFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYVKPSAKESAAINKGVAVLTTSIAPVLNPFIYTLRNKQVKQAFNVSIKRIMLSSKK*
74 >lcl|XP_001489498.2|Plus1complement(7684550..7685515) NW_001867408 probable G-protein coupled receptor 31-like LOC100055116 __SEG__ Chr31 {Equus caballus} MPLARSVMPLANCSVHSAAVEGSLAVLLVLECGLGLVGNAIALWTFCFRLKVWKPYAVYLFNLVIADLLLTLCLPFHAASYLTHKTWSLGLSACQTLIFLRALSRGVGVA
FLTAVALDRYLRVVHPRLKVNLLSLRAAWGISVLVWLLMAALSHQSLFISEAACPTFEPQGDFSFSVIWQKVLFLLQIILPFGLILFCNARIIRILQKRLRDPDKQPKLQ
RAQALVAVVVVLFALCFLPSFVARILLTIFRRSDSCRVRRALEHLSDVTSSLTYLQSVLNPVVYCFSNPTFRLSYRKVFYTLRGRGQEAEATGCDLKDSYS*
75 >lcl|XP_001489510.2|Plus110799511..10800449 NW_001867368 olfactory receptor 1052-like isoform 1 LOC100050265 __SEG__ Chr12 {Equus caballus} MASWNHTSVKEFLLVGLTENPNLQIPLFLLFMLIYFITLVGNWGMIILIWLSAQLRTPMYFFLSNLSFCDICYSTVFAPKMLANFLSKHKSSTFSDCVLQSFFFAVYVTT
EGIVLSMMAYDRYVAIANPLLYTVIMTQRLCIQMVLASYLGGIVNSLTHTIGLLKLDFCGPNIVNHYFCDIPPLLKLSCSDTYNNEILLLIFSGAVVVFTLTIIMVSYIH
IIIAIQRIRSAEGRRKAFSTCASHLTAVILLYGSVTFSYVQPSSQSFLEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKDAAKRSICWKKIPT*
76 >lcl|XP_001489533.3|Plus1complement(13456178..13457113) NW_001867424 olfactory receptor 6C2-like LOC100055176 __SEG__ Chr6 {Equus caballus} MRNQTITSFILLGLTDDTQLQVLIFMFLFLAYILSITGNLIIISLTLVDSHLKTPMYFFLQNFSLLEIAFTSACIPRYLYNIATGDRSITYNICVIQVFFIDVFGVTEFL
LLAVMSYDRYVAICKPLHYVTIMNNRVCRSLVLCCWTAGVLIILPPLIMIVNLEFCDSNVIDYFFCDSSPILKISCSDTWLLEQMVIVCAVLAFITTLLCVVMSYMYIVK
TILRFPLSQQRKRAFSTCSSHMIVVSITYGSCIFIYVKPSAKESVTINKSVTVLMTSIAPMLNPFIYTLRNKQVRQAFNDSFKRIALPSKK*
77 >lcl|XP_001489563.1|Plus1complement(4590101..4591138) NW_001867383 cysteinyl leukotriene receptor 2-like LOC100056882 __SEG__ Chr17 {Equus caballus} MERKLMSSVPSVSSSETEPNGTFSSNDSHRNCTIENFKREFYPIIYLIIFVWGALGNGFSIYVFLQPYKKCTSVNVFMLNLAISDLLFTSTLPFRADYYLRGSNWIFGDL
ACRIMSYSLYVNMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRSAWILCGIIWIFIMASSAVLLKNGSEQDGNVTLCLELNLNKVIKLQALNYLALVVGFLLPFCTLSI
CYLLIIRALLMVKVSETGLRVSHRKALTTIIISLVIFLLCFLPYHVLRTLHLVMWEVGTCIDWLHKAVVITLALAATNSCFNPLLYYFAGENFKDRLRSAVRKCHLQKIK
CSFPVCVWLKKETRV*
78 >lcl|XP_001489581.2|Plus1complement(13487272..13488207) NW_001867424 olfactory receptor 6C2-like LOC100055272 __SEG__ Chr6 {Equus caballus} MRNHTITTFILLGLTDDPQLKVVIFIFLFLSYVLSVTGNLTIISLTFVDSHLKTAMYFFLQNFSFLEISFTSACIPKYLYSIATGDKKITYDNCAIQIFFTDLFAVTEFF
LLVTISYDRYVAICKPLHYVTIMNHRVCRRLILWCWTAGLLIILPPLSLGLTLKFCDSNVIDHFVCDASPLLKFACSETWLIEQMVIICAVLTFIMTLICVILSYMYIIK
TILQFPSAQQRKKAFSTCSSHMIVVSITYGSCIFMYVKPSAEESAAINKGMAVLITSIAPMLNPFIYSLRNKQVKQAFNDLIKRTALFLKK*
79 >lcl|XP_001489623.2|Plus1complement(13519552..13520490) NW_001867424 olfactory receptor 6C2-like LOC100055352 __SEG__ Chr6 {Equus caballus} MGNHTAITTFILLGLTEDARLQVLIFIFLFLTYVLSITGNLTIIILTLMDSHLRTPMYFFLQNFSILEISFTTVCIPRFLYSLSTGDNTITYNACASQIFFIGLFGATEF
FLLAAMSYDRYVAICKPLHYMTIMNNRVCTILVLCCWVSGLMIIITPLGMGLQLEFCDSNTIDHFGCDAAPLFKISCSDTWFIEQTVIICAVLTFIITLVGVILSYMIII
RTILKFPSTSQRKRAFSTCSSHMIVVSITYGSCIFIYMKPSAKEEVDINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFNNTIKKIAFLLHK*
80 >lcl|XP_001489625.2|Plus1complement(11920271..11921284) NW_001867368 olfactory receptor 8K3-like LOC100055353 __SEG__ Chr12 {Equus caballus} MEKSNLTVLNEFILTGITDHPELQAPLFVLFLMIYMISVVGNLGMVILTKMDSKLQTPMYFFLRHLAFTDLGYSTTVGPKMLVNFIMDQNSISYYFCATQLAFFLMFINS
ELFILSAMSYDRCVAICDPLLYTVIMSQRVCRVLVAMPYLYSTFASLLVTIKIFNLSFCGYNTVHHFYCDCLPLLSLLCSDTWEIEMIILILAGFDLISLPVVLVSYLLI
LRAILRMNSTEGRRKAFSTCGSHLTVVTVFYGTLAFMYVQPKSIHSFDTDKVASIFYTLVIPMLNPLIYSLRNTDVKYSLHKVLKKICNTFSYSEWSKLFYDFKLALCAF
RGKSKHK*
81 >lcl|XP_001489626.2|Plus1complement(12231883..12232878) NW_001867370 mas-related G-protein coupled receptor member X4-like LOC100055356 __SEG__ Chr12 {Equus caballus} MAHEPRNDPTGVSPRPQPWPSHPNNGSELPTAANATAHGTSVDGAHAFSAYENTLFLGIVLVSLCGLVGNGMVIWLLGFRIKRNPFSVYILTLAGADFAFLFCKSVRFLL
LVLNRSVAALNLLIRGVTFSSYLGGLSLLMAVSVERCLSVLFPIWYRCRRPAQLSAIACALIWGLSLCPGISVLLCVHFVAFSCDVVNLVYYGMFLLTFLVLCVSSLVLL
IRVQCFSMRRQPARLSRIVLLTVLAFLVLGLPLGAGLLAHRLSPSFPYFDILLPILHLLSTLNSGVNPLIYFFMGRQRQQRGRKPLREVLQSALTEDVELSTEEPPSPDD
T*
82 >lcl|XP_001489664.3|Plus1complement(13539082..13540032) NW_001867424 olfactory receptor 6C2-like LOC100055434 __SEG__ Chr6 {Equus caballus} MRNHTVITTFILLGLTEDPLLQILIFIFLFLTYMLSVTGNLIIITLTLVDSHLKTPMYFFLRNFSFLEVSFTTVCIPRFLYSISTGENTITYNACASQIFFVIFFGATEF
FLLAAMSYDRYVAICKPLHYMTIMNNRVCTLFVVCCWVSGLMIILPPLSLGLQLEFCDSNAIDHFSCDAAPLLKISCSDTWVIEQMIILVAVFALIITLVCVLLSYTYII
KTILGFPSVQQRRKAFSTCSSHMIVVSIAYGSCIFIYVKPSAKDQVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFYDSIKRITFLSKKSKFC*
83 >lcl|XP_001489666.2|Plus1complement(11946068..11947009) NW_001867368 olfactory receptor 8K3-like LOC100055435 __SEG__ Chr12 {Equus caballus} MDKQNQTVLKEFILMGITDLPELQAPLFGLFLTIYVISVVGNLGMVILTKMDSRLQTPMYFFLRHVALIDLGYSTAVGPKMLASFVVTQNTILYIWCATQLSLFILFIIS
ELFILSAMAYDRYVAICNPLLYTVIMSQMVCWVLVAVPYVYSAFISMITTIKIFISSFCGFNVISYFYCDSLPLLSLLCSSTHEIELIILIFSVFNLVSSLLIVLVSYML
ILKAILRMNSAQGRRKAFSTCGSHLTVVVVLYVTLSFMYMQPKSSHSFDTDKIASVFYTVVIPMLNPMIYSLRNKEVKGALHRLWKNMRKLPI*
84 >lcl|XP_001489685.2|Plus1complement(13559237..13560178) NW_001867424 olfactory receptor 6C76-like LOC100055477 __SEG__ Chr6 {Equus caballus} MKNTTSVTDFILLGLTDNPELQAAIFLFLFLTYVLSVTGNLSIIILTLLDSHLKTPMYFFLRNFSFLEISFTSVCNPRFLISILTGDKSISYNACAAQLFFFILLGSTEF
FLLASMSYDRYVAICKPLHYTTIMSNKICYQLVVSSWLAGFLVIFPPLTMGLQLDFCDSNVIDHFTCDSAPLLQISCTDTSTLELMSFVLAVLTLMSTLTLVILSYSYIL
RTILRIPSAQQRKKAFSTCSSHVIVVSISYGSCIFMYVKTSAKEGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAFKDAVRKILFAKTMI*
85 >lcl|XP_001489686.2|Plus1complement(11955523..11956452) NW_001867368 olfactory receptor 5T2-like LOC100055478 __SEG__ Chr12 {Equus caballus} MKNVTEVTIFVLKGFTENFELQIILFFLFLAIYLLTLIGNLGLIMLVIGDSRLHNPMYYFLSVLSSVDACYSSVITPNMLVDFMSNNKVISFTGCASQMFLAITFGTTEC
FLLAAMAYDRYVAIYNPLLYLLRMSPRVYVPLIIASYVGGILHATLHTVATFSLSFCGTNEIRHIFCDIAPHLAISCSDTHTNHLLVFYFVGFIEIVTILIVLVSYGFIF
LVILRMHSAEGRKKVFSTCGSHLTGVSVFHGTVLFMYVRPSSSYALDHDMIVSIFYTIVIPMLNPIIYSLRNRDVKEAIQKMFKKIVYQ*
86 >lcl|XP_001489706.1|Plus1complement(4872937..4873935) NW_001867431 melanocortin receptor 4-like LOC100050469 __SEG__ Chr8 {Equus caballus} MDSTHRHGMHTSLHFWNRSTYGLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNST
DTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMAR
LHIKRIAVLPGTGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSS
RY*
87 >lcl|XP_001489721.2|Plus1612473..613411 NW_001867391 olfactory receptor 2T27-like LOC100055538 __SEG__ Chr21 {Equus caballus} MAKRNGTATTDFILLGLFPEFQYASFLVYLILLVYLIALIGNSILIFLIWMNSYLHTPMYFLLSQLSLIDLFYISSSVPNMVINHFLGKHSISRIGCGVQMFFCLTLGGA
ECLLLTLMSYDRFVAVCNPLHYAIIVNPKVCLLMTVASWTGGALNSLIQTIYTMHFPVCGLKEINHFFCEMPAILKLSCEDTSDYEMVVFVVSIVFILIPFTLITASYIH
IFLTVLRMNSPEGRNKALATCSAHLTVVSFYLGPGIVVYMTPGSSHTTTLDQGLSMFYTILTPTLNPLIYSLRNKEVVRALKKVLRKNLISK*
88 >lcl|XP_001489729.1|Plus1complement(6171654..6173219) NW_001867424 amphoterin-induced protein 2 AMIGO2 __SEG__ Chr6 {Equus caballus} MSLRLHTLPTLPGVVRPGCRELLCWLVITVTVSRGASGVCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDAEWIPVSFVKLNTLIIRHNNITSISTG
TFSTTPNLKCLDLSSNKLKTVKSAVFQELKVLEVLLLFNNHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSLPMHHINLVSGKQLR
GIYLHGNPFVCDCSLYSLLIFWYRRHFSSVMDFKNDYTCRLWSDSRHSQQVLLLQDSFLNCSDSIINGSFRALGLIHEAQVGERLVVHCDSKTSSANTDFMWVGPDNRLL
EPDKEMENFHVFPNGTLVIESPRFEDAGVYSCIAMNRQRLLNETVDVTINVSNFTVNRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCRPKRQKNMLNQSNAH
SSILNPGPAGDARADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFASETVIAEGILKSTRVKSDSDSVNSVFSDTPFVAST*
89 >lcl|XP_001489736.3|Plus113585902..13586858 NW_001867424 olfactory receptor 6C75-like LOC100055559 __SEG__ Chr6 {Equus caballus} MINDTMVTTFILLGLTDDPNWQIIIFFFLLLTYLLSVTGNLTIILLTLLHSHLNTPMYFFLQNFSFLELSLTSVCIPRFLVSIVTMDKTISYDACVTQLFFTIFLGVSEF
FLLAAMSYDRYVAICKPLHYAAIISNRVCTQLVVTSWLAGLLTVSPGLIMGLRLEFCDANAIDHFFCDYSPVLKLSCTDTQVIELLSFILATVTLLITLALVLLSYANIM
RTILKIPCAQQKKAFSTCSSHMIVVSISYGSCIFMYIKPSAEERVALNKGVAVLTTSVAPVLNPFIYTLRNKQVKQALKDTVKKMHLYYFRILALALI*
90 >lcl|XP_001489761.2|Plus1complement(13617547..13618482) NW_001867424 olfactory receptor 6C3-like LOC100055600 __SEG__ Chr6 {Equus caballus} MNHTVITEFILLGLSDDPDLQIVIFLFLFITYVLSVTGNLAIITLTLVDSHLQTPMYFFLRNFSFLEISFTTVCIPRFLGAIITRDKTISYNNCAAQLFFFIFMGVTEFY
ILTAMSYDRYVAICKPLHYTTIMNRKLCSLLVLCAWLGGFLTIFPPLMLLLQCDYCASNVIDHFACDYFPLLQLSCSDTWLLEVIGFYFALVTLLITLALVVLSYMYIIR
TILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPTAKEKASLTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKDVVHKVAFSATK*
91 >lcl|XP_001489785.2|Plus1complement(13627133..13628089) NW_001867424 olfactory receptor 6C1-like LOC100055645 __SEG__ Chr6 {Equus caballus} MRNQTEITGFVLLGLSDDPKLQVVIFVFLLISYMLNITGNLTIITLTLLDSHLQTPMYFFLRNFSLLEVTFTSVSIPKFLSTIISGDKSISFNNCMVQLFFLILLGVTEF
YLLAAMSYDRYIAICKPLHYMTIMNRRVCTLLVFASWLASFLIIFPSLMLFIQLDYCKSNVIDHFTCDYFPLLHLSCSDTKLLETMGFSFAVFTLMFTLALIFLSYIYII
RTILRIPSTSQRTKAFSTCSSHMIVISISYGSCIFMYINPSAKDRVSLSKGVAVLNTSVAPMLNPFIYSLRNQQVKRAFVDMARKTALFTNNSKHVVS*
92 >lcl|XP_001489807.2|Plus12415552..2416499 NW_001867419 olfactory receptor 10T2-like LOC100055686 __SEG__ Chr5 {Equus caballus} MKGFNRTTVVSQFILVGFSSLGELQLLLFVIFLLLYLTILVANATIMTVICLSRTLHTPMYGFLFILSFSESSYTFVIIPQLLVHLLSATKTISFTACATQLFFFLGFAC
TNCFLIAVMGYDRYVAICHPLRYTLIMNKRLGLGLVSLSGVTGFFIALVATNLICDMPFCGPNMVNHYFCDMAPVIKLACTDTHVKELALFSLSILVIMMPFLLILISYG
FIVNTILKIPSTEGKRKSFATCASHLTVVFVHYGCASIIYLRPKPKSASDKDQLVAVTYTVVTPLLNPLVYSLRNQEVKTALKRVVGMPVVTKLI*
93 >lcl|XP_001489808.2|Plus1complement(13635159..13636097) NW_001867424 olfactory receptor 6C3-like LOC100055688 __SEG__ Chr6 {Equus caballus} MRNHTMITEFVLLGISDNPELQVVIFTVLFMAYVLSVTGNLTITILTWIDCRLKTPMYYFLRNFSFLEITFTGVSIPRFLGAIITRIKTISYNNCLAQLFFFISMGVSEF
FLLTAMSYDRYIAICKPLRYATIMNKKICTLLVLCSWLGGFLTIFPPLMLILQLDFCASNVIDHFSCDYFPILELSCSDTWHLEMIGFYFAFVTLLFTLSLVILSYMCII
STILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYVKPSAKERASLTKGVAILNTSIAPMLNPFIYTLRNQQVKQAFKNLVHKVVFSRNK*
94 >lcl|XP_001489813.3|Plus133782180..33783325 NW_001877040 LOW QUALITY PROTEIN: probable G-protein coupled receptor 34 GPR34 __SEG__ ChrX {Equus caballus} MRSHTVTMATTSVSSWPCSSQGVHFITNHSSQVPRNSSGASNSTACLMDEKLLSSVLTTFYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFR
IMYHLNQNKWTLGVVLCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWTVALAGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFN
YVLVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTVCFVPYHAFRFVYISSQLNVSSCYWKEIVHKTNEIMLVFSSFNSCLDPVMYFLM
SSNIRKIMCQLLSRRFQGEASRSESTSEFKPGYSLHDTSAAAKIQATS*ST*
95 >lcl|XP_001489822.2|Plus1complement(11055030..11055959) NW_001867414 olfactory receptor 9A4-like LOC100055719 __SEG__ Chr4 {Equus caballus} MMGNRSSATEFCLLGFPGSQELHHLLFAIFFFFYSVTLMGNTIIIVIVCVDKRLHSPMYFFLGHLSALEILVTSIIVPVMLWGLLLPGMQTLSLTACVAQLFLYLAAGTT
EFVLVGAMAVDRYVAVCNPLRYIIIMNSHTCIWVVIVSWVFGFLSEIWPVYATFQFTFCKSNLLDHYYCDRGQLLKLSCDDTLFTEFVLFLMAVVIIIGSLAPTVVSYTY
IISTILKIPSASGRRKAFSTCASHFTFVVIGYGSCLFLYVKPKQTQAAEYNKIASLLISVLTPFLNPFVFTLRNDKVKEALRDSMKRCC*
96 >lcl|XP_001489857.2|Plus1complement(2358727..2359668) NW_001867419 olfactory receptor 10K1-like LOC100055776 __SEG__ Chr5 {Equus caballus} MERVNETLVAEFVFLGFSSPARMQLLLFIVFLLLYLFTLGTNAIIISTIVLDRALHNPMYFFLAVLSYSETCYTFVIVPKMLADLLAQKKTITFLGCAIQMFSFLFLGCS
HSFLLAAMGYDRYMAICNPLQYTVLMGHGMCVGLVAAACACGFTVSLVTTSLVFYLPFHSSNQLHHFFCDISPVLKLASHHSRLSQLVIFMLGVCVLVIPLLLILVSYIH
IISAILKISTSAGRYKTFSTCASHLIVVTVHYGCASFIYLRPKSNYSSSQDILISVSYTILTPLFNPMIYSLRNKEFKSAFRRVMGQTSCLVN*
97 >lcl|XP_001489860.2|Plus112054588..12055526 NW_001867368 olfactory receptor 5W2-like LOC100055780 __SEG__ Chr12 {Equus caballus} MVVENCTVITDFIFLGLSDRQDVQQGLFVLFLLVYGITVIANLGMILLIKMDSSLHTPMYYFLSNLSFCDVCYSTTVSPKMLVDFLSEQKRIPYSFCAIQMYFWGVFADV
ECLMLAVMAYDRYVAICNPLLYTVAMSRRVCTQLVSIVYIEGLIDSTIFTCCIFQLSFCNSNIINHFFCDIPPLLALSTSDTTVNEIVLFTFSTCVVGCSIVTVLLSYIY
IITTILRMNSAEGRYKAFSTCASHLTAVAVFHGTLLFMYLRPSSSYSMHTDKMASVFYTVVIPMLNPLIYSLRNKDVKGALKKAISIKLSPG*
98 >lcl|XP_001489905.2|Plus12333243..2334184 NW_001867419 olfactory receptor 10R2-like LOC100055864 __SEG__ Chr5 {Equus caballus} MANSSCVTEFLLLGFSSFGEFQLVLFVVFLCLYLIILSGNITIISVIRLDHSLHTPMYFFLCVLSTSEIFYTIVILPKMLINLLSILRTLSFMSCATQMFFFLGFAVTNC
LLLGVMGYDRYAAICQPLYYPILMSWKVCGQLVAICIVSGFLISLVGTSLVFSLPFCDSNKINHYFCDISPVIRLACAETYINELIIFICGVLVLIVPLIFICISYGFIL
RTILKIPSAEGKRKAFSTCASHLIVVIVHYGCASFVYLRPSARYTSGKDRLVTVTYTIITPLLNPMVYSLRNKDVQLAIRKMIGKTGFPLKNL*
99 >lcl|XP_001489906.2|Plus1complement(12077246..12078178) NW_001867368 olfactory receptor 1020-like LOC100055867 __SEG__ Chr12 {Equus caballus} MELKNITVKAEFFLLGFSDHPELQSVLFAVFFFIYSVTLIWNLGMIFLITISSHLHIPMYFFLCILSFTDACSSSVITPKLLVDLVSNKKTISYNGCAAQFYFFCSFVDT
ESFLLAAMAYDRYIAICNPLLYTVIMSKRICCQLAIGAFLGGTLSAIIHTTNTFLLSFCSKEINHFFCDISPLFLLSCTDTYMHDIVLVIFASLVEAICLLTVLLSYVCI
IAAILKTGSAEGRRKGFSTCASHLTVVTIYHGTLIFIYLRPSTGHSLDMDKVTSVFYTLIIPMLNPLIYSLRNKDVKNALKKVIFQKSLS*
100 >lcl|XP_001489946.2|Plus12309994..2310935 NW_001867419 olfactory receptor 10K1-like LOC100055944 __SEG__ Chr5 {Equus caballus} MERANETLVREFVFLGFSSLARMQLLLFIVFLLLYLFTLGTNAIIISTIVLDRALHNPMYFFLAVLSCSETCYTFVIVPKMLVDLLAQKKTISFLGCAIQMFTFLFFGCS
HSFLLAAMGYDRYMAICNPLRYTVLMGHGLCVGLVAAACACGFIVAQIITSLIFHLPFHSSNQLHHFFCDISPVLKLASHHSLFSQLVIFMLGMFVLVIPLLLIMISYIH
IISALLKISTSAGRYKTFSTCASHLIVVTVHYGCASFIYLRPKSNYSSSQDILISVSHTILTPLFNPMIYSLRNKEFKSAIRRVVRQVSYPVK*
101 >lcl|XP_001489967.2|Plus1complement(13733217..13734155) NW_001867424 olfactory receptor 6C4-like LOC100055986 __SEG__ Chr6 {Equus caballus} MGNQTSVKEFILLGLTNDAELQAVLFLFPLLTYVLSVMGNLTIIILTLLDYRLQTPMYFFLRNFSILEISFTSVFVPKMRVNIGTGDKTISFAGCFTQYFFAILLGATEF
YLLAAMSYDRYVAICKPLHYTTVMSRRLCIQLVLCCWFSGFLVVIVPHIMTLQLPFCASNIINHYYCDYIILLHLACSDTHFIEVIEFAAAAATLIFTLMLVILSYVYII
RTILRIPSVQQRKKAFSTCFSHMIVVSLSYGSCIFMFANPSVKAAESFNKEVAVLNTSVAPLLNPFIYTLRNKQVKIAFKDMVRKIASFSRK*
102 >lcl|XP_001489985.1|Plus13729417..3731954 NW_001877048 SLIT and NTRK-like family, member 2 isoform 1 SLITRK2 __SEG__ ChrX {Equus caballus} MLSGVWFLSVLTVAGILRTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSTGDSSQRGSHADAHVQRLSPTMNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLYP
SMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTILSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRSANNL
DVSSFQLQYGSYNTETQDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYGNLEEKKEEPATLAYTISATELLEKQATPREPELLYQNIAERVKELPSAG
LVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
103 >lcl|XP_001489986.2|Plus12279575..2280516 NW_001867419 olfactory receptor 10K1-like LOC100056023 __SEG__ Chr5 {Equus caballus} MEQVNETLMREFVFLGFSSLARLQLLLFVVFLLLYLFTLGTNAIIISTIVLDRALHTPMYFFLAVLSCSETCYTFVIVPKMLTDLLAKKKTISFLGCTIQMFSFLFLGCS
HSFLLAVMGYDRYMAICNPLNYMVLMGHGVCVGLVAAACACGFTVSLVTTSLIFNLPFHSSNQLHHFFCDTSPVLKLASHHSHLSQLVLFMLALFALVIPLLLILVSYIR
IISAILKIPSSVERYKTFSTCASHLIVITVHYGCASFIYLRPKSNYSSSQDILISVSYTILTPLFNPMIYSLRNREFKTALRRLMGQTSCPVN*
104 >lcl|XP_001489987.2|Plus1complement(12157113..12158117) NW_001867368 olfactory receptor 5D13-like LOC100056026 __SEG__ Chr12 {Equus caballus} MLTCLLQNLLLVSLNQLSYFVHRNQENQSAEVTFILLGFSEYPGLQVPLFLLFLTIYTVTVLGNLGMIVIIKINPKLHTPMYFILSNLSFVDFCYSTVVTPKLLENLVVE
DRTISFTGCIMQFFFACIFVVTETFMLVVMAYDRFVAVCNPLLYTVVMSQKLCSLLVAAPYLWGTVCSLTLTYFLLELSFIGKNIINNFVCEHAAIISVSCSDPYVSQET
ILVSATFNEISSLLIILTSYVFIFITVRKVPSTEGRHKAFSTCASHLTAITIFHRTILFLYCVPNSKSSWLVVKVASVFYTVVMPMLNPLIYSFRNKDVKETLRKSISTK
LLCH*
105 >lcl|XP_001490017.1|Plus1complement(6329705..6330727) NW_001867388 probable G-protein coupled receptor 33-like LOC100056072 __SEG__ Chr1 {Equus caballus} MDLINSTDYLINVSTSVRNSTHFLAPASKMIVALLLFVSSIIGTITNGLYLWVLKFKMKKTVNTLLFFHLILSYFISILILPFLATSYLQDNRWIFGSAMCKAFTGILYT
GIYASVFFLSAISVDRYLLTLHPVWSQLHRTPRWASSIILGVWISASALSMPYVVFKETHDDHKGTVICRNKYTVSTNWESKKIQTLRKWIPVACFISRFLLSFLLPFFI
ITFCYQRVANKMKERSLFKSSKPFKVMMTAIISFFVCWMPYHVYQGLILTQTQSLLLQFTLILTVITTSFNTLFSPTLYLFVGENFKNVFKKSILALFESTFSEDSSTER
TQNLNSEAYI*
106 >lcl|XP_001490086.1|Plus1complement(11136596..11137117) NW_001867427 protein tyrosine phosphatase type IVA 1-like LOC100050543 __SEG__ Chr7 {Equus caballus} MAPMNCLAPVEVAYRNMRFLITHNPTSATLNRFIEELKEYGVTTIVRVCEATYDTAVVEKEGIQVLDWPFDDGSSPSNQIVDDWLSLVNSKFREEPGCCIAVHCVTGLGR
TPVLVALALIEGGMKNEDAVQFIRQKRRGAFNSKQLLYLEKYRSKMRLRFKDSWGHRNNCCVQ*
107 >lcl|XP_001490091.2|Plus12223343..2224296 NW_001867419 olfactory receptor 6P1-like LOC100056185 __SEG__ Chr5 {Equus caballus} MRNFSGGHIAEFVLVGFPTSPPLQLLLFALFLAIYLLTLLENALIISTIWLTPNLHRPMYFFLGHLSFLELWYINVTVPRFLGEFLTQEHRVSYVGCMTQLYFFIALACT
ECVLLAVMAYDRYLAICEPLRYSSLMSFSVATRLATSSWGSGFFSSMMKLLFISRLSYCGPNIINHFFCDISPLLNLTCSDKEQAELVDFLLALVMILLPLLVVVSSYAS
IIAAILRIPTAQGRHKAFSTCASHLAVVVIYYTSTLFTYARPQAMYTFNHNKIISVLYTIIVPFLNPAIYCLRNKEVKDALRKAVLHRCHSSGDIQD*
108 >lcl|XP_001490116.2|Plus1complement(13824194..13825129) NW_001867424 olfactory receptor 6C76-like LOC100056234 __SEG__ Chr6 {Equus caballus} MKNRTSVTEFILLGLTEDPELNVLIFILLFFTYILSVTGNLTIITLTLIDPNLKTPMYVFLRNFSFLEISFTTVSIPRFLVSIVTGDMTISYSSCMAQVFFFIFLGSTEF
FLLTTMSYDRYVAICKPLHYTTIMNSRVCNQLVISSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPMLLISCTDTAFLELMGFFLAVFTLMVTLTLVIFSYVFIL
KTVLRIPSAEQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGMALTKGIAVLNTSVAPMLNPFIYSLRNQQVKQSFKNLVKKCFSNKL*
109 >lcl|XP_001490117.2|Plus1complement(12244701..12245639) NW_001867368 olfactory receptor 4A15-like LOC100056235 __SEG__ Chr12 {Equus caballus} MRSTEEPVEQRTNVTEFVLLVLTQSLQGQKILFAVFLLIYVATMVGNLLIVLTVMVSPMLEVPMYFFLGYLSFMDAVYSTTVTPNLIIDLLCEKKTISFHACMSQLFIGH
LFGGAEILLLVVMACDRYVAICKPLHYLTIMSQRVCILLLLLAWIGGFLHAIVKLLLVYNLPFCGPNVIDHFICDMYPLLKLACTDTYIISLTVIANDGTICVVIFMLLL
ISYGVILHSLKNLSQEGRRKALTACGSHITVVVLFFVPCIFMYVRPPSTLPIDKSLTVFYTVITPMLNPLIYTLRNGGMKNAMKKLWSRQSK*
110 >lcl|XP_001490186.2|Plus1complement(13850417..13851355) NW_001867424 olfactory receptor 6C75-like LOC100056355 __SEG__ Chr6 {Equus caballus} MRNCTEITEFILLGLTNDPQWQVVLFTFLLVTYVLSVTGNLIIITLTLSDPHLQTPMYFFLRNFSFLEISFTSVCIPRFLVTIVTGNRTISYNGCVAQLFFFIFLGVTEF
YLLAAMSYDRYVAICKPLHYTTIMSSRVSILLVLSSWLAGFLIIFPPITLLLQLDFCASNIIDHFICDSSPVLQLSCTNTRFLELMAFFLAVVTLMVTLTLVILSYTYII
RTILRIPSISQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFKTLVQRVIFSSNK*
111 >lcl|XP_001490207.2|Plus1complement(13864914..13865852) NW_001867424 olfactory receptor 6C3-like LOC100056394 __SEG__ Chr6 {Equus caballus} MKNHTVPTEFILLGLSDDPELQVVIFLFLIITYILSITGNLAIITLTLVDSHLQTPMYFFLRNFSLLEISFTTVCIPRFLSTIITRDKTISYNNCTAQLFFFIFMGITEF
YLLTAMSYDRYVAICKPLHYTTIMNKRVCILLVFCAWLAGFLNIFPPVILFLQLDYCSSNVIDHFACDYFPLLQLSCSDTWLLEVVGFYSAIVILLFTLALIILSYMFII
RTILRLPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKEKASLTKGVAILNTSVAPMMNPFIYTLRNQQVKQAFKDTVKKVMFFSGK*
112 >lcl|XP_001490234.3|Plus1complement(<13892073..13892993) NW_001867424 olfactory receptor 6C70-like LOC100056438 __SEG__ Chr6 {Equus caballus} MKNQSREIEFILMGLTDDPPLQIVIFIFLLLNYMLSVIENLSIILLTLLHPHLKTPMYFFLRNFSFLEVSFTTICIPRFLVTIVSKNRVISYNGCASQLFFYLLLGVTEF
YLLAAMSFDRYVAICKPLHYPIIMNSKMCYQLVLSSWTAGFLITFPPLILGLKLEFCASRVIDHFICDTSPVLQISCTDTHFLELISFVSAVVTLVVTLLLVILSYTYII
KTILKIPSAQKRTRAFSTCSSHLIVVSLTYGSCIFIYMKPSAKERVTLSKGVAVIYTSVAPLLNPCIYTLRNQQVKQAFKDILLKIS
113 >lcl|XP_001490248.2|Plus1complement(39426170..39428692) NW_001867383 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr17 {Equus caballus} MKLWTHLFFSCLLACISSQSQSPKSSAGGSCDSLCNCEEKDGTMLINCEEKGIQKLSQISVPPSRHFHLNLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
ACNCDLIQLKIWLENMPPQCVIGDVVCNSPEFLKGSILSRLKTESICPTPPEFEEHEDPSGSLHLTVTSSISGSRMSTKTTSLLKPPTKAPGLIPYITKPSTQLPGPYCP
IPCNCKVLSPSGLLIHCQERNIESLSDLKPPPQNPRKLILAGNIIHTLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSGGMFLGLHSLEYL
YLEYNAVKEILPGTFSPMPKLKVLYLNNNLLQVLPPHIFSGVPLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDVLCTSPE
HLDRKELKALNSELLCPGLVNNPSLPTQTSYIIVSTPTATTTADTILRSLSDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQAEEQMRDNSPVHLQYSMY
GHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLERENHSPLTGSNRKYKTTDQSTEFLTFQDASSLYRNILEKERELQQLGI
TEYLRKNIAQLQPDVEVQYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
114 >lcl|XP_001490259.1|Plus1complement(2148853..2151369) NW_001877048 SLIT and NTRK-like family, member 4 isoform 1 SLITRK4 __SEG__ ChrX {Equus caballus} MFLWLFLILSALISSTNADSDITVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPSGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELMPKPLNAKKLHVNGNSIKDVDIADFTEFEGLDLLHLGSNQITAIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVIMRNVTDKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQQDKKNKKSLIGGNHSKIVVEQRKSSEYFELKAKLQNSPDYLQVLEEQTALNKI*
115 >lcl|XP_001490282.3|Plus1complement(2063201..2064142) NW_001867419 olfactory receptor 10Z1-like LOC100056527 __SEG__ Chr5 {Equus caballus} MEHTNATSWRGFVFLGFSSFGELQLLLFVLFLFLYLITLMSNVFIIVVIRLDSHLHTPMYLFLSFLSFSETCYTLGIIPRMLSSLVMGIKAISYVGCAAQMFFSASWACA
NCFLLAVMGFDRYVAICAPLHYASHMNPTLCVQLLGTSFLSGYIFGLGMTLVIFHLPFCSSHEIQHFFCDTPPVLSLACGDTGLSELGILILSLLVLLVSFSFITVSYTY
IVAAILRIPSAEGRKKAFSTCASHLTVVIVHYGCASFMYLRPKATYSLERDQLIAVTYTVVTPLLNPVVYSLRNRAVQKALRNAFQGRFLGKR*
116 >lcl|XP_001490294.2|Plus1complement(27955460..27956542) NW_001867381 c-C chemokine receptor type 4-like LOC100056549 __SEG__ Chr16 {Equus caballus} MNPTDIVDTTVDESIYNNYYLYENIPKPCTKEGIKAFGELFLPPLYSLVFLFGLLGNSVVVLVLCKYKRLKSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLC
KIISWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSLSVFASLPGLLFSTCYTEHNHTYCKTKYSSNSTRWRVLSSLEINVLGLVIPLGIMLF
CYSMIIKTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTFERHLDYAIQATETLAFVHCCLNPVIYFFLGEKFRKYIVKLFKTCRGPFVLCQ
YCSFLQIYSSDTPSSSYTQSTVDHDRHDAL*
117 >lcl|XP_001490308.3|Plus113940332..13941270 NW_001867424 olfactory receptor 6C2-like LOC100056577 __SEG__ Chr6 {Equus caballus} MKNYTALTTFILVGLTDDPNLQILLFIFLFLTYLLSVVGNLTIITLTLVDSHLKTPMYFFLRNFSILEVSFTTVCIPRFLYIIASGDNTVTYNACEAQLFFVIILGVTEF
FLLTAMSYDRYVAICKPLHYMTIMNNRVCIKFLIGCYMLALIIILPPYIMGLELKFCDSNVIDHFGCDAAPILKIACSDTEFIERVVLVLAGLTLFFTLVCVIMSYTYII
RTILRFPSVQQRKKAFPTCSSHLIVVSITYGSCIFIYIKPHAKEGLAVNKVVSVLTTSVAPVMNPFIYTLRNKQVVQAFKDMNKRVASISKN*
118 >lcl|XP_001490327.1|Plus139663852..39664625 NW_001867397 leucine-rich repeat-containing protein 3-like LOC100050523 __SEG__ Chr26 {Equus caballus} MGPMGRQSPSSLPVPTGGSCLLLLFCLRLGASCPQSCQCPDHAGAVAVHCSARGLQEIPKDIPTDAVLLKLDANKIARIPNGAFQHLNQLRELDLSQNAIETIGPAAFSG
LAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSIHHKTTDVAMLVTMFGWFAMVIT
YVVYYVRQNQEDARRHLEYLKSLPSAPVSKDPIGPVP*
119 >lcl|XP_001490345.2|Plus193900396..93901331 NW_001867387 olfactory receptor 6C76-like LOC100056624 __SEG__ Chr1 {Equus caballus} MGNHTTITEFVLLGLSDACELQMLIFLGILLTYLLTLLGNLLIVIITFMDRRLHTPMYYFLRNFAVLEIWLTSVVFPKMLINILTGHNTISLASCFLQFFLYFLLGTTEF
LLLAVMSFDRYVAICNPLRYATIMSKRVCVQLVLSSWTAGFLLIIVPSFLIFQQPFCGPNIINHFFCDSFPLLELICADTSLIELLGFIVANFSLIGTLLVTATCYGHIL
HTILCIPSAKERQKAFSTCSSHIIVISVFYGSCFFIYFRSGKGDQGEDRNKLVALLSTVVTPMLNPFIYTLRNKQVKLVFSEQMSKLLSQR*
120 >lcl|XP_001490346.2|Plus113960280..13961236 NW_001867424 olfactory receptor 6C1-like LOC100056625 __SEG__ Chr6 {Equus caballus} MRNQTEITGFILLGLSDDPKLQVVIFAFLLISYTLSITGNLTIITLTLLDSHLQTPMYFFLRNFSLLEVSFTTVCIPKFLGTIISGDKSISFSDCMTQLFFYIVLGVTEF
FLLVAMSYDRYIAICKPLHYMTIMNRRVCTLLVFASWLAAFLIIFPLLMLFIQLDYCKSNVVDHFTCDYFPLLHLSCSDTKFLEIVGFSCAVFTLLFTLALIILSYIYII
RTVLRIPSTSQRTKAFSTCSSHMIVISLSYGSCIFVYINPSAKDRVSLSKVVSVLNTSVAPMLNPFIYSLRNQQVKRAFVDMARKTLSFTNKRKHMMS*
121 >lcl|XP_001490419.2|Plus114007867..14008823 NW_001867424 olfactory receptor 6C6-like LOC100056754 __SEG__ Chr6 {Equus caballus} MNKSMEIEFILLGLTNDPLLQIVIFLFLFFNYILSLMGNLIIILLTMLDPHLKTPMYFFLRNFSFLEVSFTTICIPRFLISILTGNKTISYNGCATQLFFFLLLGVTEFY
LLAAVSYDRYVAICKPLHYPIIMNSKMCYQLVLSSWVTGFLIIFPPLVLGLKLDFCASKTINHFLCDTSPILQLSCTDTRFIELMAFILAVVTLVVTLLLVSLSYTYIIK
TILKFPSVQQRAKAFSTCSSHMVVVSITYGSCMFMYMKPSAKERVALTKGVAVLNTSVAPLLNPFIYTLRNQQVKEALKDMLQRFCYFQNNDTKFGYK*
122 >lcl|XP_001490434.2|Plus1complement(11546449..11547390) NW_001867414 olfactory receptor 2F1-like LOC100056780 __SEG__ Chr4 {Equus caballus} MRRDNLTWVSEFVLMGLSSNRQIQAGLFVLFGAAYLLTLLGNGLIILLTGLDAQLHQPMYFFLCNLAVVDICCTSSGVPQMLMHFLQEKKTISFTRCATQLFFSLAVGGT
EFLLLAAMAYDRYVAVCDPLRYMAVMGRRCCAALAVVSWLVGLANAAVETVITMRLPTCGQNVLNHVSCETLALVRLACMDVTFNQLVIMASSVVVLLLPCCLVSLSYAH
IVATILRIRSTGGRRKAFGTCASHLTVVSMSYGMALITYMQPSSTASAEKDKVVVLFYTVMTPMLNPLIYSLRNKEMKAAMSRVLMRSSETKL*
123 >lcl|XP_001490440.2|Plus114023074..>14023994 NW_001867424 olfactory receptor 6C6-like LOC100056791 __SEG__ Chr6 {Equus caballus} MKNQSGEIEFILLGLTDDPQLQMVIFIFLFLNYMLSMMGNLSIILLTLLNPCLKTPMYFFLRNFSFLEVLLTTICIPRFLVTIVTKNKIISYNGCVSQLFFSLFIAVTEY
YLLAAMSFDRYVAICKPLHYPIIMSNKMCYRLVLSSWTAGFLITFPPLVLGLKLEFCASKVIDHFICDTSPVLQISCTDTRFLELVSFVLAGGTLMVTLLLVVFSYMYII
KTILKISSAQKRTKAFSTCSSHMIVVSLTYGSCIFIHMKPAAKERVTLTKGVAVIYTSVAPLLNPFIYSLRNQQVKQAFKDTLQKIF
124 >lcl|XP_001490442.2|Plus1complement(12421220..12422170) NW_001867368 olfactory receptor 5D13-like LOC100056793 __SEG__ Chr12 {Equus caballus} MLLVEGNQSSVTLFILLGFSEYPNLQVPLFLVFLTIYTVTLVGNLGIIVAIRINPKLHRPMYFFLSHLSFLDICYSSVFTPKLLEILVVEDRTISFKGCMVQYFFGCTFV
ITEMFMLAVMAYDRFVAVCNPLLYTVTMSHKLCKFLVAGTYTYGGTCSLTITYSLLELSFCGSNIISHFGCEYSAILSLSCSDPYFSQMICLIISIFSEACSLLIIFSSY
IVIVVAIIQMPSTGGLRKAFSTCASHLTAITIFHGIILLLYCVPNSKNSWLLVKVGTVFYTVVVPMLNPLIYSLRNKDVKETVTSVINSQLLSHSI*
125 >lcl|XP_001490460.2|Plus1complement(11581720..11582667) NW_001867414 olfactory receptor 2F1-like LOC100056816 __SEG__ Chr4 {Equus caballus} MRKDNLTWVSEFVLMGLSSDRQIQARLFVLFGVAYLLTLLGNGLIVLVIGLDRQLHLPMYFFLCNLAVLDICYISSWVPQMLAHFLLEKKTISFTRCATQLLFSLALAGT
EFLLLAAMAYDRYVAVCDPLHYVVVMGPRRCAALALVSWLVGLANSAVETAVTMRLPTCGHHVLNHVSCETLALVRLACVDITLNQAVIMASSVVVLLLPCFLVSLSYTH
IVVAILRIHSTSGRLKAFGTCASHLTVVSMSYGMALVTYMQPSSTASAEKDKVVVLFFAVVTPMLNPLIYSLRNKEMKAALSRVLMRGLSQHFNM*
126 >lcl|XP_001490479.2|Plus1complement(11610237..11611178) NW_001867414 olfactory receptor 2F1-like LOC100056850 __SEG__ Chr4 {Equus caballus} MRRDNLTWMSEFVLMGLSSDRQIQAGLFVFFGAAYLLTLLGNGLIVLLIGLDTRLHQPMYFFLCNLAMLDICYTSSGVPQMLVHFLLEKKTISFSRCATQLFFSLALGVT
EFLLLAAMAYDRYVAVCDPLRYVAVMGPRRCTALAMVSWLVGLANSAVETAVTMRLPTCGHHVLNHVSCETLALVRLACVDITLNLLVIMASSVVVLLLPCCMVSLSYAH
IVVTILRICSSGGRRKAFGTCASHLTVVSMSYGMALVTYMQPSSTASAEKDKVVVLFYAVLPPMLNPLIYSLRNKEMKAALSRVLMRSSEPKL*
127 >lcl|XP_001490489.2|Plus11903017..1903970 NW_001867419 olfactory receptor 6N2-like LOC100056866 __SEG__ Chr5 {Equus caballus} MEQHNRSSLAEFVLLGFPKVGHVRGWLFVLLLLAYLFTICGNLLIFLVIRLDAALHIPMYHFVSLLSFLELWYTAATTPKMLANLLSEKKTISFAGCLLQTYFFHSLGAS
ECYLLTAMAYDRYLAICRPLHYPAIMTPTLCGRLAAGCWVCGFLCPISEVILVSQLPFCGYNEIQHIFCDFPPLLSLACKDTSTNVLVDFAINAFIILVTFLFVMISYGR
IIVAVLKIKTSVGRKKAFSTCASHLIVVLIFFGSITFMYVRLKESYSLTLDRTLAVVYSVLTPLVNPVIYSLRNQELIKAIKRTIFQKQGRTSPIHQ*
128 >lcl|XP_001490491.2|Plus1complement(12537418..12538344) NW_001867368 olfactory receptor 140-like LOC100056869 __SEG__ Chr12 {Equus caballus} MDHLTSLNNVTEFILLGLTQNPHLQKILFIVFLFIFLFTMLANMIIVVTISLSPTLSAPMYFFLTYLSFIDAFYTSVTTPKMIIDMLSQKRTISLGGCLTQIFVEHFLGG
SEIILLIVMAYDRHVAICKPLHYMTIMRQKLCCFLVVVALMGGILHATVQVLFIVNLSFCGPNVIDHFMCDFFPLLKLACSHSIKLGMVVAANSGAMCLLIFSMLLISYI
VILSSLKSHGSKGCRKALSTCGSHFTVVVLYFVPCIFTYVRPVTTCPMDKLVTVFYTILTPMFNPIIYTVRNTEVKNALRSLLKRKVT*
129 >lcl|XP_001490494.1|Plus1complement(815379..816533) NW_001867365 urotensin-2 receptor-like LOC100056872 __SEG__ Chr11 {Equus caballus} MALSPEPASRFPELATAGSTVPELPGGPNASLNSSWASPTAPSSLEDLVATGAIGVVLSAMGLVGVAGNVYTLVVMFRFLHASAPMYIYVVNLALADLLYLLSIPFIVAT
YVTKEWHFGDVGCRILFSLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRSKGYRKVLALGTWLLALLLALPMMLAIRLVRRGHKSLCLPAWGQHAHRAYLTLLFGTSI
VGPGVVIGLLYIRLARAYWLSQRASFTQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLSQYRAAQLLTPRTARIVNYLTTCLTYGNSCVNPFLYTLLTKNYRDFRLR
SLQARGACGPAGAGSFPQCRVRFQRGSGRSLSSTSQQATETVMLPQAAPRGVCA*
130 >lcl|XP_001490508.2|Plus128729177..28730130 NW_001867389 olfactory receptor 2H1-like LOC100056900 __SEG__ Chr20 {Equus caballus} MVNQSSPVGFLLLGFSEYPGLERILFIIVLTSYLLSLVGNTLIILLSVLDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLGCSVQLFTFLFLGTTEC
ILLTVMAFDRYVAVCQPLHYATVIHPRLCWQLAAVAWVIGLVESVIQTPPTLRLPFCPHQQVDDFLCEVPALIRLFCGDTTYNEIQMAVASVFILVVPLSLILASYSAIA
QAVLRINSAIAWRKALGTCSSHLIVVTLFYSSAIVVYLQPKDPYAQKRGKFFGLFYAVGTPSLNPLIYTLRNKEVKRAFRRLLGKDGVSRESRGRAA*
131 >lcl|XP_001490523.1|Plus1complement(48795336..48796349) NW_001867383 2-oxoglutarate receptor 1-like LOC100060024 __SEG__ Chr17 {Equus caballus} MNEPLDDVANASHFPNYAAAFGNCTDEKIPLKRHYFPVIYSIVFLVGFPGNAVAISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIH
FGFHFNLYSSILFLTCFSIFRYFVIIHPMSCFSIHKTRWAVVACAVVWIISLAVVVPMTFLITSTTRANRSACLDLTNSDDLTTVKWYNLILTATTFCLPLLIVTLCYTM
IIYTLTQGPRTHNCLKQKARRLTILLLLVFYICFLPFHILRVIRIESRLLSISCSIENQIHGAYIVSRPLTALNTFGNLLLYMVVSNNFQQAMCSMVRCKARRNSEEAKK
IGHSNNP*
132 >lcl|XP_001490552.2|Plus128710824..28711777 NW_001867389 olfactory receptor 2H1-like LOC100056985 __SEG__ Chr20 {Equus caballus} MVNQSSPVGFLLLGFSEYPGLERILFIIVLISYLLTLVGNTLIILLSVLDPRLHSPMYFFLSNLSFLDLCITTSFVPQMLVNLWGPKKTISFLGCSVQLFTFLFLGTTEC
ILLTVMAFDRYVAVCQPLHYPVIIHSRLCWQLASVAWVMGLVQSVVQTPPTLSLPFCPHRQIDDFVCEVPSLIRLSCGDTSFNEIQLAVSSVVFLVMPLTLILISYGAIA
QAVLRINSAIAWRKASGTCSSHLLVVTLFYSLVISVYLQPKNPYAQKRGKFFGLFYAVGTPSLNPLIYTLRNKEVKRAFRRLLGKDGVSRESRGRAA*
133 >lcl|XP_001490555.2|Plus112608031..12608960 NW_001867368 olfactory receptor 4C5-like LOC100056989 __SEG__ Chr12 {Equus caballus} MNNVTEFILLGLTQSPDVWKLMFPVFTIIYFPTVAGNLLIVVTITTKRTLCSPMYFFLSFLSFIDGCCSSTVVPKMIYDLLAEKKTISFSECLTQLFEEHFFGGVEIILL
TVMAYDHYVAICKPLHYTITMNRRVRGFLVAIACYGRFLHALIQILFIVWLPFCAPNVIDHFICDLFPLLKLSCTDTHIFGLFVAANSGPMCMLIFSILISCYILILCSL
RRHSTEGQQKALSTCTSHVTVVILLFVPCIFVYLRPMINFPIDKVVVVFYTMLMPMLNPLIYTVRNSEVKNAMRKLWRHRVILGNNPCD*
134 >lcl|XP_001490570.1|Plus16303776..6304672 NW_001867430 adrenocorticotropic hormone receptor-like LOC100057018 __SEG__ Chr8 {Equus caballus} MKHIVNLYENINDTARNNSDCPLVVLPEEIFFTISIIGVLENLMILLAVIKNKNLQSPMYFFICSLAISDMLGSLYKILENILIMFRNTGYLKPRSNFETTADDIIDSLF
ILSLLGSIFSLSVIAVDRYITIFHALQYHSIVTMHRAIVVLIVIWTCCLGSGIAMVIFSHHIPTVITFTSLFPLMLVFILCLYVHMFLLARSHARKISTLSRGNMKGAIT
LTILLGVFIFCWAPFVLHVLLMTFCPNNPYCVCYMSLFQVNGMLIMCNAVIDPFIYAFRNPELREAFKKMIFCNSYQY*
135 >lcl|XP_001490571.2|Plus128694610..28695548 NW_001867389 olfactory receptor 2H1-like LOC100057021 __SEG__ Chr20 {Equus caballus} MVNQSSPVDFLLLGFSEYPGLERTLFIIVFTSYLLTLMGNTLIILLSVLDPRLHSPMYFFLSNLSFLDLCFTTTFVPQMLVNLWDPKKTISFLGCSVQLFIFMSLGTTEC
ILLTVMAFDRYVAVCQPLHYATVIHPRLCWQLVAVAWVMGLVQSIVQTPPTLRLPFCPHRKIDDFLCEVPSLIRLSCGDTTFNEIQLAVSSVILVVVPLSLILVSYCAIA
RAVLRINSAKGRKKTFGTCSSHLMVVTIFYSSVIAVYLQPKNRYAQKRGKFFGLFYAVGTPSLNPLIYTLRNKEVKRAFRRLLGKDEDPRES*
136 >lcl|XP_001490599.3|Plus114105360..14106295 NW_001867424 olfactory receptor 6C2-like LOC100057062 __SEG__ Chr6 {Equus caballus} MRNHTVTRFILLGLTDDPQLQGLLLIFLFFTYLLSVTGNLAIISLTLMDHHLKTPMYFFLQNFSCLEILFTSACVPRYLYNLSVGDKTIAYCFCFIQAFFADLFGVTEFF
LLATMSYDRYIAICQPLHYTTVMSSTVCRRLILCCWMAGLLIILPPFSLSQNLEFCDSNVIDGFLCDVSLFLQISCSDTWVVEQMVIVCAVLTFITTLLCVVLSYICIIK
TIVRFPSAQQRKKAFSTCSSHMVVVSITYGSCIFVYVKPSAKESAAINKGVAVLTTSIAPMLNPFIYTLRNKQVKQAFNASIKRIVLSSQK*
137 >lcl|XP_001490644.2|Plus111832487..11833440 NW_001867414 olfactory receptor-like protein OLF3-like LOC100057136 __SEG__ Chr4 {Equus caballus} MGTDNQTWVREFILLGLSNDWDTKVTLFVLFSIAYLVTVLGNFLIVLLIRLDSRLHTPMYFFLTNLSLVDVSYATSIVPQMLVHFLAGRKVIPYVSCAAQLFFSLGLGGI
EFVLLEVMAYDRYVAVCEPLRYSVIMHRALCTRLVITSWVSGSINSLLQSTTTFQLPMCTNKFIDHISCELLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIK
IISTILKIQSTEGRKKAFQTCASHLTVVVLCYGMTIFTYIQPHSSPSVLQEKLISIFYAILMPVLNPVIYSIRNKEVKGAWQKLLRQLSGLTSKLAS*
138 >lcl|XP_001490648.3|Plus1complement(6380401..6381378) NW_001867430 melanocortin receptor 5-like LOC100057141 __SEG__ Chr8 {Equus caballus} MNTSFHLHFLDLNLNATEGNLSGPNDKSKFLPCEEMGIAVEVFLTLGLISLLENILVIGAIVKNKNLHSPMYFFVCSLAVADMLVSMSNAWETITIYLINNKHLVIAETF
VRHIDNVFDSMICISVVASMCSLLAIAVDRYITIFYALRYHHIMTVKHSRVIIACIWTFCTGCGIVFIIYYESTYVVICLISMFFTMLFLMVSLYIHMFLLAQTHVKRIA
ALSGYSSVQQRTSMKGAVTLTMLLGVFIVCWAPFFLHLILMISCPRNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQEMRKTFKELICCHGFRMACRFPSRY*
139 >lcl|XP_001490653.3|Plus1complement(14141783..14142724) NW_001867424 olfactory receptor 6C2-like LOC100057150 __SEG__ Chr6 {Equus caballus} MRNDTVTTFILLGLTEDPQLQVLVFIFLFLFYLLSITGNLTIISLIFLDSHLKTAMYYFLQNFSFLEISFTSSCIPRYLYNIATGDKVITYNACVSQVFFTHLFGVTEFF
LLATMSYDRYVAICKPLHYGTIMNNTACRRLVFSSWVAALFIITPPLSLGLTLEFCGSNTIEHFICDASPLLKISCSDTWFMEQTVIISAVLALLMTLTCVVLSYIYIIQ
TILGFPSAQQKKKAFSTCSSHIIVVSITYGTCIFIYIKSSPEESVAINKGVSVLTTSIAPVLNPFIYTLRNKQVKQAFNNSIKRMISSRNKRM*
140 >lcl|XP_001490677.3|Plus1complement(14154013..14154948) NW_001867424 olfactory receptor 6C2-like LOC100057190 __SEG__ Chr6 {Equus caballus} MRNQTISTFILLGLTDDPQMKVLIFIFLFFTYVLSVAGNLIVISLTFIDCHLRTAMYFFLQNFSFLEISFTTACIPRVLYNISTGDKIITYDACVVQIFFTYLFGITEFF
LLAAMSFDRYVAICKPLHYVTIMNNRVCNRLIISCWMAGLLIIIPPLSLGLNLEFCGSKVIDHFFCDATPLLKISCSDTWFIERMILVCAVLTFIMTLVCVVLSYVYIIT
TILRFSSAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSANEEVSLNKGVSLLVSSISPMLNPFIYTLRNKQVKKALNDSVKRIIFFLKK*
141 >lcl|XP_001490693.2|Plus1complement(12732161..12733108) NW_001867368 olfactory receptor 8J3-like LOC100057228 __SEG__ Chr12 {Equus caballus} MAPGNFTRVTEFILTGVSDRPELQIPLFFVFLVIYGLTVAGNLSIITLTSVDSRLQTPMYFFLRHLAIINLGNSTVIAPKMLINFLVKKKTIFYYECAIQLGVFLVFIVA
EVFMLAVMAYDRYVAICNPLLYMVVVSRQVCLLLVSLTYLYSFFIALLASSSIFSMSYCSCNVINHYFCDTVPLLALSCSDTYFPETVVFISAATDLVFSMIIVLVSYFN
IVLSILRIHSSEGRKKAFSTCASHMMAVTVFYGTMLFMYVQPPTNHSMDTDKMASVFYTVVIPMLNPMIYSLRNKDVKAALWRFLPNICCSFKLM*
142 >lcl|XP_001490694.1|Plus16778251..6779117 NW_001877043 OTU domain-containing protein 6A-like LOC100056237 __SEG__ ChrX {Equus caballus} MEDSQRMVRRHYREKKELQARIQSMKNSVPKSDKERRKQLLLDVARLKAEMEQKHQQELEKFQESFPDDSNLDSVTEDLAKMDLENQPPRLAKAQRRRERRAAEEAARLE
RIAEVEAERQAGFRHDDEEEKLSAILEARNLEMKEIPADGHCMYRAIQDQLVFPVTVESLRRRTANYLRKHVDDFLPFFSDSETGDTCSRDSFLSYCDDIVHSALWGGQL
ELRALSHVLQTPIEVIQAYSPVLVIGEEYAKKPLTLVYLRYSCSLGEHYNSVKPLEAGAVGGAAPCLF*
143 >lcl|XP_001490710.2|Plus128641591..28642550 NW_001867389 olfactory receptor 6Q1-like LOC100057263 __SEG__ Chr20 {Equus caballus} MERANRTLVTEFVFLRFSDSAHLQLLFFCLFLMIYFLSLVGNALIVLTVALDGRLHTPMYFFICNLSLIELWYTTVTVPKMLANFLCSQGVISVPSCIAQYYFFFSLAGT
ELFILTTMAFDRYAAICRPLHYPLLLSPQTCSTLAGICWSVGFLCPMFPSFLLAQISFCTPNQINHFFCDADQIFRLSCTDTYAIQVVGYALSTVVILGALVFTMASYAQ
IMVTILAMASATARHKAFSTCTAHLSVVTIYFGTLIFMYVRPAVKYESNINKIVAIFYSVITPLLNPLIYTLRNKDVKDALKVLVSRIQRICHSSRESQ*
144 >lcl|XP_001490712.2|Plus11442238..1443170 NW_001867419 olfactory receptor 10J1-like LOC100057265 __SEG__ Chr5 {Equus caballus} MKRENHTVVTEFIFQGFFSFHEHKLTLFVVFLTLYLLTLASNVIIVTIIGIDRHLHTPMYFFLSMLSTSETVYTLVIVPRMLSSLIGLSQPISLAGCATQMFLFITLAIN
NCFLLTAMGYDRYVAICNPLRYTVIMNRRVCTQLVWGACSIGLLVAIIQISSVFGLPFCDREVAHYFCDIRPVMKLSCADTTLHDIMNFIISSLVIVVPKGLVFISYILI
ISTILKIASAEGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENMRDQDQLISVTYTVFTPLLNPVVYTLRNKEVKDALHRAIGKKPLA*
145 >lcl|XP_001490715.2|Plus1complement(14176319..14177290) NW_001867424 olfactory receptor 6C2-like LOC100057267 __SEG__ Chr6 {Equus caballus} MKNQTITTFILLGLTDDPRLQIPIFMFLFLSYMVSITGNLTIMSLTLVDCHLKTPMYFFLQNFAFLETAFTSACIPRYLYNIATGDRTIKYNICIIQVFFIDVFGVTEFF
LLATMSYDRYVAICKPLHYLTIMSSRVCRRLVLCCWMSGLLIIIPPLILFLNLKFCDSNVIDHYLCDSFPILKISCSDTWLIEQLVIVCAVLTFILTLVCVAVSYIFIIK
TILRFPSALQKKRAFSTCSSHMIVVSITYGSCIFIYIKPSAKESVVINKGVTVLITSIAPMLNPFIYTLRNKQVRQAFSNSFKKIALVSKNLRMFMSRNKILS*
146 >lcl|XP_001490733.1|Plus17730171..7730917 NW_001867410 calpain small subunit 2-like LOC100050605 __SEG__ Chr3 {Equus caballus} MFLAKALLEGANGGLGEALGGLLGGGGQKRGGGGNIGAIVGGIMNFISEAAAAQYTPEPPPSTQQHFTTVEANESEEVRQFRQQFARLAGPDMEVGATDLMNILNKVLAK
HKDLKSDGFSLDTCRSIVSVMDSDTNGKLGFEEFKYFWNNIKKWQCVFRQHDTDRSGSLRSSQLKGALQAAGFQLNEQLYRMIVRRYADENGSMDFNNFISCLVRLDAMF
RAFKSLDRNASGLIEVSIQEWLQLTMYS*
147 >lcl|XP_001490735.2|Plus111936848..11937789 NW_001867414 olfactory receptor-like protein OLF3-like LOC100057296 __SEG__ Chr4 {Equus caballus} MGQENKSQIWVREFILLGLSSDWVTQVSLSVLILAMYVVTTVGNVLILALIRLDSRLHTPMYFFLSVLSFVDLCYSNSFAPQMLAHFLSAQKSIPFHSCVLQLYVSLALG
GSEFFLLGAMAYDRYVAVCHSLHYIVIMHGGLCLGLAAGCLVAGFMNSLMETIITFRLPLCHNVINHFACEILAVLQLACVDISFNKIMVAISGFLLIMLPCSLVLFSYG
RIVAAILRIRSTQGRRKAFGTCASHLTVVCMCFGAAIFTYLRPQSASSMEEEKMVALFYAVVAPMLNPLIYSLRNKEVMAALQKVSEKFRDKR*
148 >lcl|XP_001490737.2|Plus1complement(7268859..7269818) NW_001867424 olfactory receptor 8S1-like LOC100057300 __SEG__ Chr6 {Equus caballus} MKNLSIIEEFVLLGLSSDTDIQTVLFVLFLGIYLLTLMGNLMMILVIRSDSHLHTPMYFFLGHLSFLDMCYSSVTVPKMLKNFLSQKKTISVWGCITQSFFFILSGGAEG
CLLSAMAYDRYAAICHPLLYTVVMNRPVCTAMVSAAWMTGFLNSLVNNLCIQSLKFCGPNIISHFSCELPSLFPLSCSDPMANTILLAGSTAFLGLVTLPLILFSYSKIM
FAILSISSSGGRGKAFSTCSSHLTVVLLFYGTALFRYISPPSGSVLQRVVSIQYGVITSLINPLIYSLKNQEVKAALQRTLHQQMCVFGVRNGNRMFAL*
149 >lcl|XP_001490757.2|Plus111951282..11952217 NW_001867414 olfactory receptor 6B1-like LOC100057334 __SEG__ Chr4 {Equus caballus} MEVQNQTQVTKFILVGFPGNWGMRAAVFLIFLVAYILTVAENVIIILLVQQNRPLHKPMYFFLANLSFLETWYISVTVPKLLFSFWSESNSISFTHCMIQLYFFIALMCT
ECVLLAAMAYDRYVAICRPLHYPTIMSHGLCFHLALGSWAIGFGISLAKICFISRLSFCGPNIINHFFCDISPVLNLSCTDMSIAELVDFILALVIFLFPLSITVLSYGC
ILATVLRMPTGKQKAFSTCASHLVVVTIFYSATIFMYARPRAIHAFNMNKVISIFYAIVTPALNPFIYCLRNGEIKEALKKLAYCQAIQLD*
150 >lcl|XP_001490765.2|Plus11410181..1411122 NW_001867419 olfactory receptor 10J3-like LOC100057350 __SEG__ Chr5 {Equus caballus} MLKPNSTAVTEFLFEGFSSFGWQPRLVFFVVFLILYLLTLSGNVIIVTIIRLDHHLHTPMYFFLSMLSISETCYTVAIIPHMLYGLLNPYQPIAIQGCATQLFFYLTFGI
NNCFLLTAMGFDRYVAICKPLQYSMIMGKEACVQLASGSLGIGLCMAIVQVTSVFGLPFCDDFVISHFFCDVRPLLKLACTDTTVNEIINFVVSVCVLVLPMGLVFISYV
LIISTILKIASTEGRKKAFATCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTVITPLLNPLVYSLRNKEVKDALYKAMGQKPLSS*
151 >lcl|XP_001490767.2|Plus1complement(12792387..12793343) NW_001867368 olfactory receptor 8K3-like LOC100057352 __SEG__ Chr12 {Equus caballus} MEKHNQTMLNEFILMGITDNPELQAPLFGLFLIIYVISVVGNLGMIILTKTDSRLQTPMYFFLRHLAFTDLGYSSTVGPKMLVNFVVDHNTISYYFCATQLAFFSMFILS
ELFILSAMSYDRYVAICSPLLYTVIMSQRVCRVLVAIPYLYSTFVSLLVTIKIFNLSFCGYNVIHHFYCDSLPLLSLLCSNTSEIEMIILILAGFDLISFLIVLVSYLLI
LRAVLRMNSAEGRRKAFSTCGSHLTVVTVFYGTLIFIYAQPRSTHFFDTDKVASIFYTLIIPMLNPLIYSLRNTDVKYAVNKLWKSYVISFLKVHCSM*
152 >lcl|XP_001490785.2|Plus111984029..11984961 NW_001867414 olfactory receptor 2A5-like LOC100057377 __SEG__ Chr4 {Equus caballus} MSENQTWITEFILLGFSLNPKIRMFLFELFSLFYTFTLLGNGVILGLIWLDSRLHTPMYFFLSHLAIVDVSYASNNVPKMLANLLNKKKTISFIPCIMQTFLYMAFAHTE
CLILVIMSYDRYVAICHALRYSVIMSWRVCIVQAVTSWACGSLLAMVHVVLLLRLPFCGPHEINHFFCEILSVLKLACADARLNQVVIFAASVFILVGPLCLVLVSYTRI
LFAILRIQSGEGRRKAFSTCSSHLCVLGLFFGSAIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNAEVKGALRRVLWKERSM*
153 >lcl|XP_001490787.3|Plus1398624..399688 NW_001867422 c-X-C chemokine receptor type 2-like LOC100055552 __SEG__ Chr6 {Equus caballus} MGEFNFANYYDEEFSNYSYNTDLPYILPDSAPCRPETLEMNTYALVVIYALVFLLSLLGNSLVMLVVLYTRVSRSVTDVYLLNLAIADLLFALTLPIWAASKAKGWTFGT
VLCKLVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHWVKFICLGIWILSFILALPVFLFRKAIYPPYSGPVCYEDMGANTTKWRMVMRVLPQTFGFLVPLLV
MLFCYGLTLRTLFQAHMGQKHRAMRVIFAVVLVFLLCWLPYNLVLVSDTLMRLQVIQETCVRRNDINRALDATEILGFFHSCLNPLIYAFIGQKFRHGLLRIMAIHGLVS
KEFLAKDSRPSFVGSSSGNTSITL*
154 >lcl|XP_001490792.2|Plus128573366..28574292 NW_001867389 olfactory receptor 12D2-like LOC100057387 __SEG__ Chr20 {Equus caballus} MLNQTSITEFLLLGVTDIQVLQTFLFVVFLAIYFANVTGNGAILMVVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLENFLSTHKVISFLGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLHYPLIMNHQLCTQMAITIWTIGFFHALLHSIMTSRLNFCGSNHIHHFFCDVKPLLELACGNTELNQWLLNTVTGTIAMGPFFLTLLSYFYII
THLFFKTRCCSMLHKALSTCASHFMVVILFYAPVLFTYIRPASSSSVDQDRIIAIMYSVVTPVLNPLIYTLRNKEVEGALSRVIRMRF*
155 >lcl|XP_001490796.2|Plus1complement(14207950..14208888) NW_001867424 olfactory receptor 6C2-like LOC100057392 __SEG__ Chr6 {Equus caballus} MKNQTTLTTFILLGLTDDTQLKTLLFIFLFLSYMLSVSGNLTIITLTLIDSHLKTPMYIFLQNLSFLEILFTTACIPRFLYSISSGDKSITYNACAGQLLFTDLFGVTEF
FLLAVMSYDRYVAICKPLHYMTIMNNRVCKNFILFCWVAALMIILPPISLGLDLEFCDSNVIDHFYCDASPILKIACSDTWLIEQMVMACAVLTFISTLVCVILSYILII
RTILRFPSAQQRKKAFSTCSSHMIVVSMTYGSCIFIYVKPSAKDEVAINKGISLLLTSISPMLNPFIYTLRNKQVKQAFHDSIKKIVFLSKM*
156 >lcl|XP_001490818.2|Plus1complement(7328842..7329771) NW_001867424 olfactory receptor 8S1-like LOC100057421 __SEG__ Chr6 {Equus caballus} MGNHSMFSDFILLGLSADPQTQILLFVLFLMIYLLTLMGNMVMLLVIRSDSHLYIPMYFFLGQLSFLDLCHSSVTVPKVLENLLSESKTIFVESCLAQAFFVFATGGTEA
CLLAVMAYDRYVAISSPLLYGQVMSNQLCIGLVWGSWGLAFVDALINILLTVNLDYCEHQSIPHFSCELSSLFPLSCSDTSTNFTVLLCSSVLHFFGTFILIFFSYTRIV
STILSISSTSGRSKAFSTCTSHLTTVILFYGSGFLSYLLPTSGSVVEMIFPLQYSVVTPMLNPLIYSLQNEEVKAAMRRMFRRYVNSFT*
157 >lcl|XP_001490822.2|Plus128559373..28560299 NW_001867389 olfactory receptor 12D2-like LOC100057428 __SEG__ Chr20 {Equus caballus} MLNRTSVTEFLLLGLTDIQILQPFLFVIFLAIYFLIVAGNGAILMIVISDPKLHSPMYFFLGNLSCLDICYSTVTLPKMLENFLSTHKAISFLGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLRYPLIMNHQLCTQTAITIWTIGFSHALLHSIMTSRLNFCGSNHIHHFFCDVKPLLELACGNTELNQWLLNTVTGTIGMGPFFLTLISYFYII
IYLFFKTRCCSMLHKALSTCASHFMVVILLYAPVVFTYIRPASGSSMDQDWIMAIMYSVVTPVLNPLIYTLRNKDVKGALSRVTRRRL*
158 >lcl|XP_001490825.2|Plus1complement(1365384..1366313) NW_001867419 olfactory receptor 10J1-like isoform 1 LOC100057431 __SEG__ Chr5 {Equus caballus} MKKENRTLVSEFTFQGFSSFHEHQLTLFVVFLVLYILTLAGNIIIVTIISLDHHLHTPMYFFLNMLSASETMYTLVIIPKMLCNLIGLSQPISLAGCATQMFFFTTLAIN
NCFLLTAMGYDRYVAICNPLRYSVIMNKKVCTQLVWGACSIGLIVAMTQVSAVFRLPFCTTKVAHFFCDIRPVMKLSCIDTTVNEILTLIISVLVILVPMGLVFISYILI
ISTILKITSAEGRKKAFATCASHLTVVVVHYGCASIAYLKPKSENTRDQDQLISVTYTVITPLLNPVVYTLRNKEVKDALLRVISKKLS*
159 >lcl|XP_001490841.2|Plus1complement(12015891..12016832) NW_001867414 olfactory receptor-like protein OLF3-like LOC100057459 __SEG__ Chr4 {Equus caballus} MGQENKTQIWVREFILLGLSSEWGTQVSLFVLILAMYVVTTVGNVLILALIRLDSRLHTPMYFFLSVLSFVDLCYSNSFAPQMLAHFLSAQKSIPFHSCVLQFYVSLALG
GSEFFLLGAMAYDRYVAVCHPLHYIVIMHGGLCLGLAAGCLVAGCMNSLMETIITFRLPLCHNVINHFACETLAVLQLACVDISFNKVMAAISGFLVIMLPCSLVLFSYG
RIVAAILRIRSTQGRRKAFGTCASHLTVVCMCFGAAIFTYLRPQSASSMEEEKMVALFYSVVAPMLNPLIYSLRNKEVMAALQKVLEKFRDKG*
160 >lcl|XP_001490844.2|Plus1complement(7343390..7344325) NW_001867424 olfactory receptor 8S1-like LOC100057462 __SEG__ Chr6 {Equus caballus} MAMKNYSTITEFIILGLSTDPHIQAVLFVLFLLSYLLTLMGNFLMLLVIRTDSHLHTPMYFFLKQLSFLDLCHSSVTVPKVLENLLSESKTIFVESCLAQAFFVFATGGT
EACLLAVMAYDRYVAISSPLLYGQVMSNQLCIGLVWGSWGLAFVDALINILLTVNLDYCEHQSIPHFSCELSSLFPLSCSDTSTNFTVLLCSSVLHFFGTFILIFSSYTC
IVSTILSISSTSGRSKAFSTCSSHLTTVILFYGSGFISYLLPTSGSPLEMIFSLQYSVITPMLNPLIYSLQNKEVKAAMGRMSRKYFHHFM*
161 >lcl|XP_001490849.2|Plus1complement(28533677..28534624) NW_001867389 olfactory receptor 11A1-like LOC100057466 __SEG__ Chr20 {Equus caballus} MEIVSIRNQTITEFVLLGFSDVAELHLLFFIVFTLIYTSIIVGNMLIIVAVVSSPRLHTPMYFFLVNLSFLEILYTSTVVPKMLEGFLREAAISVAGCLLQFYIFGSLAT
AECFVLAVMAYDRYLAICHPLRYPLLMGPRWCLGLVVIAWLSAFMVGGLIVGLMAQLRFCGPNHIDHFYCDFTPLMGLACSDPSIAQLTTFILSVVCLTVPFGLILTSYA
RIVVAVLRVPAGASRRKAFSTCSSHLAVVSTFYGTLIVLYIAPSAVHSQLLSKVFALLYTVVTPLFNPVIYTLRNKEVHQALWRLLYMKQTETLD*
162 >lcl|XP_001490852.2|Plus114229700..14230638 NW_001867424 olfactory receptor 6C70-like LOC100057471 __SEG__ Chr6 {Equus caballus} MKNHTRQIEFTLLGLTDNFQFQIVIFFFLLLNYMLSILGNVTIIALTLLDSHLKTPMYFFLRNFSFLEISFTSSCIPRFLITIVTRKKTISYNGCISQLFFYIFLGVTEF
FLLAAISYDRYVAICKPLHYTSIMNSKVCHQLVLSSWVTGFLVIFPPLILGLNLDFCASNIIDHFICDISPVLQLSCSDTRLLELIAFFLAVMTLIVTLLLVILSYSYII
KTILKFPSAQQKKKAFSTCSSHMIVVSITYGSCIFIYIKPSANERVFLSKGVAVLNTSIAPLLNPFIYTLRNKQVKEAFRAIFRKIFSSSDK*
163 >lcl|XP_001490878.2|Plus1complement(7389912..7390829) NW_001867424 olfactory receptor 8S1-like LOC100057502 __SEG__ Chr6 {Equus caballus} MKNHSVVSEFILLGLSVDSQTQALLFVLFLIIYLLTLMGNLMLLLVIRVDSHLHIPMYFFLGQLSFLDLCHSSVTVPKLLENLLSEKKTISVEGCMAQVFFVFATGGTES
CLLTVMAYDCYVAISSPLLYGQLMNRELCMGLVCGSWGLAFLDALINILVALNLDFCEAQNIHHFSCELPSLYPLSCSDVSASFTALLCSSLLHFFGNFLLIFFSYVRIL
FTILSISSTSGRSKAFSTCSSHLTAVSFFYGSGLLRYLMPNSGPTQELIFSLQYSVVTPMLNPLIYSLKNKEVKAAVRRMLRKGF*
164 >lcl|XP_001490882.2|Plus1complement(1324258..1325214) NW_001867419 olfactory receptor 10J4-like LOC100057510 __SEG__ Chr5 {Equus caballus} MPRLNFTAVTEFIFEGFSIFGWQHRLFLFGVFLVLYLLTLASNAIILTVIHLNRQLHTPMYFFLSVLSISETCYTVAIIPRMLSSLLNSQRVISIPDCATQLFFYLTFGI
NNCFLLTAMGYDRYVAICNPLRYSVIMGKKTCIQLASGSWSIGLSTAIIQVSSVFSLPFCGTNIISHFFCDIRPLMKLSCADTTIKEFITLLISLCVLVLPMVLIFISYV
LIVTTILKIASAEGRKKAFATCASHLTVVIVHYGCTSFIYLKPKSHNSLQDRLISVTYTVITPLLNPVVYSLRNKEVKDALLRALGRKPLFLGVGSVS*
165 >lcl|XP_001490884.3|Plus1complement(14247748..14248686) NW_001867424 olfactory receptor 6C2-like LOC100057512 __SEG__ Chr6 {Equus caballus} MRNHTAITTFILLGLTDDPLLQILIFIFLFLTYLLSVTGNLVIITLTLVDSHLKTPMYFFLRNFSFLEVSFTTACIPRFLYSISTGDNNITYNACISQLFFVILFGATEF
FLLAAMSYDRYVAICKPLHYMTIMNNRVCSLLVICCWVSSLMIILPPLSLVLQLEFCDSNAIDHFGCDAAPLLKISCSDTWVIEQMIILVAVFALIITLVCVLLSYTYII
KTILGFPSVQQRRKAFSTCSSHMIVVSITYGSCIFIYVKPSAKDQVAINKGVVVLSSSVAPLLNPFIYTLRNKQVKKAFNDSIKRIIYLSNK*
166 >lcl|XP_001490906.2|Plus128512860..28513786 NW_001867389 olfactory receptor 12D2-like LOC100057541 __SEG__ Chr20 {Equus caballus} MLNQTLVTEFLLLGLTDIQILQTFLFTVFLAIYFLIVAGNGAILMIVIFDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLENFLSTHKAISFLGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLHYPLIMNHQLCTQMAITIWTIGFSHALLHSIMTSRLNFCGSNHIHHFFCDVKPLLELACGNTELNQWLLNTVTGTIGMGPFFLALLSYFYII
IYLFFKTHSCSLLHKALSTCASHFMVVILLYAPVLLTYIRPASGSSMDQDRIMAIMYSVVTPVLNPLIYTLRNKEVKGALSRVIRRRL*
167 >lcl|XP_001490908.2|Plus1complement(1315506..>1316462) NW_001867419 olfactory receptor 10J1-like LOC100057544 __SEG__ Chr5 {Equus caballus} LCFRFSHHSMKGENHTLITEFVFQGFSSFHEHQLTLFVVFLAFYILTLAGNVIIVTIIRIDHHLHTPMYFFLSMLSTSETVYTLVILPRMLSSLVCVNESISLAGCATQM
FFFITFGITNCFLLTAMGYDRYVAICNPLRYTVIMNKRVCVQLVWGAWSIGLIVATTQVISVFRLPFCAAKVAHFFCDIRPVMKLSCIDTTVNEILTLIISVLVLVVPMG
LVFISYVLIISTILKIASAEGRKKAFATCVSHLTVVIVHYGCASIAYLKPKSENTRDQDQLISVTYTVITPLLNPVVYTLRNKEVKDALLRVIGRKLS*
168 >lcl|XP_001490937.2|Plus11246535..1247464 NW_001867419 olfactory receptor 10J5-like LOC100057586 __SEG__ Chr5 {Equus caballus} MQRKNFTGVTEFVFLGFSIFGKHQITLFVVFLTIYILTLAGNIIIVAIICIDHHLHTPMYFFLSMLASSETVYTLVIVPRMLSSLIFHNQPISLAGCATQMFFFAILAAN
NCFLLTVMGYDRYVAICKPLRYTVIMSKRMSAQLVCGSFGTGLVMAVLHVTAMFNLPFCGTVVNHFFCDIYPVMKLSCIDTTINEIINYGVSSFVILVPAGLISISYILI
ISSILKITSAKGRKKTFATCASHLTVVIVHYGCASIAYLKPKSENSIEKDLLLSVTYTIITPLLNPVVYSLRNKEVKDAIHRAMGKSIS*
169 >lcl|XP_001490956.2|Plus112060691..12061623 NW_001867414 olfactory receptor 2A14-like LOC100057617 __SEG__ Chr4 {Equus caballus} MAGNQTWITEVTLLGFQVDPALELVLFGLFSLFYTLTLLGNGVILGLICLDPRFHTPMYFFLSHLAIIDMSYASNNVPKMLANLVSQKRTIFFVPCIMQTFLYLAFAHTE
CLMLVVMSYDRFTAICHPLRYTVIMSWKVCLVLVITSWAFSFILALVHLVLILRLPFCVRHEINHFFCEILSVLKLACADTRLNQVVIFASCVFILVGPLCLVLVSYTRI
LFAILKIQSGEGRRKAFSTCSSHLCVVGLFFGSPIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNAEVKGALRRVLCKERPV*
170 >lcl|XP_001490963.2|Plus128488328..28489266 NW_001867389 olfactory receptor 14J1-like LOC100057625 __SEG__ Chr20 {Equus caballus} MANFTTMNGFLLMGFSAKPELEILCASLFLVSYLVALTGNILIITATSMDDSLYSPMYFFLKHLSFLDLCYISVTVPRYICNSFMHNGNISLWECILQCFAFTLCGCAEM
VMLTVMSYDRYVAICLPLHYEIIMNFNTCIHGILAVWISGVISGVMHTAATFSIHFCGTKIIHQFFCDVPQILKLSCSNEYVSELGVIVFLSLVAFLCFICIGLSYMHIF
STVLQIPSAEGRAKAFSTCMPHLSVVILFISTGVFAFLKPHSDSPTALDFLLSVFYTVLPPTLNPMIYSLRNKAMKTALRKVFKRRKAYFFC*
171 >lcl|XP_001490966.2|Plus1complement(14311968..14312912) NW_001867424 olfactory receptor 6C1-like LOC100057630 __SEG__ Chr6 {Equus caballus} MRNYTEITGFILLGLSDDPKLQALIFVFLLITYMLSITGNLTVITLTLLDSHLQTPMYFFLRNFSLLEVSFTTVTTPKFLSTIISGDKSISFNDCMAQFFFFILLGVTEF
YLLAAMSYDRYIAICKPLHYTTIMNQRVCTLLVFSSWLVSFLIILPLLMLFIQLDYCKSNVIDHFTCDYFPLLHLSCSDTKFLEIVGFSCAVLTLLFTLALIILSYIYII
RTILRIPSTSQRTKAFSTCSSHVIVISISYGSCIFVYINPSAKDRVSLSKGVAVLNTSVAPMLNPFIYSLRNQQVKGAFVDMARKTLFHKQMKK*
172 >lcl|XP_001490974.2|Plus1complement(51032194..51034038) NW_001867387 leucine rich repeat and Ig domain containing 1 LINGO1 __SEG__ Chr1 {Equus caballus} MLAGGARSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFN
NLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLN
INAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNY
LRVLNVSGNQLTTLEESAFHSVGNLETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVC
RADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRATVPFPFDIKT
LIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGISSTDAPRKFNMKMI*
173 >lcl|XP_001491012.2|Plus17480641..7481612 NW_001867424 olfactory receptor 8S1-like LOC100057699 __SEG__ Chr6 {Equus caballus} MALGNHSTITQFLLLGLSADPHIQTVLFVLFLDIYLLTIMGNLTMMLVIRADSHLHTPMYFFLSHLSFLDFCFSSVTVPKMLKDLLSEIKTISARGCLIQGFFVLITAGT
EVGLLSVMAYDRYAAICHPLLYGQMMRKQLCVQLVWGSWGLGFLNAFINILLAANLDFCENHTISHYSCEVPSLFPLSCSDVSNNLTVLLCSSLLLGLGTLLPIISSYAC
IVSTILSISSTSGRSKAFSTCSSHLIAVAFFYGSGFVRYLMPTSGSSLELIFSVQYGVVTPMLNPLIYSLKNKEVKAAVRRILGSVCHFPSGRIKLKDNGESR*
174 >lcl|XP_001491037.2|Plus1complement(28437552..28438490) NW_001867389 olfactory receptor 12D3-like LOC100057747 __SEG__ Chr20 {Equus caballus} MENITTVNEFLLLELTSIQELQPIVFVTFLILYVIDLFGNVSILVIVISEPRLHSPMYFFLGNLSFLDICYSSVTLPKLMSNLLSTHKTISFIGCITQLHFFHFLGGTEA
LLLTIMGFDWFVAICYPLHYTIIMNPQMRILLAAVAWLISFFYALMHSVMTASLNFCHSQKLRYFFCDVKPLLELACGDIRLNQWLIFIVTCSLAMASCFFTLLSYFYII
GFLLFKSRTCSVLHKALSTCASHFMVVSLFYGTVALTYITPTSATSVIQERFVAVIHTTVPPVLNPLIYTLRNKEVMSALRRVFGRKFKLFV*
175 >lcl|XP_001491060.2|Plus112157708..12158649 NW_001867414 olfactory receptor 2A2-like LOC100057789 __SEG__ Chr4 {Equus caballus} MGSNQSWVTEFVLVGFELSADVEVLLLWVFSLFYIFSLLANGVILGLICLDSSLHTPMYFFLSHLSVIDMSYASTNVPKMLANLVSQNRTISFVPCIMQTFLYWSFAITE
CLLLVVMSYDRFVAICHPLQYTGIMNWRVCTVLAVTSWSCGFILALVHAILLLRLPFCGPREVNHLFCEILSVLKLACADTWINQVVILAVCVFGLVGPLCLMLVSYMRI
LWAILKIQSKEGRTKAFSTCLSHLCVVGLFFGIAMVVYMVPDSSQREEREKILSLFHSLFNPMLKPLIYSLRNAQVKGALYRALQKKRPHLKG*
176 >lcl|XP_001491062.1|Plus1complement(421516..422595) NW_001867422 c-X-C chemokine receptor type 2-like isoform 1 LOC100058291 __SEG__ Chr6 {Equus caballus} MTIILQDVWNDTDLWLWFGDDYGNFTDILPTGTSYSPCSMDPETLNKYAVVVIYALVFLLSLLGNSLVMLVILYSRIGRSVTDVYLLNLAMADLLFALTLPIWAASKAKG
WTFGTVLCKLVSLLKEVNFYSGILLLASISVDRYLAIVHATRTLTQKRHWVKFICLGIWILSFILALPVFLFRKAITSPSSVLVCYEDMGANTTKWRMVMRVLPQTFGFL
VPLLVMLFCYGLTLRTLFQAHMGQKHRAMRVIFAVVLVFLLCWLPYNLVLVSDTLMRLQVIQETCVRRNDINRALDATEILGFFHSCLNPLIYAFIGQKFRHGLLRIMAI
HGLVSKEFLAKDSRPSFVGSSSGNTSITL*
177 >lcl|XP_001491063.2|Plus17494199..7495137 NW_001867424 olfactory receptor 8S1-like LOC100057793 __SEG__ Chr6 {Equus caballus} MALGNHSNITEFILIGLSDNPNVKALLFVIFLEIYILTIMGNVMMLLVIRADSHLHTPMYFFLSHLSFVDISFSSVTVPKMLENLLSQRKTVSVEGCLAQVFFVCVAAGT
EACLLSVMAYDRYAAICHPLLYGQIMSKQLYMQLVWGSWGLGFLDALINICLATNMVFCEAKIIPHYSCEMPSLLPLSCSDTSRNLIVLLCSTLLHGLGTFLLVFLSYAR
IIATILSISSNSGRSKTFSTCSSHLTAVTLYYGSGFLRYLMPNSGSSMELIFSVQYNVVTPMLNPLIYSLKNKEVKAALKRTLEKYVQHIRS*
178 >lcl|XP_001491067.2|Plus128421536..28422459 NW_001867389 olfactory receptor 12D2-like LOC100057798 __SEG__ Chr20 {Equus caballus} MLNQTSVTEFLLLGVTDIQVLQTFLFVVFLTIYFVSVTGNGIILMVVISDAKLHSPMYFFLGNLSCLDICYSTVTLPKMLENFLSTHKAISFLGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLHYPLIMNHQLCTQMAIIIWIIGFFHALLHSIMTSRLNFCGSNHIHHFFCDVKPLLELVCGNVELNQWLLNTVTGTIGMGPFLITLISYFYII
LYLFFKTHSCSLLHKALSTCASHFMVVILFYAPVVFIYIRPASGSSMDQDRVIAIMYSVVTPVLNPLIYTLRNKEVKGALSRVIRRL*
179 >lcl|XP_001491070.2|Plus1complement(12919542..12920468) NW_001867368 olfactory receptor 5AS1-like LOC100057804 __SEG__ Chr12 {Equus caballus} MLQSNYTMPMEFLLVGFTDSLPLRVTLFLVFLMVYTLTLVGNMGLIILVNISSSLQTPMYYFLSNLSFLDISYSTAITPKMLVNFLASRKGISPYGCALQMFFFGCFADA
ECLILAAMAYDRYAAICNPLLYPTLISRRVCICFIVLAYFSGSVTSMVHVCLTFRLPFCDSNIVNHFFCDIPPLLALSCADTHFNELLLFALCGFIQTTTFVFIFISYFC
ILITVLSIKSSGGRSKTFFTCASHLVAVTLFYGTLLFMYLRPTTSYSLDTDKIVAVFYTVVFPMLNPIIYTFRNKDVKNAFKKLLERN*
180 >lcl|XP_001491073.2|Plus113201385..13202308 NW_001877047 olfactory receptor 13H1-like LOC100057811 __SEG__ ChrX {Equus caballus} MAMDNVTAVFEFLLIGISNYPEWRVTFFTFLLITYLSTLLGNGLIIFLVYVDPHLHTPMYFFLSNLSFLDICYGTVSMPQALVHCFSTYLYLSYPRCLTQMSVSLVLATA
ECLLLAVMAYDRVVAISNPLRYSVVMNNPVCVWLAATSWVASLVVTALLLLSLQLHFCGAVVNHFVCEIRSLLKLTCSNTSLNELMIFITGIFSLFLPFGFVLLSYVRIA
PAVLRIHSAQGRLKAFSTCGSHLTVVTIFYGAAISTYMIPQSKLSPDQDKFISLFYGALTPVLNPLIYSLRNKDVKRAIRKVTAKRA*
181 >lcl|XP_001491110.2|Plus11149040..1149987 NW_001867401 olfactory receptor 7A17-like LOC100057876 __SEG__ Chr29 {Equus caballus} MEPGNNTQISGFLLLGFSEKPQWQLVIFGLFLTMYLITVCGNLLIILTVSSDSLLHTPMYFFLCNLSFVDICFTSTTIPKMLWNIQTQSKVITYEGCITQIYFLIHFGVL
DIFLLTVMAYDRFVAICHPLHYTVIMNHRLCGLMILGSWIVCILNSLLQSLTALRLSFCTNLEIPHFFCELNQMVQLACSDTFLNNVVMYFAAVLLGGGPFAGILYSYSK
IVSCIRGISSAQGKYKAFSTCVSHLSAVSLFYCTVLGVYLSSAATHSSHSSAIASAMYTLVTPMLNPFLYSLRNKDIKKALKSFFVKETTILSKH*
182 >lcl|XP_001491113.2|Plus112199065..12199997 NW_001867414 olfactory receptor 2A2-like LOC100057880 __SEG__ Chr4 {Equus caballus} MGSNQSWATEFVLVGFELSADVEVLLFWIFSLFYIFSLLANSVILGLICLDMSLHTPMYFFLSHLSVTDMSYASSNVPKMLANLLNQNRTISFVLCIMQTFLYLSFAHTE
CLLLVVMSYDRFVAICHPLHYTVVMNWRVCTVLAVSSWSCGFILALVHAILLLRLPFCGPREVNQLFCEIMSVLKLACADTWINQVVILAASVFVLVGPLCLMLVSYMRI
VWAILKIQSKEGRTKAFSTCLSHLCVVGLFFGIAMVVYMVPNSNQREEREKILSLFHSLFNPMLNPLIYSLRNAQVKGALYRALQKKRPT*
183 >lcl|XP_001491114.2|Plus17510875..7511810 NW_001867424 olfactory receptor 8S1-like LOC100057883 __SEG__ Chr6 {Equus caballus} MALGNHSTITQFLLLGLSADPHIQSVLFVLFLDIYLLTIMGNLTMMLVIRADSHLHTPMYFFLSHLSFLDLCFSSVTVPKMLKDLLSEIKTISVSGCLAQGFFVLISAGT
EVGLLSVMAYDRYAAICHPLLYGQMMRKQLCVQLVCSSWSLGVLNAFINIFLAANLDFCEKYTINHYSCEVPSLFPLSCSDVSNNLIALFCSSLLHGLGTFLPIVSSYAC
IVSTILSISSTSGRSKAFSTCSSHLTAVSFFYGSAFLRYLMPTSGSSLELIFSVQYSVVTPMVNPLIYSLKNKQVKAAVRRTLGKYLQCSG*
184 >lcl|XP_001491119.2|Plus1complement(28303409..28304365) NW_001867389 olfactory receptor 12D3-like LOC100057888 __SEG__ Chr20 {Equus caballus} MGNVTTVNEFLLLGLTSVQGLQPFFFVIFLIIYLINLVGNGAILVVVILESKLHSPMYFFLGNLSCLDICYSSVTLPKVLINLLSTRKAISFLGCITQLHFFHFLGSTES
ILLAIMAFDRFVAICNPLRYAVIMNPQMCILLAVVAWFTSFFYALMHSVMTARLNFCRPQKLNHFFCDVKPLLELACSNTLLNQWFLSVVTGSISMGAFFLTLLSYFYII
GFLLFKNQSCRILHKALSTCASHFTVVCLFYGPVGFTYIRPASATSMIEDRMVAITYSAVTPVLNPLIYTLRNKEVMLALKKIFVRKLFKDCQQHHWD*
185 >lcl|XP_001491145.2|Plus17522981..7523937 NW_001867424 olfactory receptor 8S1-like LOC100057935 __SEG__ Chr6 {Equus caballus} MALGNHSTITQFLLLGLSADPHIQSVLFVLFLDIYLLTIMGNLTILLVIRADSHLHVPMYFFLSHLSFLDLCLSSVTVPKMLKDLLSEIKAISVRGCLAQGFSIFITAGT
EGFLLSVMAYDRYAAICHPLLYEQMVRKQLCLQLVWGSWSLGFLNALINILPASNLDFCENHTISHYSCEIPSLFPLSCSDVSTNLLVLLCSTLLHGLGTLLPIISSYAR
IVSTILSISSTSGRSKAFSTCSSHLTAVSFFYGSGFLRYLMPTSASSLELIFSVQYSVVTPMVNPLIYSLKNKQVKAAMRRTLGKYLPCSSWKSKAKG*
186 >lcl|XP_001491147.2|Plus1complement(28286386..28287324) NW_001867389 olfactory receptor 12D3-like LOC100057940 __SEG__ Chr20 {Equus caballus} MENMTTVNEFLLLELTSIQELQLIIFMTFLILYVIDLFGNGSILVVVISEPRLYSPMYFFLGNLSFLDICYSSVTLPKLMSNLLSTHKTISFIGCITQLHFFHFLGGTES
LLLTIMGFDRFVAICYPLHYTIIMNPQMCILLAAVAWLISFFYALMHSVMTACLNFCHSQKLRYFFCDVKPLLELACGDIRLNQWLIFIVTCSLAMASCFFTLLSYFYII
GFLLFKSRTCSVLHKALSTCASHFMVVSLFYGTVALLYIPPMSATSVIQERFVAIIHTTVTPVLNPLIYTLRNKEVMSALRRVFGRKLKLFV*
187 >lcl|XP_001491161.2|Plus1complement(7543379..7544311) NW_001867424 olfactory receptor 8S1-like LOC100057977 __SEG__ Chr6 {Equus caballus} MALGNHSTVIELFLLGLPVDHHIQVLLFVLFLAICLFALSGNLLMILFIRANSHLHAPTYFFLSHFSFLDLCCSSVTVPKMLENILSEKKTISVEDCLTQAFFVFDSGGR
ELCLLAVMAYDRYAAICYPLLYGQMMSNELCVGLVWGSWGLAFLDGFINTLLAWNLDFCETQVISNFICEIPSLFPPSCSNSSNNFEAFLFSVLLHAFGTFLLVFSYARI
ISTILSISSTLGRSKAFSTCSSHLTAVTLFYGSGLLRCLMPISGSPCELVFSMQYCVITPLVNPLVYSLKNKELKASLKNMLQKNLQHLR*
188 >lcl|XP_001491166.2|Plus128241017..28241961 NW_001867389 olfactory receptor 2B2-like LOC100057985 __SEG__ Chr20 {Equus caballus} MWINNQSSLDDFILLGFSDRPWLETPLFVIFLVAYIFALFGNISIILVSHLDPQLDSPMYFFLSNLSLLDLCYTTSTVPQMLVNLRGPEKTITYGGCVVQLYIFLALGST
ECILLAAMAFDRYVAICKPLHYPIIMNQRRCIHMATGTWISGFANSLVQSTLTMLAPRCGQRVIDHFFCEVPALLKLACTDTRINEAELNVLGALLLLVPLAFILGTYVF
IAQAVMRIRSAESRWKAFNTCASHLLVVSLFYFTAISMYVQPPSSYSRDRGKIMALFYGIVTPTLNPFIYTLRNKDVKAALRRTLTKEFWVKRK*
189 >lcl|XP_001491170.3|Plus114449855..14450793 NW_001867424 olfactory receptor 6C2-like LOC100057988 __SEG__ Chr6 {Equus caballus} MRNHSAITTFIIMGLTNDPQLEILVSAFLFITCMLSVVGNLTIISLILVDSHLKTGMYFFLQNFSFLELSFTKACIPAYLYIISSGDRAITIKACFSQIFFVVLFGATEF
FLLAVMSYDRYVAICKPLHYVTIMNSRVCRNLILCCWVSGLLVILPPLGLSLQLEFCDSVIEHFYCDASPILKNSCSETWFTEQLVIVCAVLTFIMMLFCVVLSYIYIVS
MVLRSPSAQQRKKAFSTRSSHMIVVSITYGSCIFMYIKPSAKDEVAINKAVSLLTMSVAPLLNPFIYTLRNKQVKQSFHDTLKTFVFHSKKQ*
190 >lcl|XP_001491196.1|Plus1496982..497974 NW_001867422 G-protein coupled bile acid receptor 1-like LOC100055590 __SEG__ Chr6 {Equus caballus} MTPNGTREAPSPIPVGALGLFLALASLIVAANLLLALGIAKDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWSQSRRGYWSCLFLYLAPNFSFLSLLANLLLVHGER
YMAVLRPLRPRGSPRLALLLTWASPLLVASLPALGWNHWAPGANCSSQAVFPAPYLYLEVYGLLLPAVGAVVLLSARVLLTAHRQLQDIRRLERAVCRGAPSALARALTW
RQARAQAGATLLFGLCWGPYVATQLLSVLAFEHRPPLGAGTLLSLISLGSASAAAVPVAMGLGDQRYTAPWRAAARRWLRALQGRVSGDSPGPATAYHTSSQSSVEPNLN
*
191 >lcl|XP_001491197.2|Plus1complement(7561885..7562841) NW_001867424 olfactory receptor 8S1-like LOC100058025 __SEG__ Chr6 {Equus caballus} MASGNHSSITEFILLGLSADPQVQALLFALFLMIYLLTLLGNLLMILVIHTDSNLHTPMYFFLSHLSFQDLFYSSVTVPKMLENLLSQRKAISVKGCLAQVFFVFATTGI
EACLLSVMAYDRYAAICHPLLYCQVMSKQLCVRLVWGSWVVAFLDALINILLALNLDFCEVQTIHHYSCELPSLLPLSCSDVSTNSAMLLCSVILHAIGTCLLIIFSYAC
IVSTILSISSATGRSKAFSTCFSHLTAVILFYGSAVLRYLMPTSGSPLELILSIQYSVIIPLVNPLIYSLKNKEVKAALRRTVLKYLQRLRQHRRERT*
192 >lcl|XP_001491229.2|Plus128207848..28208792 NW_001867389 olfactory receptor 2B2-like LOC100058073 __SEG__ Chr20 {Equus caballus} MWINNQSSLDDFILLGFSDQPWLETPLFVIFLVAYIFALFGNISIILVSHLDPQLDSPMYFFLSNLSLLDLCYTTSTVPQMLVNLRGPEKTITYGGCVVQLYIFLALGST
ECILLAVMAFDRYVAICKPLHYPIIMNQRRCIHMATGTWISCFVNSLVQSVLTVLTPRCGRRVIDHFFCEVPALLKLACTDTRINEAELNVLAALLLLVPLTLILGSYVF
ISRAVMRIRSAESRWKAFNTCASHLLVVFLFYFTAISMYVQPPSSYSRDRGKIMALFYGIVTPTLNPFIYTLRNKDVKAALRRALTKDFWVKTR*
193 >lcl|XP_001491232.2|Plus1complement(13051364..13052269) NW_001877047 olfactory receptor 10A7-like LOC100058082 __SEG__ ChrX {Equus caballus} MTQVSEFILLGLGDLHGLQFLLFGVFLVIYVMTLISNIVILTVVSTDHSLHTPMYFFLGHFSCLEISYTTTIEPTMLRTLLSAHVPISFPGCACQFYFFAALVATECFFL
AVMSYDRYIAICNPLHYSTIMDHCGCLQLAGASWVAGFVAPILLMVFIFRLTFCAANEIDHFFCDLKPIMKLACTDTQVAEIISFICTSLFALGPFLLNLASYTCIISTI
LRIPSITGKQRAFSTCSSHLTVVCLYYGTLGIVYGFPSGPQDEDLLKLLSLLYTVLTPALNPIIYTLRNKDIKVALRKLVR*
194 >lcl|XP_001491250.2|Plus112263909..12264841 NW_001867414 olfactory receptor 2A2-like LOC100058108 __SEG__ Chr4 {Equus caballus} MGSNQSWVTEFVLVGFQLRADVEVLLLWVFSLFYIFSLLANGVILGLICLDPSLHTPMYFFLSHLAIIDISYASTNVPKMLANLVSQNRTISVVPCIMQTFLYWGFAATE
CLILVAMSYDRFVAICHPLHYTVIMNWRVCMVLAVTSWSCGFIQSLVHAILLLRLPFSGPREVNHLFCEILSVLKLACADTWINQVVIFATCVFVLVGPLCSMLVSYMRI
LWAVLKIQSKEGRTKAFSTCLSHLCVVGLFFGIAMVVYMVPESNQREEQEKILSLFHSLFNPMLNPLIYSLRNAQVKGALYRALQKKRPT*
195 >lcl|XP_001491262.2|Plus1complement(14479152..14480081) NW_001867424 olfactory receptor 6C4-like LOC100058122 __SEG__ Chr6 {Equus caballus} MKNKTTFTEFILMGLTSQPELQVVIFIFLFLAYLLSVLGNLTIIILTLVDPHLQTPMYFFLRNFSFLEISFTSIFIPRFLTSMTTGNKVVSFAGCMTQYFFAIFLGGTEF
YLLASMSYDRYVAICKPLHYLTIMSSRVCIQLVFCSWLGGLLAILPPIILMSQVDFCASNVLNHYFCDYGPLLELACSDTSLLELMVILLAVVNLVVTLLLVTLSYTYII
RTILRIPSAQQRTKAFSTCSSHMIVISLSYGSCIFMYINPSAKEEGAFNKGMAVLITSITPLLNPFIYTLRNQQVKQAFKDTIKNIVKL*
196 >lcl|XP_001491285.2|Plus112313124..12314056 NW_001867414 olfactory receptor 13-like LOC100058156 __SEG__ Chr4 {Equus caballus} MRDNMTSIMEFILLGFPFSPRIQVLLFGLFSLFYAFTLLGNGVILGLISLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLNPARPISFADCMTQTFLFLTFAVTE
CLLLVVMSYDRYVAICHPLRYSAIMSWRVSVTLAVTCWTIGVLLSLVHLVLLLSLPFCRPQKINHFFCEIMAVLKLARADTHINEIAVLAGAISVLVGPFSSIVVSYMCI
LGAILRIQSGEGQRKAFSTCSSHLCVVVLFYGTAIITYVGPQHGNPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVKNALKTVLRRERVL*
197 >lcl|XP_001491289.2|Plus1complement(13046735..13047664) NW_001867368 olfactory receptor 4A47-like LOC100058168 __SEG__ Chr12 {Equus caballus} MEPRNNVTYVVLLGLTQNPKEQKILFVMFLLFYILTMVGNMLIVVTVTFTKSLKSPMYLFLASLSVMDVIYSSSITPRLISDLFCGNSTISFQFCMAQLFTEHFSGGSGV
FLLLVTAYDCYVAICKPLHYLVIMRQWVCIVLLLVCWIGGFLHSVIQLSIIYGLPFCGPNVIDYFICDMYPLLKLVCTDTYVIHYLVMANGGLICTIVFLLLLISYGVIL
HSLKKLSHEGRWKAFQTCISHITVVVFFFLPCIFMYVRPAKTFSIDKPLSLFYTVITPMPNPLIYTLRNSEVTNAMKKLWRRNVVSCGK*
198 >lcl|XP_001491298.1|Plus1complement(6584301..6585305) NW_001867382 G-protein coupled receptor 12 isoform 1 GPR12 __SEG__ Chr17 {Equus caballus} MNEDLKVNLSGLPRDYLDAGAAENASAAVSSQVPVVKPEPELVVNPWDIVLCTSGTLISCENAVVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLIINFVFAYLLQSE
ATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLIMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVCFLFMFALMLQLYIQI
CKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPPSLSQRARS
PSDV*
199 >lcl|XP_001491303.2|Plus112321556..12322497 NW_001867414 olfactory receptor 2A1/2A42-like LOC100058194 __SEG__ Chr4 {Equus caballus} MKENQTMVMEFILLGFRLGPRIQMLLFGLFSLFYAFTLLGNGVILGLISLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLNPARPISFAGCMTQTFLFLSFAHTE
CLLLVVMSYDRYVAICHPLRYSVIMSWRVCITLVVTSWTCGVLLALVHVSLILRLPFCGPHEINHFFCEILSVLKLACADTRLNKVVIFVASVFVLVEPLCLVLVSYMRI
LFAILRIQSGEGCRKAFSTSSSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKILFLFYSLFNPMLNPLIYSLRNSEVKGALRRAVCKESHSQLE*
200 >lcl|XP_001491304.2|Plus17612716..7613666 NW_001867424 olfactory receptor 8S1-like LOC100058198 __SEG__ Chr6 {Equus caballus} MALGNHSTISEFILLGLSTDPHVQALSFVLFLAIYLLTLLGNLMMLLVIRTDPHLHTPMYFFLSHLSFLDLCYSSVTLPKLLENLLSQKKMISVEGCLAQVFFLFDTGGT
EACLLTVMAYDRYVAICHPLLYSQMMSNQLCKGLVCGSWGLSFLDAFINILLALDFDFCRDQSIPHYSCELPSLFPLSCSDISTSFTVLLCSSLLHGLGTCFLIIFSYTL
IVSTILGISSSSGRIKTFSTCSSHLTAVLLFYGSAFLRYTMPTSGSPLELVFSVQYSVVTPLMNPLIYSLKNNEVKAAVRRTFRKYLQYMLTKDRR*
201 >lcl|XP_001491311.3|Plus128174300..28175262 NW_001867389 olfactory receptor 10C1-like LOC100058205 __SEG__ Chr20 {Equus caballus} MNLNCSLWQDNSMSVKLFAFTKFSEVTEQCFLLFTLVLLMFLTSLTGNALIALAIWTNPVLHTPMYFFLTNLSILEIGYTCSIIPKMLQSLVSEARGISWEGCAMQMFFF
SLFGISECCLLAAMAYDRYVAICSPLHYAARMSREVCAQLAMVSWGVGCVVSLGQTNNIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFVVAVLCISSPFLLI
VASYGRIVAAVLFMPSPEGRQKALSTCSSHLVVVTLFYGSASVTYLRPKATHSPGIDKLLALFYTVVTSMLNPIIYSLRNKEVKAALQRTIAGKKVLTPE*
202 >lcl|XP_001491314.3|Plus1complement(14507381..14508319) NW_001867424 olfactory receptor 6C2-like LOC100058210 __SEG__ Chr6 {Equus caballus} MKNYTALTTFILVGLTDDPNLQILLFIFLFLTYLSSVVGNLTIITLTLVDSHLKTPMYFFLRNFSILQVSFTTVCIPRFLYTMASGDNTVTYNACAAQLFFVVTLSVTEF
FLLTAMSYDRYVAICKPLHYTTIMNNRVCIRFLVSCYVLSLIIVLPPYIMGFEFEFCDSNVIDHFGCDAAPILKIACSDTEFIERVVLVLAVLTLLFTVVCVVMSYTYII
RTILRFPSVQQRKKAFSTCSSHLIVVSITCRSCIFIYIKPHAKEGLAVNKAVSVLTTSVAPAMNPFIYTLRNKQVVQAFKDMNKRVASISKN*
203 >lcl|XP_001491339.2|Plus1complement(28160439..28161356) NW_001867389 olfactory receptor 2G3-like LOC100058247 __SEG__ Chr20 {Equus caballus} MINESLAGDFILVGFSDQPQLEKILFVGVLISYLLTLVGNTAIILVSCLDPMLHTPMYYFLTNLSFVDLCFTTSIVPQLLWNLHGSAKTITPVGCAIQLYVSLALGSTEC
VLLAVMAFDRYAAVCRPLHYATVMHSRLCQSLAGMAWLSGMGNTLIQGTITLWLPRCGNRRIYHFICEVPAMIKLACVDIHANEVQLFMASLVLLLLPLALILISYGYIV
QAVMRIRSAQAWRKALGTCGSHLLVVSLFYGTITAVYIQPNSSYAHREGKFITLLYTVLTPTLNPLIYTLRNKDVKGALKRLVRR*
204 >lcl|XP_001491344.2|Plus112926167..12927132 NW_001877047 olfactory receptor 11A1-like LOC100058259 __SEG__ ChrX {Equus caballus} MEKLTRSQELLTSVGPRNTTMMVTEFIILGFGDLKELGPLLFLVFGIVYLATISGNLLLVVLVSTQRGLQTPMYFFLANLSCLEVCYTSNIVPRMLVDLLRTNRVISTVG
CIIQLYFFGALGSTECYLLAVMSCDRYLAVCRPLHYPTLMYGTICVGLAIGSWVGGFTVAAAFQVAMVSSFTFCGGNEIDHFFCDLKPLQKLSCSDPHLVNLVCMSLTVL
VTLVPFGLTLASYWRILSTVLHIPSVTGRQKVFSTCSSHLVVVTLFYGTLILVYAVPLAGEVSVLNKTFSLLYTIVTPMCNPLIYSLKNKDVKEALKKLRI*
205 >lcl|XP_001491345.1|Plus1complement(12910260..12911849) NW_001877040 retinoic acid-induced protein 2 RAI2 __SEG__ ChrX {Equus caballus} MDDLQSQNLSMDMTDSSPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNSNA
TYVMTTQGPVQLPVVLEQHVFQHLNSPLVLPQEAPCSSSAIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGALGPPPCQPPPGYAPVPPQPFNSP
LSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSPSFPKAPSSFGLHPFKGTQTPLEKEELKPFDIIQPREYFQLSRHTVIKMGSENEALDLSMKSVPWLKTG
EVSPPICQEDAALDLSLAAHRKSEPLPETLYDSSGSVDSPGHTLMEKLPGSMEMPFGPATPREASAMMDSHMGSSDTAEPLSQPSQPSSEVKAENNIEVGSESQVAKVIV
SVEDAVPAVFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEEAMGNMESLRKPVKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
206 >lcl|XP_001491358.2|Plus1complement(16267808..16268758) NW_001867396 olfactory receptor 2K2-like LOC100058280 __SEG__ Chr25 {Equus caballus} MQGENLTIWSLFFLEGFSRYPELEIVLFVFSLVMYLITLLGNSTLILIAVLDSCLQSPMYLFLGNLSFMDICYTSASIPTLLVNLLSCQKTIIFSGCAVQMYVSLAMGST
ECVLLAVMAYDRYVAICNPLRYPIVMNRQVCVQLATVSWVTGCLTALLEASFALQIPLCGNLIDHFTCEILAVLKLACTSSLLMDMVMLVVSVLLLPIPLLLICISYVFI
LSTVLRISSAEGRNKAFSTCGAHLTVVILYYGAALSMYLKPSSSSSQEIDKVISLLYGVLTPMLNPIIYSLRNKEVKDAMKRLLGRITLHQTRENL*
207 >lcl|XP_001491366.2|Plus17628101..7629057 NW_001867424 olfactory receptor 8S1-like LOC100058292 __SEG__ Chr6 {Equus caballus} MASGNHSSITEFILLGLSADPQVQALLFALFLMIYLLTLLGNLLMILVIHTDSNLHTPMYFFLSHLSFQDLFYSSVTVPKMLENLLSQRKAISVKGCLAQVFFVFATTGI
EACLLSVMAYDRYAAICHPLLYCQVMTKQLCVRLVWGSWVVAFLDALINILLALNLDFCEVQTIHHYSCELPSLLPLSCSDVSTNSAMLLCSVILHAIGTCLLIIFSYAC
IVSTILSISSATGRSKAFSTCFSHLTAVILFYGSAVLRYLMPTSGSPLELILSIQYSVITPLVNPLIYSLKNKEVKAALRRMMLKYLQCLRQHRREIT*
208 >lcl|XP_001491370.1|Plus11560149..1561204 NW_001867427 sphingosine 1-phosphate receptor 2-like LOC100058299 __SEG__ Chr7 {Equus caballus} MGSLYSEYLSPSKVLEHYNYTKETLDKQEASRQVASSLIILLCCAIVLENLLVLIAVIRNSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGPVTLRLTPVQWFAREGS
AFITLSASVFSLLAIAIERHVAIAKVKVYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGLLEACSTVLPLYAKQYVLCVVSIFSIILLAIVVLYIRIYCVVRSSHP
DVTGPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVRACPILYKAQYFFAFATLNSLLNPVIYTWRSQDLRQEVLRLLLCWRPAARMQGRRAGTPGHSLLPLRSSS
SLERSMHMPTSPTCLEGNTEV*
209 >lcl|XP_001491391.2|Plus128124198..28125118 NW_001867389 olfactory receptor 2J3-like LOC100058338 __SEG__ Chr20 {Equus caballus} MEKINASFENYFVRLGFSNWPHFEVVLFVVILMFYVMTLIGNLFIIILSHMDSHLHTPMYFFLSNLSFLDLCYTTSAIPQLLVNLWGPEKTISYAGCMIQLYFFLALGTT
ESVLLVVMSYDRYVAVCRPLHYTVLMNPRFCYLLAVASWVSGFTNSALHFSFTFCVPLCGHHQVDHFFCEVPALLRLSCVDTHANELTLLVTSSIFVFIPLILILSSYGA
ITRAVLRMQSTTGRQKVFGTCGAHLTVVSLFYIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVKVAVKRLMW*
210 >lcl|XP_001491394.3|Plus1complement(14544151..14545089) NW_001867424 olfactory receptor 6C2-like LOC100058345 __SEG__ Chr6 {Equus caballus} MKNHTAVTTFILLGLTDDPKLQILLFVFLFLTYVLSVAGNLIIITLTLLDSHLKTPMYFFLRNFSFLEVSFTTVCIPRFLYTITTGDNTITYNACVTQLFFVVLFGATEF
FLLAAMSYDRCVAICKPLHYTTIMNTRDCATLVLSCWFAGLLIILPPLGLGLQLEFCDSNIIDHFVCDASPVLQITCSDTVLIERVILSFAVLTLITTLVCVVLSYTYII
KTILRFPSAQQRKKAFSTCSSHVIVVSVTYGTCIFVYIKPSAREGVAINKVVSVLATSVAPVLNPFIYTLRNRQAKDAFKDTVKRIVFLTKK*
211 >lcl|XP_001491397.1|Plus13057292..3059253 NW_001867406 rab proteins geranylgeranyltransferase component A 2 CHML __SEG__ Chr30 {Equus caballus} MADSLPTEFDVIVIGTGLPESILAAACSRSGQRVLHLDSRSYYGGNWASFSFSALLSWLECQQNSDPGEEGSAAWQDLIHETEEAITLCSKDKTIQHTEVFCYASQDVDD
NIEETDALQRTPSWVAPTPLTNPLVPACLSEETPSLCVTRHEMPAKDTPENDGEISPEVTDVEETLAKENNRGDKTCTHAVSDGAKDENKPIVEDSTDQPKRNRITYSQI
VKEGRRFNIDLVSKLLYSQGLLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKALTMVEKRMLMKFLTFCLDYEQHPEEYQAFMQCSFSEYLKTKKLT
PNLQHFVLHSIAMTESSCTTIDGLKATKNFLQCLGRFGNTPFLFPLYGQGEVPQCFCRMCAVFGGIYCLRHKIQCLVVDKESGRCQAIIDHFGQRINAKYFIVEDSYLSE
DTCSNVQYKQISRAVLITDQSVLKTDSDQQISILIVPPAEPGMCAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVRKLFIPYAETETDREGLRKPRLLWALY
FNMRDSSEISRSSYNGLPSNVYVCSGPDCGLGNEHAVRQAQTLFQEIFPTEEFCPPPPNPEDIIFDGDDKQPEVPGTTNRIIAKLESSEDCKNLENHENHLQN*
212 >lcl|XP_001491413.2|Plus17658898..7659836 NW_001867424 olfactory receptor 8S1-like LOC100058373 __SEG__ Chr6 {Equus caballus} MALRNHSTLTEFILVGLSDDPHIEALLFVLFLGIYLLTLMGNLMMLLVIRVDSHLHKPMYFFLSNLSFLDLCLSSVTVPKLVEDLLSEKKTISVEGCLTQVFFVFLTAGN
EACLLSVMAYDRYAAICHPLLYGQVMSNQLCVKLVLASWGLASLNSVAIVLLAINLDFCEAQTIHYYTCELPSLFPLSCSDISINISILSFSTILLGLGNFLPIFFSYIR
IISNILSISYKTGRRKSFSTCSSHLIAVILFFGSGMLRYLTPPSGSFLDLLSSLQYSVITPMLNPLIYSLKNKEVKIAVKRRLGKYLQYFRW*
213 >lcl|XP_001491420.2|Plus128113732..28114658 NW_001867389 olfactory receptor 2J3-like LOC100058379 __SEG__ Chr20 {Equus caballus} MEKINASFENYFVRLGFSNWPHFEVVLFVVILMFYVMTLIGNLFIIILSHMDSHLHTPMYFFLSNLSFLDLCYTTSAIPQLLVNLWGPEKTISYAGCMIQLYFFLALGTT
ECVLLVVMSYDRYVAVCRPLHYTVLMNPRFCYLLAVASWVSGFTNSALHFSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHTNELTLLVTSSTFVLIPLILILISYGA
ITRAVLRMQSTTGRQKVFGTCGAHLTVVSLFYIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVKVAVKRLMGCD*
214 >lcl|XP_001491423.2|Plus1complement(13124087..13125022) NW_001867368 olfactory receptor 5L1-like LOC100058385 __SEG__ Chr12 {Equus caballus} MAKENCTTVAEFILLGLAEVPELRVFLFLVFLLIYGVTVFSNLGMIALIQVSSRLHTPMYFFLSHLSFVDFCYSTIIVPKMLANILNEDKTISFLGCTVQFYLFCTCLVS
EVILLAVMAYDRFVAISNPLLYMVIMSRNLCVELVSCCYLCGTACSLIHLCLAVEIPSYRSNVINHFFCDLLPLLSLACSDVTMNELLLYIVATFNEIITIMIILTSYLF
ILITILKMDSAEGRCKAFSTCASHLTAIVVFHGTILFIYCQPSSGNNMDTDRVATVFYTVVIPMLNPLIYSLRNKDVKEALRKVVGCKVFS*
215 >lcl|XP_001491443.2|Plus17683991..7684926 NW_001867424 olfactory receptor 8S1-like LOC100058417 __SEG__ Chr6 {Equus caballus} MALRNHSIITEFILIGLSDDPHIEALLFVLFLGIYILTIMGNLTMLLVVRTDSHLHTPMYFFLSNLSFPDLCFSSVTVPKLLKDLLSEKKTISVEGCLTQVFFVFLTAGT
EAFLLSVMAYDRYVAICHPLLYGQLMSNQLCVKLVLASWGLASLNSVVIVLLAISLDFCEAQTVQHYTCELPSLFPLSCSDISISIDILICSILLHGFGTFLPVFFSYTR
IVSTILSISSTTGRSKAFSTCSSHLIAVILFFGSGLIRYLMPTSVSSLDLLSSLQYSAVTPMLNPLIYSLKNMEVKAAVKRTLGKYLQYFR*
216 >lcl|XP_001491449.2|Plus114572086..14573015 NW_001867424 olfactory receptor 6C4-like LOC100058428 __SEG__ Chr6 {Equus caballus} MKNKTTFTEFILLGLTSQPELQVVIFIFLSLTYLLSVLGNLTIIILTLVDPHLQTPMYFFLRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEF
YLLASMSYDRYVAICKPLQYLTIMSSRVCIQLVFCSWLGGFLAILPPIILISQVDFCASNVLNHYFCDYGPLLELACSDTSLLELMVILLAVVTLVVTLLLVTLSYTYII
RTILRIPSAQQRTKAFSTCSSHMIVISLSYGSCMFMYINPSAKEEGAFNKGMAVLITSITPLLNPFIYTLRNQQVKQAFKDTIKKIVKL*
217 >lcl|XP_001491466.2|Plus1complement(11041316..11042260) NW_001867414 olfactory receptor 9A4-like isoform 1 LOC100050381 __SEG__ Chr4 {Equus caballus} MMGNHSSATEFCLLGFPGSQELHHILFAMFFFLYSVTLAGNTVIIMIVCVDKRLHSPMYFFLGHLSALEILVTSIIVPVMLWGLLLPGMQTLSLTACVAQLFLYLAVGTT
EFALLGAMAVDRYVAVCNPLRYIIIMNSRTCIWVVIVSWVFGFLSEIWPVYATFQFTFCKSNLLDHFYCDRGQLLKLSCDDTLFTEFVLFLMAVVIIIGSLAPTVVSYTY
IISTILKIPSASGRRKAFSTCASHFTFVVIGYGSCLFLYVKPKQTQAAEYNKIASLLISLLTPFLNPFIFTLRNDKVKEALRDSMKGCCQLLKE*
218 >lcl|XP_001491473.2|Plus128079715..28080653 NW_001867389 olfactory receptor 10C1-like LOC100058467 __SEG__ Chr20 {Equus caballus} MSTNTSVVTEFILAGFSHLAGLQSLLFSLFLTVYLLTIAGNLLIVVLVSVDSALQSPMYFFLRILSALEIGYTSVTIPLLLHHLLSGQRHIPRSGCALQMFFFLFFGATE
CCLLAAMAYDRYAAICEPLHYPLLLSHQMCLQLAGSAWACGAMVGLGHTSFIFSLPFCGPNVIPHFFCEIQPILQLVCGDTSFSEMQIILAAALLILCPFGLILGSYGRI
LATIFQIPSAAGRRKAFSTCSSHLVVVSLFYGTGIFIYIRPKASYDPATDPLLSLFYAVVTPILNPIIYSLRNTDVKAALKRTIQKMRPAEI*
219 >lcl|XP_001491476.2|Plus114597168..14598121 NW_001867424 olfactory receptor 2AP1-like LOC100058471 __SEG__ Chr6 {Equus caballus} MKNKTMLTEFILLGLTDAPEMQVVVFTFLLLAYLLSITGNLTILILTLLDPHLQTPMYFFLRNFSFLEISFTNIFIPRVLISITTRNKSISFAGCFTQYFFAIFLGATEF
YLLAAMSYDRYVAICKPLHYTTMMSNRVCTQLVLCSWLAGLMVIIVPITLMSQQDFCASNRLNHYFCDYEPLRELSCSDTSLIEKIVFSVASVTLVATLVLVVLSYTFII
RTILKLPSAQQRTKAFSTCSSHMIVIALSYGSCFFVYLKPSTKEPGTFNKGVALLFTSVTPLLNPFIYTLRNQQVKQAFKDTVQKLMNLYRISELKP*
220 >lcl|XP_001491504.2|Plus128070882..28071841 NW_001867389 olfactory receptor 6Q1-like LOC100058512 __SEG__ Chr20 {Equus caballus} METANRTLVTEFVFLRFSNSPHLQLLFFSLFLLVYLLSLVSNALIVLIVALDGRLHTPMYFFICNLSLVELWYTTVTVPKMLANFLCSQGVISVPSCITQYYFFFSLVAT
ELFILTTMAFDRYVAICRPLHYQLLLSPQTCGTLAGVCWSVGFLCPMFPSFLLTQISFCTPNQINHFFCDADQIFRLSCTDTYAIQAVGYGLSTVIILGSLVFTMASYAQ
ILATILAMASAAAQRKTFSTCAAHLSVVTIYFGTLIFMYVRPAVKYESNINKIVAIFYSVITPLLNPLIYTLRNKDVKEALKMLVSRIQRICHSSWETQ*
221 >lcl|XP_001491527.2|Plus114615513..14616442 NW_001867424 olfactory receptor 6C4-like LOC100058554 __SEG__ Chr6 {Equus caballus} MKNQTILKEFILLGLTDSQEIQLVIFILLFLTYIFSIIGNLTIITLTLLDSHLQTPMYFFLQNFSFLEISFTSTFTPRLLISISTGNKSISFAGCFTQYFFAIFLGATEF
YLLAAMSYDRYVAICKPLHYATIMSNRVCTQLVLSSWLGGFLIIVSPIILTSQLDFCASNVLNHYYCDYGPLIEISCSDTRVLELVDYILAVVTLVVTLVLVVLSYTNII
WTILKIPSAQQRKKAFSTCSSHMIVISLSYGSCIFMYIKPSAKEGVAFNKGVAVLNTSVAPLLNPFIYTLRNKQVKQGFRDVASKTMSL*
222 >lcl|XP_001491559.2|Plus1complement(28037352..28038290) NW_001867389 olfactory receptor 12D3-like LOC100058588 __SEG__ Chr20 {Equus caballus} MENITTMNEFLLLELTSIQDLQPIIFMTFLILYMIDLFGNGSILVIVISEPRLHSPMYFFLGNLSCLDICYSSVTLPKLMSNLISTHKAISFLGCITQIHFFHFLGCTES
ILLAMMGFDRFVAICYPLRYTVIMNPQVCILLAAVAWFTSFFYALMHSVMTAHLNFCHSQKLNYFFCDVKPLLELACGDIRLNQWLIYIVTCSLAMASCFFTLLSYFYII
GFLLFKNRSCNVLHKALSTCASHFMVVSLFYGTVALTYITPASATSVIQERFVAIIHTTVTPMLNPLIYTLRNKEVMLALRRVFGKKLKQFA*
223 >lcl|XP_001491562.2|Plus114630626..14631561 NW_001867424 olfactory receptor 6C4-like LOC100058592 __SEG__ Chr6 {Equus caballus} MKNQTLTEFILLGLTENPELQIIIFIVLFLAYIFSFLGNLTIITLTLLDSHLQTPMYFFLQNFSFLEISFTSTLTPRLLISISTGNKSISFAGCFTQYFFAIFLGATEFY
LLAAMSYDRYVAICKPLHYATIMSNRVCTQLVLGSWLGGFLIIVSPIVMTSQLDFCASNVLNHYYCDYGPLIEISCSDTRVLELVDFILAVVTLVVTLVLVILSYTNIIW
TILKIPSAQQRKKAFSTCSSHMIVISLSYGSCIFMYIKPSAKEGVAFNKGVAVLNNSLAPLLNPFIYTLRNKQVKQAFKDVAIKIGHLYSF*
224 >lcl|XP_001491586.2|Plus1complement(28019883..28020812) NW_001867389 olfactory receptor 12D3-like LOC100058631 __SEG__ Chr20 {Equus caballus} MENYTTVNEFLLLGLISIQELQPVIFMIFFILYIINLLGNGAILLIIILEPRLHSPMYFFLGNLSCLDICYSSVTLPKLMSNLLSTRKAISFLGCITQIHFFHFLGCTES
ILLAMMGFDRFVAICYPLRYSVTMNPQVCILLAAVTWFTSFFYALMHSVMTARLKFCSQKLNYFFCDVKPLLELACGDIRLNQWLIYIVTGSLAMAACFLTLLSYCYIIS
FLLFKNRNCSVLHKALSTCASHFMVVSLFYGTVGLTYITPTSATSVKQSRFVAVIHTTVTPVMNPLIYTLRNKEVMLALKKVFGKKLFA*
225 >lcl|XP_001491589.2|Plus114647290..14648225 NW_001867424 olfactory receptor 6C76-like LOC100058635 __SEG__ Chr6 {Equus caballus} MANQNVLTVFFLQGLTDTKELQVAVFLLLLAAYPITVSGNLAIISLTLLDTRLQTPMYFFLRNLSCLEIWFQTVIVPKMLLNIATGTKTISFAGCITQDFFHIFLGATEF
FLLAAMGYDQYIAICQPLRYPILMSSRICTQLILTRWLGGFSFGIMPVILTSQLPFCDVHINHFFCDYTPLMEVVCSGPNVLEMVDFTLALGALLSTLALIALSYVQIIR
TIVRIPSVQERKKAFSTCSSRVIVVTMCYGSCFFMYVKPTPGKGVDLNKGVSLINTIITPFLNPFIYTLRNHQVKQVVKDLVRKMSWLQNK*
226 >lcl|XP_001491607.2|Plus1complement(28006855..28007811) NW_001867389 olfactory receptor 5V1-like LOC100058670 __SEG__ Chr20 {Equus caballus} MEGENQTALFEFIILGFSNLNELQFLLFTIFFVTYICTLGGNIFIILVTMTDPRLHTPMYFFLENLAFLDICYTTTNVPQMMAHLLSEKKSISYLGCMAQLFAFIFFVGS
ESLLLAAMAYDRYIAICKPLRYSVIMNKALYGQLAASCWTGGFLNSVVHTTLTFHLPFCGNNRINYFFCDIPPLLILSCGDTSVNELALLSIGVFIGWTPFLCTILSYLY
IISTILRISSAEGRQKAFSTCASHLIIVLLYYGSSIFTYVRPISTYALEKDRLISVLYSVVTPMLNPIIYSLRNKDIKQAVKVMGRKWQASSSLSFDV*
227 >lcl|XP_001491628.2|Plus1complement(27979913..27980866) NW_001867389 olfactory receptor 5V1-like LOC100058710 __SEG__ Chr20 {Equus caballus} MEGKNQTVLSEFIILGFSNLSELQFLLFTIFFLTYLCTLGGNIFVILVTMADPHLHTPMYYFLGNLAFLDICYTTTNVPQMMVHLVSKKKSISFGGCVAQLFAFIFFVGS
ECLLLAAMAYDRYIAIRKPLRYSVIMNKVLYSQLAASCWTGGFLNSVVHTVLTFRLPFCGNNQINYFFCDIPPLLILSCGDTSVNELALLSIGVFIGWIPFLCIVLSYLY
IISAILRIRSSEGRRKAFSTCASHLIIVLLYYGSAIFTYVRPISAYSLEKDRLISVLYSVVTPMLNPIIYTLRNKDIREAVKAVGRKWQPPIPSFNM*
228 >lcl|XP_001491651.2|Plus1<27950210..27951235 NW_001867389 olfactory receptor 14J1-like LOC100058753 __SEG__ Chr20 {Equus caballus} LFLLFFGFLNRIILSIFRVTMANLTSTSGFLLMGFSDDRKLQILHALLFLVTYLLALIGNLLIITITTLDYRLHSPMYYFLKHLSLLDLCFISVTVPQSIANSLMNNGYI
SLGQCILQVFFFIALASSEVAILTVMSYDRYVAICQPLKYETIMDPHACRHAVIAVWIAGGLSGLVHTAVNFSLSLCGERVIHQFFCDVPQMLKLACSSEFINEIAVAAF
TTSTAFICLISIVLSYVRIFSAVLRIPSAEGRTKVFSTCLPHLFVVTFFLSAAGFEFLRPPSNSQSAMDLMFSIFYTVIPPTLNPIVYSLRNEAMKAALRKVLSKEEFSQ
RKMYLKALCKL*
229 >lcl|XP_001491658.2|Plus1complement(4963965..4965824) NW_001867387 muscarinic acetylcholine receptor M3 CHRM3 __SEG__ Chr1 {Equus caballus} MQRTNQVKAEIFLTPSFLSFLPRLCQRVTMTLHNNNTTSPLFPNISASWIHGPSDAGLPPGTVTHFGSYNISRAAGNFSSPNGTTSDPLGGHTIWQVVFIAFLTGVLALV
TIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGL
AWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSMK
RSSRRKYGHCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVTDEELGTVDLERKASKLQAQ
KSMDDGGSFQKSFSKLPIQLESAVDTAKTSEVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCI
PKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL*
230 >lcl|XP_001491664.2|Plus110639525..10640454 NW_001867368 olfactory receptor 4B1-like LOC100058772 __SEG__ Chr12 {Equus caballus} MASTNNVTELIFTGLFRDPDVQRVCFVAFLIVYLATVVGNGLIVLTVSISKSLNSPMYFFLSQLSLVEISYSSTVVPKFITDLLAKIKTISLEGCLAQIFFFHFFGVTEI
LLLVVMAYDRYVAICKPLHYMNIMSHQVCQVLVAGSWLGGFVHSIIQILITIQLPFCGPNVIDHYFCDLQPLFKLTCTDTFVEGVIVLANSGLIALCSFLILVTSYIVIL
VNVRNHSAEGKRKALSTCASHITVVILFFGPAIFFYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKMAMRRLRGKKENVGME*
231 >lcl|XP_001491678.2|Plus127931697..27932641 NW_001867389 olfactory receptor 2B2-like LOC100058795 __SEG__ Chr20 {Equus caballus} MWINNQSSLDDFILLGFSDRPWLETPLFVIFLVAYIFALFGNISIILVSHLDPQLDSPMYFFLSNLSFLDLCYTTSTVPQMLVNLRGPEKTISYGGCVAQLYIFLALGST
ECTLLAVMAFDRYVAICKPLHYPIIMNQRHCIYMATGTWISGFANSLVQSTLTVLAPRCGQRVMDHFFCEVPVLLKLACTDIHINEAEFNVLGALLILVPLTLILGTYVF
IARAVMRIRSAESRWKAFNTCASHLLVVSLFYFTAISMYVQPPSSYSRDRGKIMALFYGIVTPTLNPFIYTLRNKDVKAALRRVLAKEFWVKTR*
232 >lcl|XP_001491689.2|Plus1complement(25646832..25647770) NW_001867363 olfactory receptor 5-like LOC100058808 __SEG__ Chr10 {Equus caballus} MERSLELANMTRVQQFVLLGLSTRPDIRDVLFAIFLTLYLLILLENTLIIYLICSHRELHKPMYFFLGNLSYLEMCYVSVTMPSLLVGLWTGPYNISFTACMTQLFFFVS
LICTECTLLASMAYDCYVAICRPLHYLLLMRPQVCLSLASSSWLGGLMVSAVKTTCVATLSYCGPNVLNQFFCDVSPLLNLSCTHVALTELVDFISAIVIFCGTLLVALA
SYSAIGVAVLRMPSAAARRKAFSTCASHLVVVGIFYSAALFIYCRPSRIKSMDLNKVLSVIYAVVTPMCNPIIYCLRNKEVHAALRKTLHWP*
233 >lcl|XP_001491710.2|Plus1complement(25654838..25655776) NW_001867363 olfactory receptor 5-like LOC100058842 __SEG__ Chr10 {Equus caballus} MDKSLELANMSRVQQFVLLGLSTRPDIRDVLFAIFLTLYLLTLLENTLILYLICSHSELHKPMYFFLGNLSCLEMCYVSVTMPSLLVGLWTGPYNISFTACMTQLFFFIV
LIGTECTLLASMAYDRYVAICRPLHYLLLMRPQVCLSLALSSWLGGLLVSVAKTTCIATLSYCGPNVLNQFFCDVSPLLNLSCTHVALTELVDFISAIVIFCGTLLVALA
SYSAIGVAVLRMPSAAARRKAFSTCASHLVVVGIFYSAALFIYCRPSRIKSMDLNKVLSVIYAVVTPMCNPIIYCLRNKEVHAALRKTLHWP*
234 >lcl|XP_001491730.3|Plus127913272..27914207 NW_001867389 olfactory receptor 2G3-like LOC100058863 __SEG__ Chr20 {Equus caballus} MGMNNSNVQEDFILLGFSDQSDLEKILFVVVLVTYFLTLVGNTVIILISSIDPQLKTPMYFFLTHLSLLDICFSTSIVPQLLWNLRGPAKTITALGCAVQLYVSLALGST
ECVLLAVMAFDRYAAICKPLHYAAVMNRQLCQALAGIAWLSGVGNSVIQSTVTLWLPRCGHRGLHHFFCEVPSMIKLACVDIHANEVQLFIASLVLLLLPLALILMSYGH
IVKAVIRIKSVQAWRKALGTCGSHSMVVSLFYGTIAAIYIQPNSSYAHTQGKFISLFYTVVTPTLNPLIYTLRNKDVKGALRRLFHRDLGS*
235 >lcl|XP_001491762.3|Plus127898260..27899195 NW_001867389 olfactory receptor 2G6-like LOC100058903 __SEG__ Chr20 {Equus caballus} MEHNNKTSGGDFILLGFSDQPQLEVLLFVVVLISYLLTLVGNTTIILVSCLDSKLHTPMYFFLTNLSFLDLCFTTSIVPQLLWNLKGPNKTITLTGCAIQLYVSLSLGST
ECVLLTIMAFDRYVAVCRPLNYTAVMHPSFCKVLAGIAWLSGVGNTLIQGTITLRLPRCGHHHLHHFLCEVPAMIKLACVDIHANEVQLFVATLVLLLLPMALILVSYGL
ILHSVIKINSIQAWRKALGTCGSHILVVSLFFGTSSAIYIQPKRSYGHSQGKFLTLFYTIITPTLNPLIYTLRNKDMKGALRRLLRKEQNY*
236 >lcl|XP_001491767.2|Plus125709411..25710337 NW_001867363 olfactory receptor 1038-like LOC100058913 __SEG__ Chr10 {Equus caballus} MSNLTVVSVFLLRGFSAVPELQLLSAATFLLIYLAAILGNLSIMAAVTLDPRLHTPMYFLLKHLSLVDICSTSTTLPQVLVATMVGSGEISLPACASQLFAFVCLGSTEC
FLITSMAYDRCLAIYRPLMYGAAMSPRTCASLVVVAWGSGILFSAFHTANTFSLPFCGPNVIDHFFCDIPPLMRLACANADAHEAVGFAASGCIIMSCFALTVLSYIRIL
ATVVRIRSSASRWKAFSTCSSHLATVLLFYGTGSSAYMQPTAHYSPLQGRVAAVFYSILTPTLNPLIYSLRNKDMKGALRKLYLQVPS*
237 >lcl|XP_001491780.3|Plus127880122..27881084 NW_001867389 olfactory receptor 10C1-like LOC100058936 __SEG__ Chr20 {Equus caballus} MNLSCSLWQDNSMSVKQFAFTKFCYITEQCFFSFTLILFMFLASLTGNALIALAIWTNPVLHTPMYFFLANLSLLKIGYTCSVIPKMLQSLVSEARGISREACATQMFFF
SFLGISECCLLAAMAYDRYIAICSPLHYAARMSRGVCAQLAMISWGVGCMVSLGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFVVAILCISSPFLLI
IASYGRVLAAVLIMPSPEGRQKALSTCSSHLLVVTLFYGSGSVTYLRPKASHSPGVDKLLALFYTVVTSMLNLIIYSLRNKEVKAALRRTLWEKKVLSHG*
238 >lcl|XP_001491787.1|Plus1complement(34719544..34720167) NW_001877040 putative type-1 protein phosphatase inhibitor 4-like LOC100058948 __SEG__ ChrX {Equus caballus} MAASTTSQHRPIKGILKNKGSTASSMAASTQQSGGATQEVQRKKSQKWDESNILATYRPAYRDHELMKTNEPSSPHLSVQDDGEDAMSDLEAKEVMTLDILALKLAVTDM
SESNYQVVEPESHGAHTSKIFVDIQEKHQQFEMKRKLHYNEGLNIKLARQLISKELQLEEEDKNEESLHATNEEKTTTEESDEGPDGDQLQTQGRYA*
239 >lcl|XP_001491831.3|Plus127857150..27858112 NW_001867389 olfactory receptor 10C1-like LOC100059020 __SEG__ Chr20 {Equus caballus} MKLNCSLWQDNSMSVKQFAFTKFSEVTEQCFLLFTLILLMFLASLTGNALIALAIWTNPVLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
TFFAISECCLLAAMAYDRYMAICSPLHYATRMSRGVCAQLAMISWGVGCTVGLGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFVVAILCISSPFLLI
IASYGRILAAVLIMPSPEGRQKALSTCSSHLLVVTLFYGSGSVTYLRPKASHSPGTDKLLALFYTVVTSMLNPIIYSLRNKEVKAALQRILWEKKVLTHE*
240 >lcl|XP_001491901.2|Plus1complement(27825684..27826631) NW_001867389 olfactory receptor 2W1-like LOC100059132 __SEG__ Chr20 {Equus caballus} MINDSYFGGFILLGFPGQPELETIISGVVFFFYTIALMGNIAIILLPLLDECLQTPMYFFLRNLAILDLCYTTNIVPQMLVNVWGKEKKITFAGCAFQLFTDVTLCTVEC
MLLAVMSYDRFNAVCKPLHYMTIMNPQLCQGLMAMTWVIGIINCMILSPHAMSLPRCGNHHLDHYFCEISAMVKIACVDTTAMEETLFALCFFIFLTPLLLILVSYGFIA
VAVLKMKSAAGRQKAFGTCSSHLFVVSIFYGTIIYMYIQPGNSPSQDEGKLLSIFYSIVTPSLNPLIYTLRNKEFKGAMKRLIGKEKGSGETAVH*
241 >lcl|XP_001491921.2|Plus1complement(27781734..27782675) NW_001867389 putative olfactory receptor 2B3-like LOC100059179 __SEG__ Chr20 {Equus caballus} MNWANESSPKEFILLGFSDRPWLQMPLLVLLLISYTITIFGNVSIMMVCILDPKLHTPMCFFLTNLSILDLCYTTSTVPHMLINICRNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLHYVVIMNHWFCLRMVSFSWLIGFSNSVLQSSLTLNMPLCGHQEVDHFFCEVPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRKKAFGTCGSHMVVVSLFFGTGIYMYLQPPSSTSKDWGKMVSLFYGIITPMLNPLIYSLRNKDMKEAFKRVMCITFFYKK*
242 >lcl|XP_001491943.2|Plus1complement(27767962..27768906) NW_001867389 olfactory receptor 2B11-like LOC100059213 __SEG__ Chr20 {Equus caballus} MNPSNASSPKVFILLGFSDHPWLEMPLFIIVLVAYICTLVGNISIIVISRVDPHLDSPMYFFLSNLSFLDLCFTTTTIPQLLLNLWGTDKSISYGGCVTQFYMFHFLGAT
ECILLAVMSLDRYMAICKPLRYSAIMHQQLCIFLVAVAWLSGLANSLLQSSLTIQLPLCGNNKVDDFLCEVPVMIKMSCVDTTFNVAMLSIVGAFYSLVPLLLILVSYGF
IVATVLRIRSSEGKKKAFNTCGSHVIVVSLFYGPVISMYVQPSATNSQDKNKLMSLFYSLVTPMLNPFIYTLRNKDMKGAMRRLLVSLYHQGRE*
243 >lcl|XP_001491962.2|Plus127746424..27747377 NW_001867389 olfactory receptor 2H2-like LOC100059255 __SEG__ Chr20 {Equus caballus} MITICNNSHSDFILLGFSDKPYLEKILFWVILIFYGLTIAGNMVIILVSLKDPKLHIPMYFFLSNLSLLDLCFTSSCVPQMLVNFWSPEKTISYIGCAFQLCVFLWLGAT
ECVLLMVMAVDRCVAVCHPLQYTTVMHPKLCLQLAILAWGTGLFQSLIQSPATLQLPFCSLQRVDDIVCEVPALIQASSADTTYNEIQMSVASIILLVVPLIVILSSYGA
IAKVVLRIKSTTGQKKAFGTCASHLLVLSLFYGTVTAVYLQPKNHYAHEWGKFLTLFYTVVTPTLNPLIYTLRNKEVKGALMRLGRKTWDSQSNSRG*
244 >lcl|XP_001491998.1|Plus1complement(50686574..50687647) NW_001867383 G-protein coupled receptor 183 GPR183 __SEG__ Chr17 {Equus caballus} MDINFTTPTIAPPGSNCDLYAHHGTARILMPLHYCIVFVIGLVGNLLALIVIVQNRKKINSTTLYSTNLVISDILFTTALPTRIAYYALGFDWKIGDALCRITALVFYIN
TYAGVNFMTCLSIDRFFAVVHPLRYNKMKRIEHAKGVCIFVWILVFAQTLPLLINPMSKEENERTTCMEYPNFEETKSLPWILLGACFLGYVLPLVIILICYSQICCKLF
KTAKQNPLTEKSGVNKKALNTIIFIIVVFVLCFTPYHVAIIQHMIKKLHFSDPLECSQRHSFQISLHFTVCLMNFNCCMDPFIYFFACKGYKRKVMKMLKRQVSVSISSA
VRSAPEENSREITETQMMIHSKSLNGK*
245 >lcl|XP_001492000.1|Plus110036560..10038509 NW_001867392 leucine-rich repeat transmembrane protein FLRT3 isoform 1 FLRT3 __SEG__ Chr22 {Equus caballus} MISPAWSIFLIWTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKV
FFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPMKVNVR
GLMCQAPEKVRGMAIKDLNAELFDCKDSAVVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPSRKTIIITVKSVTSDTIHISWKLVLPMTALRLSW
LKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYRVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVTIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS*
246 >lcl|XP_001492009.2|Plus1complement(27726535..27727476) NW_001867389 putative olfactory receptor 2B3-like LOC100059324 __SEG__ Chr20 {Equus caballus} MNWANESSPKGFILLGFSDRPWLQMPLFVLLLVSYTITIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLINICRNKKTISYGGCVAQLIIFLALGAT
ECLLLAVMSFDRYVAICRPLRYVVIMNHWFCLRMVAFSWFTGFSNSVLQSSLTLNMPRCGRQEVDHFFCEVPALLKLSCADTRPIENELFFFSVLILLIPVTLILISYGF
IAQAVLRIRSAEGRKKAFGTCGSHMVVVSLFFGTAIYMYLQPPSSTSKDWGKMVSLFYGIITPMLNPLIYSLRNKDMKEAFKRVMCITFFYKK*
247 >lcl|XP_001492057.2|Plus1complement(27710884..27711825) NW_001867389 olfactory receptor 2B11-like LOC100059400 __SEG__ Chr20 {Equus caballus} MALINKSHPEEFILLGFADRPWLELPLFIILLITYPTAMMGNIAIILVSKLDPRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFNLGSAKKTISYMGCAAQLYFFHIMGGT
ECLLLAIMSFDRYVAICKPLHYTLVMNQNIRILLVSTVWLCGMTYAVSEATVTLQLPLCGLNTLDHLLCEIPVLIKNACGEKGANELTLSVVCIFMLAVPLCLIIASYTC
IGHAVFKIKSSEGRKKSFGTCSSHLIVVFLFYGPGISMYLQPPSSISRDQPKFMALFYGVVTPTLNPFIYTLRNKDVKEALGKLVRSIFTSKW*
248 >lcl|XP_001492077.2|Plus1complement(27690453..27691391) NW_001867389 olfactory receptor 2B11-like LOC100059435 __SEG__ Chr20 {Equus caballus} MALINKSHPEEFILLGFADRPWLELPLFVILLITYPMAMMGNIAIILVTKLDPRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFNLGSAKKTISYVGCAAQLYFFHIMGGT
ECLLLAIMSFDRYVAICKPLHYTLVMNQRVCILSVSTVWLCGMTYAVSEATVTLQLPLCGLNTLDHLLCEIPVLIKNACGEKGANELTLSVVCIFMLAVPLCLILISYAC
IGHAVFKIKSSEGRIKAFGTCSSHLIVVFLFYGPAISMYLQPPSSISRDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGALGKLVRSIFTSK*
249 >lcl|XP_001492088.1|Plus16561147..6562124 NW_001867363 free fatty acid receptor 2-like LOC100059449 __SEG__ Chr10 {Equus caballus} MPSSLIVVFYIIIFVTGLPANLVALWAFLKRVRQPHPAPIHILLLNLTLADLLLLLLLPFKIIEAASDFHWYLPEVVCATVGFGFYSSIYCTTWLLAAISIERYLGVAFP
VQYKLSRRPVYGVVAALVAWITSFGHCTIVIIVQYFNSTQKATNIEVTCYRNFTQEQLEVVLPVRLELCLVLFFIPMVITIFCYWRFVWIMLTQPHVGAQRRRRAVGLAI
VTLLNFLVCFGPYNISHLVGFYTKESPKWRVEAVVISALNASLDPLLFYFSSSTARRAFEKRLQVLQGPGSSLLGLRDRGSVEVTNRVGGLSQVEGAPSSDFTTD*
250 >lcl|XP_001492127.2|Plus1complement(27644732..27645670) NW_001867389 olfactory receptor 2B11-like LOC100059515 __SEG__ Chr20 {Equus caballus} MTLINKSHPEEFILLGFADRPWLELPLFIILLITYPMAMMGNIAIILVSKLDPRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFNLGSAKKTISYMGCAIQLYFYHTMGGT
ECLLLAIMSFDRYVAICKPLHYTLVMNQRVCILLVSTVWLCGMTYAVSEATVTLQLPLCGLNKLDHLVCEIPVLIKTACGEKGANELTLSVVCIFMLAVPLCLILASYAC
IGHAVFKIKSSEGRKKAFGTCSSHLIVVSLLYGPGISMYLQPPSSISKDQPKFMALFYGVVTPTLNPFIYTLRNKDVKGALGNLARSIFTSK*
251 >lcl|XP_001492154.3|Plus127624997..27625920 NW_001867389 olfactory receptor 2J3-like LOC100059553 __SEG__ Chr20 {Equus caballus} MMGKINASSEGYFVLLGFSNWPHLEVVLFVVILIFYLMTLIGNLFIIILSHLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGT
TECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHFSFTFFVPLCGHHQLDHFSCEVPALLRLSCVDTHANELTLMVTSSIFVLIPLILILSSYG
AISQAVLRMQSTTGLQKVFGTCGAHLMVVALFFIPVMCIYLQPPSGDSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVKRLMG*
252 >lcl|XP_001492191.1|Plus158254179..58255255 NW_001867381 type-1 angiotensin II receptor-like LOC100059005 __SEG__ Chr16 {Equus caballus} MMLNSSTEEGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVIGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLMTLPLWAVYTAMEYRWPFGNYLCKIASASVSF
NLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWTLAGLASLPTIIHRNVFFIENTNVTVCAFHYEFQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWK
TLKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKITDIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSL
STKMSTLSYRPSDNGSSSKRPAPCIEVE*
253 >lcl|XP_001492227.2|Plus127553993..27554931 NW_001867389 olfactory receptor 2J1-like LOC100059656 __SEG__ Chr20 {Equus caballus} MMKEKNASSEGYFVLLGFSNWPHLEAVLFVVILMFYLMTLIGNLFIIILSHLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISHAGCMIQLYFVLALGT
TECVLLVVMSYDRYAAVCRPLHYTILMHPRFCRLLALASWVSGFTNSALHSSFTFWIPLCGHHQVDHFFCEVPALLRLSCVDTHANELTLMVTSSIFVLIPLILILSSYG
AIARAVLRMQSTTGLQKVFGTCGAHLLVVSLFFVPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVKRLMGWEWEM*
254 >lcl|XP_001492229.2|Plus12169344..2170282 NW_001867427 olfactory receptor 7D4-like LOC100059658 __SEG__ Chr7 {Equus caballus} MEAGNHTGVSEFLLLGLSEDPELQPLLFGLFLSMYLVTVLGNLLIILAISSDSQLHTPMYFFLSNLSFVDICFISTTVPKMLVNIQAQSKDISYIGCLTQVCFFTLFSGM
DNCLLTVMAYDRFVAICHPLHYNVIMNPRLCNLLILISWVIILCISLLHILLMVQLTFCIGTEIPHFFCELAQIIKLASSDTLINNISLYVATALLSVFPLTGILFSYSQ
IVSTLTRMSSAGGKYKAFSTCGSHLSAVSLYYGTGLGVYLSSAVTHSSKRSCIASVMYTVITPMLNPFIYSLRNKDVKGALGRLLSRASSCL*
255 >lcl|XP_001492280.2|Plus12192762..2193700 NW_001867427 olfactory receptor 7D4-like LOC100059730 __SEG__ Chr7 {Equus caballus} MESRNHTEISEFLLLGLSEDPALQPLLFGVFLSMYLVTVLGNLLIILTISSDSQLHTPMYFFLSNLSFVDICFISTTVLKMLVNIQTQNKNISYRGCLTQMYFFMVFGGM
DNFLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLILISWVIIFCISLLHILLMVRLTFRIGTEIPHFFCELAQVLKLACSDTFINDISLYVATALLCVFPLTGILFSYSQ
IVSSLMKMASTEGRYKAFSTCGSHLSVVSLFYGTSMVVYLSSAVTHASQRSSVASVVYTVVTPMLNPFIYSLRNRDVKRALGRLLSQAASCL*
256 >lcl|XP_001492368.2|Plus1complement(27461454..27462398) NW_001867389 olfactory receptor 2W1-like LOC100059887 __SEG__ Chr20 {Equus caballus} METSNGSSETDFILLGFSDRPQLERIISVLVFIFYTATLVGNTTIILVSYLDTQLHTPMYFFLSNLSFLDICYTTSIIPQMLVNLWGPKKSITYGGCVLQFFFALDLGTT
ECLLLAVMAYDRYAAVCQPLHYTVVMHPQLCQKMVLTAWSSGLGSTLILFSLTLKLPRCGHRKVDHFFCEMPALIKMACVYSKVIEILVFALGVVFLLVPLSLILISYGV
ITHAVVRIKSAARWHKVLNTCGSHLTVVTLFYGTIIYMYMKPQNHTSQDEGKFLTLFYTIVTPSLNPLIYTLRNKDVKSAIKRIFWVEKWSAMS*
257 >lcl|XP_001492472.2|Plus12355027..2355965 NW_001867427 olfactory receptor 7D4-like LOC100060038 __SEG__ Chr7 {Equus caballus} MEAGNHTGVSEFLLLGLSEDPALQPLLFGVLLSIYMVAVLGNLLIILAVGSDSHLHTPMYFFLSNLSVVDICFTSTTVPKMLVNMQAESKDISYTGCLTQVYFFLIFALL
DDFLLTVMAYDRFVAICHPLHYMVIMNPRLCSLLVLMCWFISFWVSLLHILLLRQLTFCIGTEIPHFFCELAQVLKVACSDTLINNIVLSVATALLGVFPLVGILFSYSQ
IVFSLLRMSSSGGKCKAFSACGSHLSAVSLFYGTSLGVYFSSSVTHSSQRSLITSVMYTVVTPMLNPFIYSLRNKDVKGALGRLLSQAAPCL*
258 >lcl|XP_001492514.3|Plus18819335..8821116 NW_001867419 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 LINGO4 __SEG__ Chr5 {Equus caballus} MAAATAPKQAWPPWSLLLFLLLLPGGSSGGCPAVCDCTSQPRAVLCAYRQLEAVPGGLPLDTELLDLSGNRLWGLQQGMFSRLGLLRELDLSYNQLSTLEPGAFRGLQSL
LTLRLQGNRLRIMGPGVFSGLSALMLLDLRLNQIVLFLDGAFGELGSLQQLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGLALAHLPALVALRLRELDIGRLP
AGALRGLRKLKELEIHHWPSLEALEPGSLLGLNLSSLAITRCNLSSVPFQALHHLSFLRVLDLSQNPISSIPARRLSPLVRLQELRLSGACLTSIAAHAFQGLTAFHLLD
VADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTSPPACAGPQHVQGKSLREFSDILPPGHFTCQPAMIRKSGPRWVVAEEGGHAVFSCSGDGD
PAPTVSWMRPQGAWLGRAGRVRVLEDGTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQIEPPNGSFSDPNITMPGIPGPFFLDSRGIAMVLAVGFLPFLTSVTLC
FGLIALWSKGKGRVKHHTTFDFVAPRPSGDKNSGGNRVTAKLF*
259 >lcl|XP_001492628.2|Plus1complement(30316311..30318257) NW_001867381 RAF proto-oncogene serine/threonine-protein kinase-like LOC100050968 __SEG__ Chr16 {Equus caballus} MEHIQGAWKTISSGFGFKDAVFDGPSCICPTIVQQFGYQRRASDDGKLTDSSKTSNTICVFLPNKQRTVVSVRNGVSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKA
RLDWNTDAASLIGEELQVDFLDHVPLTTHSFARKTFLKLASCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTFGDSGVPALPSLTMRRMRES
VSRMPVSSQHRYSTLHAFTLNISSSCSEGSLSQRQRSTSTPNVHMVSTTLPVDSRVIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKI
RPRGQRDSSCYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTSEHFQAFRNKVAVLHKTRHVNVLLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKF
QMFQLIDITRQTAQGMDYLHAKNIIHRDMKSKNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWLAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSH
INNRDQILFMVGRGYASPDLSKLYKNCPKAVKRLVADCVKKVKEERPLFPQILSPVELLQHSLPKINRSASEPSLHRAAHTKDINACTLTTSPRLPVF*
260 >lcl|XP_001492647.2|Plus111967693..11968865 NW_001867388 somatostatin receptor type 1 SSTR1 __SEG__ Chr1 {Equus caballus} MFPNGTASSPSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSV
PFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLV
GFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFK
RSFQRILCLSWMDNAVEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL*
261 >lcl|XP_001492771.2|Plus12573206..2574144 NW_001867427 olfactory receptor 7D4-like LOC100060476 __SEG__ Chr7 {Equus caballus} MEAGNHTQLSEFVLLGLSEDPELQPLLFGVFLFMYLVTVLGNLFIILAITSDSHLHTPMYFFLSNLSFVDICFISTIVPKMLVNIQAQSRVISYKGCLTQVYFFMLFCVM
DSFLLTVMAYDRFVAICHPLHYMVIMNPRLCGLLVLMCWFIIFWVSLLHILLMRQLTFCIGTEIPHFFCELAQVLQLACSDTLINNIIMYVATALIGVFPLTGILFSYTK
IVSSLMRISSAGGKYKAFSTCGSHLSSVSLFYGTSLGVYLSSAMTHSSHRSSIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLSRASSSL*
262 >lcl|XP_001492781.2|Plus193426..94361 NW_001867370 olfactory receptor 4D9-like LOC100060487 __SEG__ Chr12 {Equus caballus} MEQGNYTTVKEFIFLGITQSRELSWVLFVFLFLVYMTTLMGNLLIMVTVTCEAHLHTPMYFLLRNLSVLDICFSSITAPKVLADLLSERKTISFNGCVTQMFFFHLLGGA
DVFSLSVMAFDRYIAISKPLHYMTIMNRGRCTSLVVASWVGGFVHSIVQISLLLPLPFCGPNVLATFYCDVPQVLKLACTDTFTLELLMISNNGLVSWFIFFFLLISYTV
ILRILRSHTGEGRRIAISTCTSHITVVTLHFVPCIYVYARPFTALPTDTAISVTFTVISPLLNPMIYTLRNQEMKSAMRKLKKRLRHSEKI*
263 >lcl|XP_001492798.2|Plus12588119..2589057 NW_001867427 olfactory receptor 7D4-like LOC100060509 __SEG__ Chr7 {Equus caballus} MEAGNHTQLSEFILLGLSEDPELQPLLFGVFLFMYLLTVLGNLFIILAITSDSHLHTPMYFFLSNLSFVDICFISTIVPKMLVNIQAQSRVISYKGCLTQVYFFMLFSVM
DDFLLTVMAYDRFVAICHPLHYNVIMNPRLCGLLVLMCWFTIFWVSLLHILLMRQLTFCIGTEIPHFFCELAQVLKLACSDTLINNIIMYVATALIGVFPLTGILFSYSK
IVSSLMRISSAGGKYKAFSTCGSHLSSVSLFYGTSLGVYLSSAVTHSSHRSSIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLSRASSSL*
264 >lcl|XP_001492808.2|Plus1102954..103889 NW_001867370 olfactory receptor 4D9-like LOC100060524 __SEG__ Chr12 {Equus caballus} MEQGNYTRVKEFLFQGLTQSRELSLVLFLFLFLVYTATVMGNLLIMVTVTCEPRLHTPMYFLLRNLSVLDICFSSITAPKVLADLLSRRKTISFSGCITQMFFFHLLGGA
DIFSLSVMAFDRYMAISKPLHYVTIMSRGRCTALIVASWVGGFVHSIVQISLLLPLPFCGPNVVDGFYCDVPQVLKLACTDTFVLEVLMISNNGLISTLWFIFLLVSYTV
ILMMLRSHAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPMDRAVSITFTVIIPVLNPMIYTLRNQEMKSAMRKLKRRLGPYEKE*
265 >lcl|XP_001492937.3|Plus1complement(209772..210710) NW_001867370 olfactory receptor 10V1-like LOC100060690 __SEG__ Chr12 {Equus caballus} MGDENQTIEIQFHFHPFSPILEVQMFIFVAFLLMYTGSLIGNATIFLTVWAERSLHIPMYFFLANLAVLEIFYSSTVAPLALVNLLTMGRIPISFTGCGTQMFFFVFLGS
ADCIFLGIMAYDRFVAIRDPLHYTLIMRRRLCAQLAVGALVLGFIVALQLTVLIFHLPFCGHNRITHFYCDVLPILRLACGDTRTQETMIFIASVIILTIPFSLISMSYF
FIVVAILKIHSAEGRHKAFTTCSSHLTVVLLQYGCCSLIYLRPSSSYNPEMGRVVSVVYTFVTPVLNPLIYSIRNKELKDALSKIMKRHLLN*
266 >lcl|XP_001492960.2|Plus1complement(237135..238064) NW_001867370 olfactory receptor 10V1-like LOC100060726 __SEG__ Chr12 {Equus caballus} MEEINKTADVRFFFHPFSADPTVQVVIFVAFLVMYLTSLSGNATIAVIVQINHSLHTPMYFFLANLAVLEIFYTSSIAPLALANLISMGKTPVSITGCGTQMFFFVFLGG
ADCVLLAVMAYDRFTAICYPLRYTLIMSWPLCVELMGGSLVLGFLLSMPLTILIFHLPFCNSNEIYHFYCDMPAVMRLACADTRVHKTALYIISFIVLSIPLSLISISYV
FIVAAILRIRSAEGRRRAFSTCSSHILVVLLQYGCTSFIYLSPSSSYSPEMGRVVSVVYTFITPILNPLIYSMRNRELKDALKKALKKF*
267 >lcl|XP_001493001.2|Plus1274340..275278 NW_001867370 olfactory receptor 10V1-like LOC100060799 __SEG__ Chr12 {Equus caballus} MEDANQTGMIHFHFRPFSKLPDVQMLIFVTFLIMYLVSISGNVSISLIIWINHSLHTPMYFFLANLAALEVCYSSTIAPLTLASILSPERTLISLPGCGTQMFFFIFLGS
ADCILLAIMAYDRFVAICHPLHYTLMMSWRLCVQLSLGSLMLGFILAMQLTVLIFQLPFCSSKEVSLFYCDVLPVMRLACADTHVHEATLFVVSVTVLTIPFLLITLSYA
FIVSAILKIRPAEGRQKAFSTCSSHLTVVVLQYGCGSLIYLCPSSSYSPERGQVVSVVYTFITPVLNPLIYSMRNRELQDALKRAMMSFLLS*
268 >lcl|XP_001493093.1|Plus18179022..8179321 NW_001867419 late cornified envelope protein 2B-like LOC100060939 __SEG__ Chr5 {Equus caballus} MSCQQNQQQCQPPPKCPPKCPTPKCPPKCPPQCPAPCPPPVSSCCDPSSGGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCEGGPSGGPGRCGGSGGCC*
269 >lcl|XP_001493167.2|Plus12801282..2802211 NW_001867427 olfactory receptor 18-like LOC100061045 __SEG__ Chr7 {Equus caballus} MGPQNLTSVLEFHLLGFSDDLELQPLLFGLFLTMYLVTVFGNLLIILTVSFDFHLHTPMYFFLSNLSLADISFSTTTVPKMLVNLKTHSKSITYAGCLTQVSSFSLFVCL
DSLLLTVMAYDRFVAICHPLHYPAIMNFHLCGLLVLVSFFVSLLDSQLHYLMMSQLTFCADVEIPHFFCDPPQLLKLACSDTSTNNILIYFIGTIFGGVPLTGILYSYTR
IISSILRISSSGLRYKAFSTCGSHLLAVCLFYGIGLGVYLGSSVSSSLRKEAVASVMYTVVTPMLNPFIYSLRNSHIKNVLWRIVSRIA*
270 >lcl|XP_001493227.2|Plus110958777..10959706 NW_001867396 olfactory receptor 13D1-like LOC100061131 __SEG__ Chr25 {Equus caballus} MGNYSAVTEFFLVGLSQYPEVQFFLFALCLIMYVIILLGNSLLLLISILDSRLHTPMYFFLGNLSLLDICYTSSSILPMLIIFKSGRKSISFMGCALQMVVSLGLGSTEC
VLLAVMAYDRYVAICNPLRYPIIMNRVLYVHMATWSWIIGCLNSLVQTVLTMVLPFCGNNVIDHLTCEILALLKLICSDISMNVLIMTVASIVLLVIPLLLIFTSYVFIL
SPIMRINSVEGRKKVFSTCSAHLTVVILFYGSALFMYMKPKSKDTKASDEIIGLSYGVVTPMLNPIIYSLRNKEVKEAVKKVMSRHLHL*
271 >lcl|XP_001493246.1|Plus1complement(52498243..52499529) NW_001867387 immunoglobulin superfamily containing leucine-rich repeat protein ISLR __SEG__ Chr1 {Equus caballus} MQELRLLCCAVLLGLVQTCPEPCDCGEKYGFKIADCAYRDLEAVPPGFPTNVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALAPLGHLKSLDLSHNLI
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINDNPFDCTCGIVWFKTWALTTAVSIPEQDNVTCSSPHVLKGTP
LNRLLPLPCSAPSVQLTYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVDITSPNVGADGRALPGTPAASSRPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDALGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRARGPEAAAAGEGVRGQQLPGLLLLGQSLLLLLLPSF*
272 >lcl|XP_001493265.1|Plus113374221..13375828 NW_001867431 suppressor of cytokine signaling 6 SOCS6 __SEG__ Chr8 {Equus caballus} MKKISLKTFRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINSEDEKGGKNRSKSESLMGTLKRRLSAKQKQKGKGSTASGSSADEDTFSSSSAP
IVFKDVRAQRPMRSTSLRNHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETVCQEQSSSLKSSESQNGDLHLHLDEHVPVVIGLMPQDY
IQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGNSFSEDENQVDQDLVVAQEIFVDQSVNGLLIGTTGVMLQSPRASHDDVPPLSPLLPPMQTNQIQRNFSGLT
GADAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRF
SFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTHPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY*
273 >lcl|XP_001493280.2|Plus1complement(10922874..10923836) NW_001867396 putative olfactory receptor ENSP00000348552-like LOC100061197 __SEG__ Chr25 {Equus caballus} MGKSNQSSVTEFVLLGLSGYPELEAIYFVLVLYMYLVILLGNGVIIIVSIYDSHLHTPMYFFLSNLSFLDICYTSSSIPLFLSSFLTSKKTISFSGCGVQMFFSFAMGAT
ECVLLSMMAFDRYVAICNPLRYPIIMSKASYVPMVSGSWIAGGVNSVLQTSLAMRLPFCGDNVINHFTCEILAVLKLACADVSINVLSMVVANMIFLVVPVLFIVVSYVF
ILFTILRIPSAEGRRKAFSTCSAHLTVVVIFYGTILFMYAKPKAKDSSGADKVQVTDKIISLFYGVVTPMLNPLIYSLRNKDVKAAVKNILCQKCSSEGR*
274 >lcl|XP_001493300.2|Plus111095263..11097302 NW_001867383 kelch repeat and BTB domain-containing protein 7 KBTBD7 __SEG__ Chr17 {Equus caballus} MQSREEAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDAAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQA
SITMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLA
QLLAVLRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDQDYLKGLLTKPIVKKYCLDLIEAALQMRYGDMLYKSLVPKPESSSGSVVSTAENPP
QRLGVCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRDP
VTGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDSE
THNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDD
EVWVQVAPQRNAQDQQGSL*
275 >lcl|XP_001493309.2|Plus1complement(26936303..26937247) NW_001867389 olfactory receptor 2B11-like LOC100061233 __SEG__ Chr20 {Equus caballus} MKHVNESFPENFILMGFTKYPWLDLPLFFGLLMSYMFTLLGNIAIILASQLDSQLQSPMYFFLTSLSFLDLCFTTTTVPQMLFNLGGPNKSITYVGCMTQAYVFHWLGCT
ECVLLGIMALDRYVAVCKPLRYSVIMDHKLCLQLSSTAWLIGLGNSLLQSTLTVQLPLCGNQELDHFFCELPGLIKMACVDTTVNELTLAVVATFLIMGPLSMILASYSY
IAKAVFQIPSADGKLKAFNTCSSHLLVVSLFYGPGIYIYMQPSVDGRQDVTKVLTLFYCVITPMANPFIYTLRNKDVKGALMRLLRRAISSKRI*
276 >lcl|XP_001493322.2|Plus111159872..11161881 NW_001867383 kelch repeat and BTB domain-containing protein 6 KBTBD6 __SEG__ Chr17 {Equus caballus} MQSREEAPRSRRLASPRGGKRPKRIHKPSVSAFFTGPEELKDAAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVERLYAASDMLQLEYVREACASFLARRLDLANCTAIFKFADAFGHRKLRSQAQSFIAHNFKQLSQMGSIREESLADLTLA
QLLTVLRLDCLNTEHEQTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDQDYLEGLLTKPIVKKYCLDLIEAALQMRYGDMLYKSLVPKPESSSGSVVSTAENPP
QRLGVCAKEMVIFFGHPRDPFLCCDPYTGDIYKVPSPLTCLAHTRTVTTLAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRDP
ITGVKLKEVECYSVQRNQWALVAPLPHSFISFDLMVIQNYLYALNSKRMFCYDPSHNMWLKCVSLKRNDFQEACVFNDEIYCICDIPVMKVYNPARGEWRQINNIPLVSE
TNNYRIINHGQKLLLITSRTPQWKKNRVTVYEYDSRGDQWINIGTTLGLFQFDSNFFCLSARVYPSCLESGQSFLTEEEDVPSESSTEWDLGGFSELDSESGSSSSLSDD
DLWVQVAPQ*
277 >lcl|XP_001493334.1|Plus111775559..11776671 NW_001867427 coiled-coil domain-containing protein 89-like LOC100061274 __SEG__ Chr7 {Equus caballus} MPQEEKALQMDTPPSEEPLDKQNEKLENQEEEMEFKELDGLREALANLRGLSEEEKSEKALLCSRIQEQSQLICILKRRSDKALERCQILEMLNTELEEKRMLEAQKLKA
KKEHAQKLEERFMTLAANHELMIRFKDEHKSQNVKLREENEKLRLENDNLFSQALKDQEAKVLQLTARSEVLAKELETLKQRCAQDACQAQAREKELLELQNQQAQAHTK
ETEQLRSQLQSLKQQHQQAMEQMAKAELEHSSLNQELQAKLQTVTREKEELLQLSVERGKVLQNKQAEIRQLEEKLEMADAARRHALERFEQEAVAVDSNLRVRELQRRV
DGIQKAYDELRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
278 >lcl|XP_001493353.2|Plus110864520..10865479 NW_001867396 olfactory receptor 13C8-like LOC100061306 __SEG__ Chr25 {Equus caballus} MGRTNDSMLTEFLLVGLSAHPKLQTVFFALVLWMYLMILLGNGILISVIIYDSHLHTPMYFFLCNLSFLDICYTSSSVPLILDSFLTVRKRVSFSGCMMQMFLSFALGAT
ECVLLGMMALDRYVAICYPLRYPAIMRKGAYVPMAAGSWVSGLVDSVVQTSLAMQLPFCANNVINHFVCEILAILKLACADIAINVISMAVSNLVVLVIPLLVISISYIF
IIATILRIPSTEGKRKAFSTCSAHSTVVIIFYGTIFFMYAKPKSKSSVGPVNQDVVEALISLLYGVMTPMLNPLIYSLRNKDVKTAVKTMLGRKNSDGV*
279 >lcl|XP_001493368.2|Plus110813759..10814715 NW_001867396 putative olfactory receptor ENSP00000348552-like LOC100061342 __SEG__ Chr25 {Equus caballus} MEVANQSIVAEFVLLGLSDQPKLEKTFFVLLLSMYLVILLGNGILILVTILDSQLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAVQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAASSWVAGGANSLVQISLAVQLPFCGDNVINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIF
ILTTILRIPSAEGQQKAFSTCSAHLTVVVIFYGTILFMYAKPKSKDPLGVDKQDVSDKLISLFYGALTPMLNPIIYSLRNKDVKVAVKKLVTQKCFAQ*
280 >lcl|XP_001493475.2|Plus110774462..10775418 NW_001867396 putative olfactory receptor ENSP00000348552-like LOC100061518 __SEG__ Chr25 {Equus caballus} MEVANQSLVAEFVLLGLSDQPKLETTFFVLLLSMYLVILLGNGILILVTILDSQLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAVQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAASSWVAGGANSLVQISLAVQLPFCGDNVINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFIFVSYIF
ILTTILRIPSAEGQQKAFSTCSAHLTVVVIFYGTILFMYAKPKSKDPLGVDKQDVSDKLISLFYGALTPMLNPIIYSLRNKDVKVAVKKLVTQKCFAQ*
281 >lcl|XP_001493488.2|Plus1complement(3057285..3058247) NW_001867427 olfactory receptor 7D4-like LOC100061533 __SEG__ Chr7 {Equus caballus} MEAGNHTEVSEFLLLGLSEDPELQSLLFGVSLSMYLVTVLGNLLIILAVSSDSRLHTPMYFFLSNLSFVDICFISTTIPKMLVNIQAQSTDISYIGCLAQVCFSTIFAGM
DNCLLSVMAYDRFVAICHPLHYMVIMNPRLCGLLLLMSWFIILSVSLIDILLMMQLTFCIGTEIPNFFCELVQVLRVACSDTLINNIFLYVATALLGVFPLTGIIFSYSQ
IVFSLMRMSSAGGKYKAFSTCGSHLSAVTLFYGTGLGVYLSSAVTHSSQRSSIASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLGSVASSPWWVTGLRT*
282 >lcl|XP_001493516.2|Plus1complement(3070908..3071828) NW_001867427 olfactory receptor 7D4-like LOC100061569 __SEG__ Chr7 {Equus caballus} MEAGNHTEVSEFLLLGLSEDPELQPLLFGVFLSMYLVTVLGNLLIILAISSDSHLHTPMYFFISNLSFIDICFISTTIPKMLVNIQVQNKDISYIGCLTQVYFFIMFSGM
DNFLLTVMAYDRFVAICHPLHYMIIMNPRLCGLLVLMSWFIMFWVSLLHILLLWQLTFCLGTEIPHFFCELAQVLKVACSDTFVNNISLYVATALLGVFPLTGILFSYSQ
IVSSLMRMSSAGGKYKALSTCGSHLSAVFLFYGTSLGVYLGSTVTHSPKRSSVASVMYTVVTPMLNPFIYSLRNKDVKGSLGRLFK*
283 >lcl|XP_001493571.2|Plus1complement(10741084..10742043) NW_001867396 olfactory receptor 13F1-like LOC100061652 __SEG__ Chr25 {Equus caballus} MVKTNVTVISNFIFLGFSYYPKVEIAVFVLCLLMYLITLLGNMILISITILDSRLHTPMYFFLSNLSILDIWYTSSALTPMLVNFVSGKNTISFSGCATQMYFSLAMGST
ECVLLSMMAYDRYVAICNPLRYPIIMNKRVCVQIAAGTWVTGCLTALVETMSVLHQSLCGNSIINHFTCEILAVLKLVCSDTSKVQLIMLVISILLLPMPMLLICLSYAF
ILSNILRIGSVDGRSKAFSTCAAHLTVVILFYGTALSMYLKPSAVDSQEIDKFMAFVYAGLTPMLNPIIYSLRNKEVKAAVKKLLIRHPLRALLIPSSK*
284 >lcl|XP_001493594.2|Plus110731717..10732655 NW_001867396 olfactory receptor 2S2-like LOC100061689 __SEG__ Chr25 {Equus caballus} MERTNWTDIEFILQGLSEYPSAEKLLFVMCSVTYLVILLGNSTLITLTLLDSRLHTPMYFFLGNLSFLDICYTSSYIPTLLIHLLSEKKTISFTRCVVQMSVSFTMASTE
CVLLAVMAYDRYVAICNPLRYPIIMSRALCIQMASLSWGLGFLNSLTQTILAVRLPFCGKNVINHFVCEILAFIKLACADISLNEITLMLGNVIFLFSPLLLICISYIFI
LSTVLRINSAEGRKKAFSTCSAHLTVVTVFYGTILFMYMKPKSKDSTFDKLIALFYGVVTPMLNPIIYSLRNTEVHGAMRKLMTRYWFWRKG*
285 >lcl|XP_001493612.2|Plus133848283..33849668 NW_001867389 zinc finger and BTB domain-containing protein 9 ZBTB9 __SEG__ Chr20 {Equus caballus} MDTSTPLPPVAPSPNFSPAPRTIQIEFPQHSSLLLEALNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLRDAPRLTLPSVIEADAFEGLLQLIYSGRLRL
PLDALPAHLLVASGLQMWQVVDQCSEILRDLETSGGGLSTPGSTACHTLLSTTSSPGGWCISSSSFQTEVQSSTSTQSLVGGEGSELEDVLQIQIEEEEEEDQGSAAPSQ
TPQSQRASGDFPRPHGSQPLPVSSTPRRLPEGESAPLEPPAPQTARPLKIFYIKQEPFEPKEEKSGGGTQSGAAEEETKVFAGGDSEGNGELAFLLPSGAGAASGGAGSS
GKPVDLHGNEIVSGSGGPGGAGQAVHGPVKLGGAPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHACPHCGRQFRVHAY
FLRHQDLCKGQGWATAHWTYE*
286 >lcl|XP_001493614.2|Plus1complement(10704281..10705237) NW_001867396 olfactory receptor 13C2-like LOC100061720 __SEG__ Chr25 {Equus caballus} MEWDNQTILVEFFLKGLSGYPRLELLFFVLILIMYVVILLGNGTLILISILDSHLHTPMYFFLGNLSFLDISYTTTSIPSTLVSFLSERKTISFTGCAVQMFLGLAMGTT
ECVLLGMMAVDRYVAICNPLRYPVIMSKESYVPMAAGSWIIGVVNSAVQTVFVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMLVATTLFILTPLLLIIVSYTL
IIVSILKIRSSEGRSKVFSTCSAHLTVVIIFYGTILFMYMKPKSKEKLNSGDMDATDKLISMFYGVVTPMVNPLIYSLRNKDVKEAAKHLLRRKVFNK*
287 >lcl|XP_001493640.2|Plus13210074..3211003 NW_001867427 olfactory receptor 18-like LOC100061767 __SEG__ Chr7 {Equus caballus} MELQNLTHISEFLLLGLSDDPELQPLLFGLFLSMYLVTVLGNLLIILVVSCDSHLHTPMYFFLSNLSLADIGFITTTVPKMLVNIQTHSKSITYAGCLTQVSFFLLFGCL
DSLLLAMMACDRLVAICHPLHYPVIMKPHLCVLLFLVSFFISLLDSQVHYLMVSQLIFCTDLEIPNFFCDVSQLLNLACSDTSANNIVIFFGGTISGFLPISVIVFSYYR
IVSSILRLSSSGGKYKAFSTCGSHLSVVCLFYGTGLGVYLSSAVSSSPRKDAVASVMYTVVTPMLNPFIYSLRNRDIKSALWRVASRIA*
288 >lcl|XP_001493667.3|Plus113220821..13221783 NW_001867387 olfactory receptor 6S1-like LOC100061806 __SEG__ Chr1 {Equus caballus} MPQRKEMTTEMGNGTMVQEFTLEGFPAVQHVGKVLFMVHLLAYLASLTGNVVVVTITCADSRLQTPMYFFLSIFSFTECCVTSSVIPKLLVIFLLGPQTISFPACFIQAF
VFLFLGAAGFLLMAVMSVDRYVAICKPLHYPTIMNLRTSLLLVTACIALGLTLITGLVVKVSQLSFCSPHVIPHFFCDLGPLIHLSCSDTTSVETLTFVLALCILLTSLI
ITIIAYSNIVVTIICLPSAKERRKAFSTCSSHLIVLSLMYGSCVFIYVKPKQTNRLESNRGAALVTTVVTPLLNPVIYTLRNKQVHQALREMMCRIKISK*
289 >lcl|XP_001493694.2|Plus110645514..10646452 NW_001867396 olfactory receptor 13C3-like LOC100061851 __SEG__ Chr25 {Equus caballus} MEKTNWTDIEFILQGLSEYPRAEKLLFVMCSVMYLVILLGNSTLIILTLLDSHLHTPMYFFLGNLSFLDIWYTSSFIPTMLIHFLSKKKTISFTRCVVQMSVSYTMGSTE
CVLLAVMAYDRYMAICNPLRYPIIMSKALCIQMASLSWGLGFLNSLTETILAIRLPFCGKNVINHFVCEILAFVKLACTDISLNEVTIMLGNVIFLFSPLLLICISYVFI
LSTVLRINSAEGRKKAFSTCSAHVTVVIVFYGTILFMYMKPKSKDSAFNKLIALFYGVVTPMLNPIIYSLRNTEVHGAMRKLMTRHWFWRKE*
290 >lcl|XP_001493705.2|Plus1complement(3268018..3268956) NW_001867427 olfactory receptor 7D4-like LOC100061862 __SEG__ Chr7 {Equus caballus} MEAGNHTEVSEFLLLGLSEDPELQPLLFGVFLSMYLITVLGNLLIILAIGTDSHLHTPMYFFLSNLSFVDICFISTTIPKMLVNIQTQSKDISYMGCLTQVCFFTIFVGL
DNFLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLVLISWLIIFWISLIHILLIMRLTFCIGTEIPHFFCELAQVLKLACSDTLINNIFLYVTTALLCVFPLTGILFSYAH
IVSSLMKMNSTEGKYKAFSTCGSHLSVVSLFYGTGLGVYLSSAVIHSSQRNSIASVMYTVVTPMLNPFIYSLRNKDVKRALGRPLSRAASCL*
291 >lcl|XP_001493720.2|Plus110628553..10629515 NW_001867396 olfactory receptor 13C8-like LOC100061882 __SEG__ Chr25 {Equus caballus} MERTNDSMLTEFVLVGLSAHPKLQTVLFLLVLWMYLMILLGNGVLISVSIYDSHLHTPMYFFLCNLSFLDICYTSSSVPLILDSFLTGSKRISFSACMIQMFLSFAMGVT
ECVLLGMMALDRYVAICYPLRYPVIMNKGAYVPMAVASWVSGFVDSVVQTALAMQLPFCANNVINHFVCEILAVLKLACADISINVISMAGSTLILLVIPLLVVSISYIF
IIATILRIPSTEGKRKAFSTCSAHLTVVIIFYGTIFFMYAKPKSKSSVGPDNEDIVEALISLFYGVMIPMLNPLIYSLRNRDVKTAVKNMLGSKNSSDGI*
292 >lcl|XP_001493727.1|Plus1complement(53290695..53291831) NW_001867394 sphingosine 1-phosphate receptor 3-like LOC100061893 __SEG__ Chr23 {Equus caballus} MATVPPPHPGPTPWNEVLRTHYNYVGKLEGRLRDTPEGGTLTTVLFLIVCSFIVLENLMVFIAIWKNNKFHNRMYFFIGNLALCDLLAGVAYTVNILMSGKKTLSLSLTV
WFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKKYRVFLLIGMCWLIAFSLGALPILGWNCLRNLPECSTILPLYSKRYIAFCISVFMAILVTIVILYARIYF
LVKSSSRRVASPHNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACKVKECAVLFKAQWFIALAVLNSAMNPVIYTLASKEMRRAFFRLVCTCLVRGRGTSSSPVQP
ALDPSRSKSSGSNNSSPSSKSKEDPPPLAAPPCITDKNKTLPNGILCK*
293 >lcl|XP_001493732.3|Plus1complement(13261326..13262258) NW_001867387 olfactory receptor 6C2-like LOC100061899 __SEG__ Chr1 {Equus caballus} MEVKNETTIQEFVLEGFPAVQHLGKFLFLVHLLAYLASITGNMVIITITWVDHRLQTPMYIFLSTFSFCESCFITTVIPTLLSIFLSGRQTIPFTACLTQAFAFLFLGSI
IFFLMAVMSLDRHLAICKPLRYPTVMNLRVSFLLVFFCYTLSFIFITGLLVQVSQLSFCGPNVISHFFCDLGSLIHLSCSDTRSVEIYIFFLALLVILIALILTFIAYSN
IIVTIVRLPSAKERQKAFSTCLSHLIVLSLMYGSCVFTYVKPKQTNRLDSNREAALVNTVVTLLLNPVIYTLQNKQIHQALRKTLSRMRL*
294 >lcl|XP_001493748.3|Plus1complement(13270708..13271664) NW_001867387 olfactory receptor 6C4-like LOC100061933 __SEG__ Chr1 {Equus caballus} MEKSMTGDARNRTAVQEFTLEGFPSVQPLGKVLFLVHLLAYLASIMGNTLIITITWADHRLQTPMYFFLSSFSFCECCFITTVIPKLLAMYLSGRKSISFAACFTQAFVF
LFVGTTIFFLMAVLSLDRYLAICKPLYYLTVMNPRMCFLLVIICLALGFFLMVVPVILLSQSSFCGPHVIPHFFCDFGPLTKLSCSDTRSIEMLAFAMDSFVLLTSLIIT
IIAYSNIVFSIVCLPSAKERQKAFFTCSSHLIVLSLMYSSCILIYMKPKQTTSLDSNREAALMNTVVTPLLNPVVYTLRNKQVHQALRDALSRIRLQR*
295 >lcl|XP_001493750.1|Plus1complement(1181153..1182370) NW_001867370 putative G-protein coupled receptor 44-like LOC100061935 __SEG__ Chr12 {Equus caballus} MLANVSVKPLCPILEQMSRLQSHSNTSIRYIDHASVVLHALASLLGLVENGLILFMVGCRMRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHTWELGTTFCKLHSSV
FFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTIPRLDGRVMCYYNVLLLNPGPDRNATCNSRQAALAVSKFLLAFLVPLA
IIASSHATVSLQLRHRGCRRPGRFVRLVMAVVAAFALCWGPYHVFSLLEARAHGDPALRPLVWRGLPFVTSLAFINSVVNPLLYVLTCPDVLHKLRRSLRSVLESVLVDD
SELGGLGSSRRRRASSTANSASSLPLGGRRLSPLRRPGTLLGWLRGGRAASPQRGRARSEDQTAPLNRALSTTSG*
296 >lcl|XP_001493756.2|Plus1complement(6558950..6560845) NW_001867391 leucine-rich repeat-containing protein 70 LRRC70 __SEG__ Chr21 {Equus caballus} MSRKTKNRAMCGLHFSLPCLRLFLLVTCCLVLLLHKEILGCSSVCQLCTGRRVNCRNLGLSSIPKNFPESTVFLYLTGNNISHINESGLTGLHSLVALYLDNSQIVYVYP
KAFVQLRHLYFLYLNNNAIKRLDPGIFEGLSNLRNLYLQSNQVSFVPRGVFNDLVSVQYLNLRRNRLTVLGSGTFVGMIALRVLDLSNNKILRISDSGFQHLGNLDSLYL
EGNNLTKVPSNAFAVLKSLKRLSLSHNHIEAIHPFAFKGLVNLEYLILKNSRIKNVTRDGFSGINNLKHLILSHNDLENLNSDTFSLLKNLIYLKLDRNRIISIDGDTFE
NMGASLKILNLSFNNLTDLHPRVLKPLSSLTHLQANSNPWECNCELLGLRDWLASSAITLNIYCQNPPSMRGRALHYIKWTDFTNCVTSSTNVSRAWAIKSLHIHHKTTA
LMMAWHKVTANGKHLENTESVAFWERIRTSPASRFFQESTFGNPLETTAVLPVQIQLTSSVNLNSGKNSALPIDAASVSGKTSLICTQEVEKLNEAFDILLAFFILACVL
IIFLIYKVIQFKQKLKAPENSGESRLEYYSFYQSARYNVTTSVCNTSPYSLESPALEQIRLQKQIVPESEAQVILFEHSAL*
297 >lcl|XP_001493769.2|Plus1complement(13292604..13293545) NW_001867387 olfactory receptor 6C4-like LOC100061969 __SEG__ Chr1 {Equus caballus} MEKSMIGDARNRTAVQEFTLEGFPSVQPLGKVLFLVHLLAYLASIMGNTLIITITWADHRLQTPMYFFSSFSFCECCFITTVIPKLLAMYLSGRKSISFAACFTQAFVFL
FVGTTIFFLMAILSLDRYLAICKPLYYPTVMNPRMCFLLVTACFGFFLMVVPVILLSQSSFCGPHVIPHFFCDFGPLTKLSCSDTRAIEMLAFVFVSFTILTPLIITIIA
YSNIAVTITRLPSAKERQKAFFTCSSHLIVLSLMYSSCVLIYMKPKQTTSLDSNREAALVDIVVTPMLNPVVYTLQNKQVHQALRDALSRVRL*
298 >lcl|XP_001493785.2|Plus1complement(3348257..3349195) NW_001867427 olfactory receptor 7D4-like LOC100061995 __SEG__ Chr7 {Equus caballus} MEAGNHTEVSEFLLLGLSEDPELQPLLFGVFLSMYLVTVLGNLLIIVAISSDSHLHTPMYFFLSNLSFVDICFISTTIPKMLMNIQTQSKDISYIGCLSQVYFFMVFAGM
DDFLLTVMAYDRFVAICHPLHYVVIMNPRLCCILVLMCWSVIFSVSLFHILLMVQLTFCIGTEIPHFFCELAQLLKVACSDTLINNISLYVATALLFVFPLTGILFSYSQ
IVSSLMRVGTSESKYKAFSTCGSHLSAVSLFYGTGVGVYLSSAVTHSSQRSSVASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLRRTASCL*
299 >lcl|XP_001493800.2|Plus1complement(10559876..10560832) NW_001867396 olfactory receptor 13C2-like LOC100062019 __SEG__ Chr25 {Equus caballus} MEWDNQTILEEFFLKGLSGYPRLELLFSVLILIMYVVILLGNGTLILISILDSHLHTPMYFFLGNLSFLDICYTTTSMPSMLVSFLSERKTISFTGCAVQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYPVIMSKGSYVPMAAGSWIIGVINSAVQTVFVVQLPFCRNKVINHFSCEILAVMKLACADISGNEFIMLVATTLFISTPLLLIIISYTL
IIVSILKIRSSEGRSKVFSTCSAHLTVVIIFYGTILFMYMKPKSKETLNSGDVDANDKFISMFYGIITPMVNPLIYSLRNKDVKEAVKHLLRRKVFNK*
300 >lcl|XP_001493817.2|Plus110544929..10545867 NW_001867396 olfactory receptor 13C3-like LOC100062055 __SEG__ Chr25 {Equus caballus} MEKTNWTEIEFILQGLSEYPRAEKLLFVMCLVIYLVILLGNSTLIILTLLDSCFHTPMYFFLSNLSFLDICYTSASLPAMLIHFLSKKKTISFTRCVVQMSVSYMMASTE
CVLLAVMAYDRYGAICNPLRYPVIMSKTLCIQMASFSWGLGFLNSLVQTLLAIRLPFCGKNVFNHFVCEILAFVKLACADISLNEITLMLDNVIFLLFPLLLICISYVFI
LSIVLRINSVEGRKKAFSTCSAHVTVVIMFYGTILFMYMKPKSKASAVDKLIALFCGAVIPMLNPIIYSLRNTEVHGAMRKLVSRHWFWRKG*
301 >lcl|XP_001493860.2|Plus110519952..10520890 NW_001867396 putative olfactory receptor ENSP00000348552-like LOC100062119 __SEG__ Chr25 {Equus caballus} MERTNWTEIEFILQGLSEYPRAEKFLFVMCLVIYLVILLGNSTLIILILLDSRLHIPMYFFLGNLSFLDICYTSASLPAMLIHFLSKKKTISFTRCVVQMSVTYTMGSTE
CVLLAVMAYDRYGAICNPLRYPIIMSKVLCIHMVVLSWGLGFLISLAQTLLAIRLPFCGKNVFNHFVCEILAFVKLACADISLNEITLMLDNVIFLFSPLLLICISYIFI
LSTVLRINSVEGRKKAFSTCSAHVTVVIMFYGTILFMYMKPKSKASAVDKLIALFYGAVIPMLNPIIYSLRNTEVHGAMRKLITRHRFWKKR*
302 >lcl|XP_001493866.2|Plus1complement(3400682..3401623) NW_001867427 olfactory receptor 7D2-like LOC100062128 __SEG__ Chr7 {Equus caballus} MEAANQTGISEFILLGFSEEPELQPFIFGLFLSMYLVTVLGNLLIILAISSDSHLHTPMYFFLTNLSLVDICFSTTIVPRILVNIHTENKAISYMDCLTQVYFSMFFPIL
DTLLLTVMAYDRFVAICHPLHYTVVMNPRLCGMLVFITWFIGVMTSLLHILLIMHLTFCRDLEIPHFFCELTHILKLACSDTFLNSTLIYFMTGVLGVFPLIGILFSYSQ
IASSIRKMSSSGGKQKAFSTCGSHLSVVSLFYGTGVAVYFTSAVTHSSQKISVASVMYTVVTPMLNPFIYSLRNKDVKGALGRLLSRSASCLW*
303 >lcl|XP_001493877.1|Plus1complement(33282859..33283638) NW_001867381 leucine-rich repeat-containing protein 3B-like LOC100051404 __SEG__ Chr16 {Equus caballus} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
304 >lcl|XP_001493922.2|Plus1complement(10453198..10454154) NW_001867396 olfactory receptor 13C4-like LOC100062223 __SEG__ Chr25 {Equus caballus} MDRVNKTLVKEFILLGLSGYPKLEIIFFALILVMYLLILIGNGVLIIASIFDYRLHTPMYFFLGNLSFLDICYTSSSVPSTLVSLISKKRNISFSGCAVQMFFGFAMGST
ECFLLGMMAFDRYVAICNPLRYPIIMSKVVYVLMASVSWLSGGINSIVQTSLAMRLPFCENNIINHFLCEILAVLKLACADISLNIVTLAVSNMAFLVLPLLVIFFSYMF
ILYTILRMNSATGRRKAFSTCSAHLTVVIIFFGTIFFMYAKPKSQDLLGKDNLQATEGLISIFYGVVTPMLNPIIYSLRNKDVKAAVKYLLSWKTVKQ*
305 >lcl|XP_001493933.2|Plus1complement(24483..25421) NW_001867390 olfactory receptor 2M3-like LOC100062238 __SEG__ Chr21 {Equus caballus} MAWENQTINSGFILLGIFNHNPTHIFLFSLVLSIFTVAFMGNTAMVLLIYLDTQLHTPMYFLLSQLSLMDLMLICTTVPKMAFNYLSGKKYISLASCGTQIFFYVSLLGA
ECFLLAAMAYDHYVAICYPLRYSILMSQKICGLMAASSWILGSLDGIIEVAVVLSFSYCGAREIPHFFCDVPALLTLSCTNTLLFQRMIFICCVIMLLFPVAVIIASYVH
VIRAVIRMGTGDGRRKAFTTCSSHLMVVGMYYGAAMFIYMRPTSDRSPTQDKMVSAFYTILTPMLNPLIYSLRNKEVARAFTKVLGKGKPGE*
306 >lcl|XP_001493948.2|Plus110431381..10432340 NW_001867396 olfactory receptor 13F1-like LOC100062261 __SEG__ Chr25 {Equus caballus} MFQANLTSVTIFLFLGFSHYPKVDITVFVLCLLMYLTTLLGNMILISITILDSRLHTPMYFFLSNLSFLDIWYTSSALAPMLANFVSGKNTISFSGCAAQMYFSLAMGSS
ECVLLSMMAYDRYVAICNPLKYPIIINKRVCVQIAAVSWVTGCLTAFVETVSVLQLPLCGNSIINHFACEILAVLKLSCVDTSKVKLIMLVITILLLPMPMLLICISYAL
ILSNILRISSADGQSKAFSTCAAHLTVVVLFYGVALYAYLKPSGVDSKEIDKFMTLVYAGLTPMLNPIIYSLRNKDVKAAVKKLLIRNLFGTALISVLK*
307 >lcl|XP_001493976.3|Plus1complement(3460245..3461321) NW_001867427 olfactory receptor 7G3-like LOC100062310 __SEG__ Chr7 {Equus caballus} MKDFCQTSDVCVSVLLSLTSLLSSRLINNMESGNQTSVPEFLLLGLLEDPELQPLLFGLFLTMYLVTVLGNLLIILAVSSVSHLHTPMYFFLSQLSLVDISFTSTIVPKM
LVNIQTENKAITYTGCLTQVYFFMVFICMDNLLLTVMAYDRYVAICHPLYYTVIMNLPLCGLLILLSLFISIMNALLHTLMVFHLSFCTDLKIPHFFCELSEILKLACSD
TLINNILVYLVTSLLGVGPLSGIIFSYTRIVSSILRIPSTDGKYKAFSTCGSHLSVVSLFYGTCVGVYLSSAANFPSRRRAVASVMYTVFTSMMNPFIYSLRNRDIKGAL
RKLISGTFSFSWFCHLPWVWASRMTQRE*
308 >lcl|XP_001493988.2|Plus1complement(26488252..26489190) NW_001867389 putative olfactory receptor 2B8-like LOC100062341 __SEG__ Chr20 {Equus caballus} MEQKNGSSFTGFVLLAFSDRPQLELVLFVVLLIFYIFTLLGNTTIIALSHLEPHLHTPMYFFLSNLSFLDLCYTTSIIPQLLVNLSGADKCVSFAGCVVQLYISLGLGCT
ECILLGVMAFDRYVAVCRPLHYTVIMPPRVCALMASASWFIGFANSLLQTVLIFLLPLCGRNKLDHFLCEIPALLKLACVDTTMNESELFFASVIILLIPVALIILSYGG
IVRAISRIKSATGQRKAFGTCGSHLTVVTLFYGTAIYAYLQPSNNYSQDQGKFIALFYTIITPMINPLIYTLRNKDVKGAMRKVLWKDYDSR*
309 >lcl|XP_001494036.2|Plus126460470..26461402 NW_001867389 olfactory receptor 2G6-like LOC100062409 __SEG__ Chr20 {Equus caballus} MERANDSTFSGFILLGFSNRPQLETALFVAILIIYFLSFLGNGTIILLSVLDPRLHTPMYFFLSNLSFMDLCLTTCTVPQTLANFKGKDKTITYGGCVTQLFIALGLGGV
ECVLLSVMAYDRYAAVCRPLHYMVIMHPQLCLQLVVTAWLTGFGNSVVQTALTMTLPLCGKNRVDHFFCEVPVMLKLACTNTSINEAELFAVSVFFLVVPLSLILVSYGH
ITRAVLKIKSAHGRRKAFGTCGSHLMVVIIFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLLNPLIYTLRNKDVKGALRRLVRRTRD*
310 >lcl|XP_001494039.2|Plus1complement(133713..134681) NW_001867390 olfactory receptor 7A17-like LOC100062413 __SEG__ Chr21 {Equus caballus} MEAGNDTQISEFLLLGLSKEAELKPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLVNIQTQSKAITYEGCITQMYFFMLFVVL
DTFLLTVMAYDRLVAICYPLHYPVTMNPVLCALLLLVSWIMSALNYLLQSLMLLWLSFCTDLEIPHFFCEIKQVVQLGCSDTILNDTVMCFSAVLLGGGSLAGILYSYCK
IVSSICGISSAQGKYKAFSTCASHLSIVSLFYCISLGVYLSSAATHSSHSSATASVMYTVLTPMLNPFIYSLRNKEIKKALKRFFGMAAAKGLIVLGLKNLM*
311 >lcl|XP_001494040.3|Plus1complement(2956931..2959069) NW_001867425 LOW QUALITY PROTEIN: TIR domain-containing adapter molecule 1 TICAM1 __SEG__ Chr7 {Equus caballus} MAAGPGPSLSGAFELLGAAGHDKLLYLKHKLKSPRPGCRGAELLHAMVLLKLGQETEARISLEALKADAVARLVARRWAGMAGAEDLEEPPDLSWAVARLYHLLSEEKLC
PEPLRDVAYLAALRAFSSRDDHRLGELQDEARDRCGWDIVEDPVDFGPLHSDMGCLPPASASPSGTRSLPQPIEDLSAWSRGCPLRSGGSRVSLASALEISQSPTMRILS
LQHGPHGPAGCVTSPGPAWHLSPLPRAARSPRR*AGPRRGSPPAPRCCQATQPCGFLRTPRMCLLAWPTPRKLQKPAPITRWSARKCRRHPRLSPRPPGPSGTRRHPSFL
QKTPLGYPPSRAHRLPRPPPRPPPSLLHPPLLPLAQPPPTRVPPLRRPSRRSRSSITSWSCTRGPTSPSPCASARGWRPWACPTGPPSARTSRCRGAGRCAACRTPSTTR
PSPSCCSPPTSTVA*ACTRSARRS*AASRGTAGRTAWSPSCRWRAPRPS*APTPPACSPAWCGWTSTPGSSPGRWPAPLSSSSCGPAEPTGGGNRTPGPCGRRASS*TGS
GCSWRP*MPPTPRTSRAACPGRRRWRSCRQLLGATCHWGLRGLLGARCPGEPSLSQPFPPGPAISRLRGWRAPLHHPSRSPLPSRSPPPSCSPPTSRSPPPSCSPPPSPS
PPPSRSPHLCPPRARGCSLSSSTTRRWCSWGSTTTCGARGGPRRPRTTLSRGS
312 >lcl|XP_001494063.2|Plus1complement(26434879..26435829) NW_001867389 putative olfactory receptor 2B8-like LOC100062441 __SEG__ Chr20 {Equus caballus} MLARLEEKNASSFTGFILLAFSDRPQLELVLFVVLLIFYIFTLLGNTTIIALSHLDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLRGINKSISFGGCVVQLYISLG
LGGTECILLGVMAFDRYVAVCRPLHYTVIMPPHLCALMASASWFIGFANSLLQTVLIFLLPLCGRNKLDHFFCEVPALLKLACVDTSINESEIFFVVVFILLIPVAFIMF
SYGGIVRAILRIKSAAGQRKAFGTCGSHLTVVTLFYGTAIYAYLQRNNNYSQDQGKFIALFYTIVTPMINPLIYTLRNKDVKGAMKNVLWNGHDSR*
313 >lcl|XP_001494064.2|Plus13493249..3494307 NW_001867427 olfactory receptor 7G1-like LOC100062442 __SEG__ Chr7 {Equus caballus} MHTESFPSFYSFSSPDDVCLGGHTCSWSRDHIFSIIFIDNMGLRNKTDVSEFLLMRLTEDPELKTIFFSLFLSMYLVTVLGNMLIVLAVSSDSHLHTPMYFFLSNLSFTD
ICLSTTRIPKMLVNIQAQNQSITYAGCISQICFILTFVCWENFLLAVMAYDRYVAICHPLRYTVIMNPRLCGLLILLSMFISIVDALLHSLMVLRLSFCTHLEIPLFFCE
VVQVIKLACSDTLINNILIYSVASIFAGVPLSGIVLSYIQIVSSILRMSSSGRKYKAFSTCGSHLSVVTLFYGTAFGVYISSAVTNSSRKTAVASMMYTVVTSMMNPFIY
SLRNRDMKGALRMLIGRVSSFL*
314 >lcl|XP_001494105.2|Plus1complement(26387855..26388805) NW_001867389 putative olfactory receptor 2B8-like LOC100062508 __SEG__ Chr20 {Equus caballus} MLARLEEKNASSLTGFILLAFSDRPQLELVLFVVLLIFYIFTLLGNTTIIALSHLDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLRGIDKSISFGGCVVQLYISLG
LGCTECILLGVMAFDRYVAVCRPLHYTVIMPPHLCALMASASWFIGFANSLLQTVLIFLLPLCGRNKLDHFFCEVPALLKLACVDTTMNESEIFFVGVFILLIPVAFIMF
SYGGIVRAILRIKSAAGQRKAFGTCGSHLTVVTLFYGTAIYAYLQRNNNYSQDQGKFIALFYTIVTPMINPLIYTLRNKDVKGAMKNILWKGHDSR*
315 >lcl|XP_001494118.2|Plus1complement(8385416..8386366) NW_001867420 olfactory receptor 11A1-like LOC100062539 __SEG__ Chr5 {Equus caballus} MAISLWENQTTIVEFVLRGFSSVRQLNIFLFMIFLVFYMLTVSGNILIVLLVLVSYHLHTPMYFFLVNLSFLEIWYTSNIVPKMLLIVIAEQKTISVAGCLTQFYFFGSL
AATECLLLAVMSYDRYLAICQPLHYPILMTGPLCMRLAASSWLCCFFLTAITMVLLSQLTFCGPNEIDHFFCDFTPLVHLSCMDTSLTETIAYATSSAVTLVPFLLIMAS
YSCILVAILRIPSGTGRQKAFSTCSSHLTVVTVFYGTLIGTYLMPSANSSQLLHKGFSLLYTILTPMFNPIIYSLRNKDIHEALKKCLSKKSAFLR*
316 >lcl|XP_001494123.2|Plus1complement(26371897..26372835) NW_001867389 putative olfactory receptor 2B8-like LOC100062545 __SEG__ Chr20 {Equus caballus} MEQKNGSSLTGFVLLAFSDRPQLELVLFVVLLIFYIFALLGNTTIIALSHLDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLRGTDKSISFAGCVVQLFISLGLGGT
ECVLLGVMAFDRYVAVCRPLYYTVIMHPRLCALMASASWFIGFANSLLQTLLIFLLPICGRNKLDHFFCEVPAFLKLACIDTSMIQSEMFFLGVFILLIPVTSIMFSYCQ
IVRAILRIKSAAGQRKAFGTCGSHLTVVTLFYGTAIYAYLQPSNNYSQDQGKFIALFYTIVTPMVNPLIYTLRNKDVKGAMRKVLWKDYDSR*
317 >lcl|XP_001494128.2|Plus1175072..176040 NW_001867390 olfactory receptor 7A17-like LOC100062551 __SEG__ Chr21 {Equus caballus} MEPGNLTGVSEFLLLGLSEELKLEPFIFGLFLSMCLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICSTSTTIPKMLLNIQTQSKGITYEGCITQMYFFVLFVML
DIFLLTLMAYDRFVAICHPLNYRVVMNPRLCALLVLVSWILSALDSLLQSLMVLQLSFCTYLEIPHFFCELNQMVQLACSDTFLNDMVTYFVAVLLAGGPFAGILYSYFK
IVSSIRGISSAQGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAATHSSHSSATASVMYTVVTPMLNPFIYCLRNKDMERALKKFFGMAGIKGPIVIRLEKCP*
318 >lcl|XP_001494152.2|Plus1complement(26351981..26352919) NW_001867389 putative olfactory receptor 2B8-like LOC100062587 __SEG__ Chr20 {Equus caballus} MEQKNGSSFTGFILLGFSDRPQLELVLFVVLLIFYIFTLLGNTTIIALSHLDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLRGTDKSISFAGCVVQLFISLGLGCT
ECILLGVMAFDRYVAVCRPLHYTVIVHPRLCVLMASASWLFGVTNSLLQTLLIFRLPLCGRNKLDHFLCEIPALLKLACTDITMIQSEIFFVGALDLLSPVAFIMFSYGR
IIRAILRIKSAAGQRKAFGMCGSHLTVVTLFYGTAIYAYLQPSNNYSQDQGKFISLFYTIVTPMINPLIYTLRNKDVKGAMRKVLWKDYDSK*
319 >lcl|XP_001494204.2|Plus1complement(26323575..26324513) NW_001867389 putative olfactory receptor 2B8-like LOC100062654 __SEG__ Chr20 {Equus caballus} MEQKNGSSFTGFLLLSFSDRPQLELVLFVVVLIFYIFTLLGNTTIIALSHLDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLSGADKTISFAGCVVQLYISLGLGCT
ECILLGVMAFDRYVAVCRPLHYTVIMHPRLCALMASASWFIGFANSLLQTVLTFLLPICGRNKLDHFFCEIPAFLKLACIDISMIQSEMFFASVFMLLIPASLIMLSYGG
IVRAILRIKSSAGQRKAFGTCGSHLTVVTLFYGTAIYAYLQPSNHYSQDQGKFIALFYTIVTPMINPFIYTLRNKDVKGAMKKILWESYDSR*
320 >lcl|XP_001494229.2|Plus1complement(26300641..26301579) NW_001867389 putative olfactory receptor 2B8-like LOC100062692 __SEG__ Chr20 {Equus caballus} MEQKNGSSLTGFLLLGFSNRPGLELVLFVVLLIFYIFTLLGNTTIIALSHLDPHLHTPMYFFLSNLSFLDLCYTTSIVPQLLVNLSGADKSISFGGCVVQLFISLGLGCT
ECILLGVMAFDRYVAVCRPLYYTVIIHPRLCLLMASASWMFGVANSLLHTVVIFLLPFCGRKKLDHFFCEIPALLKLACTDITMIQSEIFFVSALDLLLPVAFIMFSYGR
IIRAILRIKSAAGQRKAFGTCGSHLTVVTLFYGTAIYAYLQPSNNYSQDQGKFIALFYTIVTPMINPLIYTLRNKDVKGAMRKVLWKDYDSR*
321 >lcl|XP_001494232.1|Plus113735795..13736907 NW_001867386 prolactin-releasing peptide receptor-like LOC100066425 __SEG__ Chr1 {Equus caballus} MASVPALGSEAPDLFPGLQPAASTLANQSAEASAGNGSAAGPDAQAVTPFQSLQLVHQLKGLIVLLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMC
TACVPLTLAYAFEPRGWVFGRSLCHLVFFLQPVTVYVSVFTLTTIAVDRYMVLVHPLRRRISLRLSGYAVLAIWALSAVLALPAAVHTYHVELKAHRVHLCEEFWGSQER
QRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHIFNLLRDLDPGAIDPYAFGIVQLLCHWLAMSSACY
NPFIYAWLHDSFREELRKLLLAWPRKIVPHRQSMTVSVII*
322 >lcl|XP_001494267.2|Plus126265508..26266428 NW_001867389 olfactory receptor 2W3-like LOC100062763 __SEG__ Chr20 {Equus caballus} MSSQSCQEQFILLGFSDRPRLEQILFVFVLIFYLVTLVGNIVIIWVSRLDPCLHTPMYFFLTNLSFLDLCFTTSSIPQLLFNLGSPDKTISFTGCAIQLFMFLGLGGTEC
VLLAVMAYDRFTAICKPLRYSVIMHSQLCWKLVSVAWGVGLLNSLVMSPVTMKLPRCGRCRVKHFLCEMPALIKIACVDTVAVESTVFILSVIIVLVPLSLILISYSYIA
LAVLRIKSAAGRRKAFNTCGSHLTVVSLFYGNIIYMYMQPGNNSSQDQGKFLTLFYNLVTPMLNPVIYTLRNKDVKGALKRLVSRK*
323 >lcl|XP_001494287.2|Plus126223344..26224270 NW_001867389 putative olfactory receptor 2W6-like LOC100062794 __SEG__ Chr20 {Equus caballus} MEKANDSSEYAFILVGFSDRPKLEMVLFIVNFILYSVAVLGNSTIILLCVLDPRLHTPMYFFLANLSFLDLCFSTSCIPQMLVNLWGPDKTISYAGCVVQLFSFLSVGGI
ECILLAVMAYDRYVAICKPLHYLVIMHPQLCLRLVAVAWGSGLVNAIVMSPLTMTLPRCGRRRVNHFLCEMPALIKMACVDARPVEMLAFTFAILIVLLPLTLILVSYGY
IAAAVLRIKSAAGRRKAFNTCSSHLTVVSLFYGSIIYMYMQPGNSSSQDQGKFLTLFYNLVTPMLNPLIYTLRNKEVKGALKKVLGRQ*
324 >lcl|XP_001494310.2|Plus126210689..26211630 NW_001867389 olfactory receptor 2B6-like LOC100062825 __SEG__ Chr20 {Equus caballus} MNRVNESIPQEFVLLGFSDQPWLEFPLFVVFFISYIITIFGNLTIILVSCLDSKLHTPMYFFLTNLSLLDLCYTTSTVPQMLVNLYSARKVISYGGCVAQLFMFLALGAT
ECVLLAVMSFDRFVAICRPLHYSVVMHRRLCLQLAASSWITGFGNSVWLSTLTVQLPLCGSRVVDHFLCEVPALLKLSCVDTTANEAELFFVSVVFHLIPLTLILISYAF
IAQAVLRIQSAEGRQKAFGTCGSHLIVVSLFYGTAISMYLQPPSPNSKDRRKMVSLFYGIIAPMLNPLIYTLRNKEVKEAFKRLVARVFLIKK*
325 >lcl|XP_001494332.2|Plus126193920..26194858 NW_001867389 putative olfactory receptor 2W6-like LOC100062850 __SEG__ Chr20 {Equus caballus} MEKDNTSSFEGFFLVGFSDRPHLELILFVVVLSFYLLTLLGNMTIILLSALDSRLHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYLGCAIQLYFVLALGGV
ECVLLAVMAYDRYAAVCKPLHYTVIMHPRLCGQLASVAWLSGFSNSLIMAPQTLMLPRCGHMRVDHFLCEMPALIGMACVDTMTLQALAFALAIFIILAPLFLILISYGY
IAGAVFRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFFTLFYTIITPSVNPLIYTLRNKDVKEAMKKVLGKGSAEA*
326 >lcl|XP_001494353.2|Plus1complement(26161326..26162294) NW_001867389 olfactory receptor 2B2-like LOC100062880 __SEG__ Chr20 {Equus caballus} MNQVNESVPQEFILLGFSDRPWLELPLFVVFLVSYILTIFGNLAIILMSRLDSKLHTPMYFFLTNLSLLDLCYTTSTVPQMLVNICNSRKVISYGGCVAQLFIFLALGST
ECLLLAVMSFDRFVAICRPLHYSVIMHQRLCLQLAAASWISGFSNSVLQSTLTLQMPLCGHKEVDHFFCEVPALLKLSCVDTTANEAELFFISVLFLLIPVALILISYAF
IVQAVLRIRSAEGRRKAFGTCGSHLIVVSLFYGTAIYMYLQPPSPASKDRGKMVSLFYGIITPMLNPLIYTLRNKDVKGAFKRSIARVFSIKTWEYPNNRPR*
327 >lcl|XP_001494411.2|Plus1388257..389198 NW_001867390 olfactory receptor 1I1-like LOC100062968 __SEG__ Chr21 {Equus caballus} MEPENQTVGSEFFLLGLTEKPEHQTLLFGLFLSMYLVTVFGNLLIILAIITDSHLHTPMYFFLSNLSLVDIFFSSTTVPKMLVNLWTQSRAIPFAGCLTQMYAFHLFGTM
DSFLLAVMAIDRFIAIVHPLRYSVIMSPRVCVLLVGGLWLITNFQSLVHTCLMAQLTFCGGSEIPHFFCDLMPLLKLSCSDTHTNELVIFAFGIIMGISPLSCILFSYTC
IFRAVFKIPSAQGKWKAFSICGSHLTVVSLFYGTIFAVYLQPTSAASSQKNKAATLMCGVVIPTLNPFIYSLRNKDMKVALRKLVGKAAPPRS*
328 >lcl|XP_001494421.2|Plus115458125..15458979 NW_001867398 protein phosphatase 1 regulatory subunit 3B-like LOC100062982 __SEG__ Chr27 {Equus caballus} MAVDIECRYSCMAPSLRRERCAFQISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADTQGLALTMVKVFSEFDDPLDIPFNITELLDNIVNLTTAESESFV
LDFSQPSADYLDFRNRLQTDHVCLENCVLKDRAIAGTVKVQNLAFEKTVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECSGQTY
WDSNKGKNYRIIRAELKSTQGTAELPNGPDFGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
329 >lcl|XP_001494484.2|Plus1complement(3796300..>3797259) NW_001867427 olfactory receptor 7G1-like LOC100063056 __SEG__ Chr7 {Equus caballus} SIRLANNMKPTNETDVIEFHLMEVTNDPKLKSLMFILFLSIYLVTVLGNLLIILAIITDSNLHTPMYFFLSNLSFTDICLSTTTIPKMLLNIKEQNQSITYTGCLTQVSF
ALTFPNLENFLLAVMAYDRYIAICHPLRYTVIMNPRFCGLLILLSLLISILNALIHSLMVLRLSFCPDPEIPLFFCEIAQVIKIACSDTLINSILIYLAASIYGCVPPSG
IIFSYTQIASSILRVPSVGGKYKAFSTCGSHLSAVSLFYGTGVGVYISSVFTHSSRKMAVASVIYNMVTPMLNPFIYSLRNRDMKGALRKIIGSVPSFQ*
330 >lcl|XP_001494612.2|Plus15846089..5847051 NW_001877049 olfactory receptor 10R2-like LOC100063279 __SEG__ ChrX {Equus caballus} MASLQKNYSVNSEFILLGFGDLDELQIFFCGLFLTMHLVTLAGHTTIVLITLIDSCLQTPMYFFLRNLSTIEICYILVIVPNMLANFLSRSQRMPFLNCALQMHLFIALG
GAECFLLAVMAYDRFVAICNPLRYTLIVTRALCLQMLALACVSGFALSLTLTTLIFLLPFCRSHEINHFFCDIPAVLFLACSDTRANEIAVFLVCMLILLIPFLLILLSY
GFIIAAILRIRSAEGRGKAFSTCAGHLLVSLMHYGCAIFIYIRPKSCYTPEQDKIVSLIYTNVTPMLYPMIYSLRNKEVNGALRRLLGSHSQMRQQPNTR*
331 >lcl|XP_001494656.2|Plus16033183..6033461 NW_001867419 dolichol-phosphate mannosyltransferase subunit 3-like LOC100063346 __SEG__ Chr5 {Equus caballus} MTKLAQWLWALALLGSAWAALTMGALGLELPSSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGMRF*
332 >lcl|XP_001494795.2|Plus138456296..38457237 NW_001867394 ras-related GTP-binding protein A-like LOC100063565 __SEG__ Chr23 {Equus caballus} MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCL
EAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCK
EQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGAKHSLLMR*
333 >lcl|XP_001494860.1|Plus1complement(19343026..19344099) NW_001867427 tsukushin-like LOC100063671 __SEG__ Chr7 {Equus caballus} MPWPLLLPPLLLLAASGAQTTRPCSPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTTHLDLSSNRLETVNESVLAGPGYTTLAGLDLSHNLLTSILPTAFSR
LRYLESLDLSHNGLAALPADSFTSSPLSDVNLSHNRLQEVSVSAFTTHSQGRVLHVDLSHNLIHRLLPHPAGASLPTPTIQSLNLAWNQLRAVPDLHDLPLRYLSLDGNP
LAAIGPGAFTGLVGLTHLSLGSLQGVPQLAPYGFRELQGLQVLDLSGNPKLKWAGAEMLSGLDSLQELDLSGTALVPLPEMLLLHLPALQSVSVGQGVRCRRLVREGAYP
RQPGSSPKVALHCVEAQELAARGPDTL*
334 >lcl|XP_001494891.1|Plus19567024..9568505 NW_001867420 amphoterin-induced protein 1 AMIGO1 __SEG__ Chr5 {Equus caballus} MQPPGDLRGLWLLLLSFFLLLFEVARAGRPLVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNHLNFISSEAFSPVP
NLRYLDLSSNQLRTLDEFLFSELQALEVLLLYNNHIMAVDRSAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHN
NPLHCDCELYQLFSHWQYRQLSSVMDFQEDLYCMSSKKLHNVFNLSFLNCSEYKERAWEAHLGDPLTIKCDTKQQGMTKVWVTPNNERVLGEVANSTVTVSKDGSLHFEH
VQVEDGGVYTCYAMGEAFNETLSVELKVYNFTSHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRR
VAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV*
335 >lcl|XP_001494932.1|Plus1complement(14246027..14247106) NW_001867382 protein mab-21-like 1 MAB21L1 __SEG__ Chr17 {Equus caballus} MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAG
KQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALENAAKQTWRLAREILTNPKSLEKL*
336 >lcl|XP_001495067.1|Plus1complement(10867805..10868797) NW_001867422 G-protein coupled receptor 55-like LOC100063969 __SEG__ Chr6 {Equus caballus} MSQGNKSEDCSFSDVDELMKSVQLAVYVPTFLLGLLLNVLAIRGFCTFLQKRCLDYAATSIYMINLAVFDLLLVLSLPFKTVLNHVPTPFPSFCTLAECLYFISMYGSVF
TICFISLDRFLAIQYPIQVSHLRSPRKIFGICFIIWVLVWAGSIPIYNFHGQVETYKCFHNMSDSTWSAKVVFPLEVFGFLLPMAVMGFCSSRSIRILIGRRDHNQDWVQ
RKACIWTIAANLAVFVVSFLPVHLAFFLQFLVRNGFIVECRAKQNISLFVQLSMCFSNVNCCLDVFCYYFVIKEFRMGIMAHRPSRAQLILQDTLTTGATKKDLIKESKP
*
337 >lcl|XP_001495108.1|Plus1complement(21063775..21064278) NW_001877040 protein tyrosine phosphatase type IVA 1-like LOC100052288 __SEG__ ChrX {Equus caballus} MNRPAPVEIAYRNMRFLIAHSPTNASLNKFLQELKRNGVTIIVRVCEATYNTAILEKEGIQVLDWPFDDGAPPPRHIVEKWLKLIKQKFRQDPGSCIAVHCAAGLGRAPV
LVAIALIEGGMKSEDAVQFIRQKRRGAFNSKQLLYLEKYRPTMCFRLRNSRCNCFVQ*
338 >lcl|XP_001495121.1|Plus129845088..29847070 NW_001867395 leucine-rich repeat transmembrane protein FLRT2 isoform 1 FLRT2 __SEG__ Chr24 {Equus caballus} MGLQTTQWPSHGAFFLKSWLLISLGLYSQVSKILACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAVSLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKG
IAEGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLACPTTTPGLPLFTPAPSTVSPTTQPPTLSVPTPSRSYTPLTPTTSKLPTIPDWDGRERVTPPISERIQLSIHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASYVNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGISYTDCHIPNNMRYCNSSVPDLEHCHT
*
339 >lcl|XP_001495161.2|Plus1complement(3674722..3676104) NW_001867370 muscarinic acetylcholine receptor M1 CHRM1 __SEG__ Chr12 {Equus caballus} MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASN
ASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRAR
ELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEDDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPT
RKGRERAGKSQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKR
RWRKIPKRPGSVHRTPSRQC*
340 >lcl|XP_001495244.1|Plus131820821..31821843 NW_001867395 psychosine receptor-like LOC100061785 __SEG__ Chr24 {Equus caballus} MNSTCIEEQHDLDHYLFPIVYVIVVIVSIPANIGSLCVSFLQVKKENELGIYLFSLSLSDLLYTLTLPLWIDYTWNKDNWTFSPALCKVSAFFTYMNFYSSTAFLTCIAV
DRYLAVVYPLKFFFLKTRRFAFMVSLFVWILETIFNAVILWEDETTIEYCDAEKSNFTLCYDKYPLEKWQIKLSLFRTCACYAIPLVIIMVCNLKVYQAVQHNRATEDSE
KKRIIKLLVSITLTFILCFTPFHVMLLIRCILERNANLDNNLFDHKSGKQSYKMYRITVALTSLNCVADPILYCFVTETGRSDMWNVLKFCTGRLNTSQRQRKRIPSMST
KDTVELDILE*
341 >lcl|XP_001495336.2|Plus1complement(4503444..4504382) NW_001867427 olfactory receptor 7D4-like LOC100064357 __SEG__ Chr7 {Equus caballus} MEEGNDTEISEFLLLGLSEDPELQPLLFALLLSMYLVTLLGKLLIILTIISDSHLHTPMYFFLSNLSFVDICFTSTTVPKMLVNIQAQRKDISYIGCLTQVYFLMIFALL
DVFLLTVMAYDRFVAICHPLHYMVIMNPRLCGLLVLMCWFIIFWVSLFHILLLRRLTFCIGTKIPHFFCELAQVLKLACSDTLINNTSMYVATALLGVFPLIGILFSYSQ
IVSSIMRISSAGGKYRAFSTCASHLSAVSLYYGTGLGVYFSSALTHSSHRSSIASVMYTVVTPMLNPFIYSLRNKDVKGALRKLLSRAASCL*
342 >lcl|XP_001495385.2|Plus12133784..2134689 NW_001867430 leucine-rich repeat-containing protein 30-like LOC100059558 __SEG__ Chr8 {Equus caballus} MGARQSSAHSQDKGPKGMVLLAGRQKFSPWDDALLSGKDPRSLLKRGIRHVSFSLVTKGMTDIPDFLWGLSEVQKLNLSHNQLRVLPPEVGKLTRLVVLNLCGNRLKSLP
REISLLKSLKVLFVNMNCLTEMPAELSACKNLEVLSLSHNCLSQLPASFADLPRLRKLNISNNYFAHIPICVFSLKELDFLHVGSNRLENIAESIQCLVSLQIFIAERNN
IHSFPRSLCLLTSLELLNLNNNDIQTLPDELYLLCRLARIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLFSYLKDKKHN*
343 >lcl|XP_001495503.2|Plus1278065..278994 NW_001867369 olfactory receptor 4B1-like LOC100064597 __SEG__ Chr12 {Equus caballus} MASTNNVTKLIITGLFQDPEIQRVCFVMFLLMYLATVVGNGLIVVTVSISKSLNSPMYFFLSYLSVVEVSYSSTVAPKFISDLLVRVKTISLEGCVVQIFFFHIFGVTEI
LLLTVMAYDRYVAICKPLHYTTIMSRLMCHLLVAGSWLGGIIHSVAQILVTVKLPFCGPNVIDHYFCDLHPLFKIACTDTSVEGVIVLTNSGLISVFSFLILVSSYIVIL
FNLRNHSAEGRHKALSTCASHITVAILFFGPAIFLYMRPSSTFTVDKLVAVFYTVITPMLNPIIYTLRNSEVKNIMKRLWGKKVNSGMQ*
344 >lcl|XP_001495600.1|Plus13276522..3277847 NW_001867395 suppressor of cytokine signaling 4 SOCS6 __SEG__ Chr24 {Equus caballus} MAENSENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVNSIEKTEVPLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAMGQCFPIKNCSS
RHPSGLSSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINPKSDEWVSTDLSQSELRDGQLKQRRTVEEEVNCFPHTIVQPCVITTNNASCRGGPMTGSVMNLVS
NNSIEDSDMDSDDEIITLCTSSRKRNKPKWETDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSR
SLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPVPSAMKLYLKEYHYKSKVRVLRIDAPEQQ
C*
345 >lcl|XP_001495672.2|Plus120857653..20858618 NW_001867427 olfactory receptor 2AT4-like LOC100064846 __SEG__ Chr7 {Equus caballus} METIACNGSEDSSTIFYLMGIPSLPKSLFLPIFFVFLLLYLLILVGNALILMAVVAEPSLHKPMYFFLINLSALDIIFTTTTVPKMLSLHLLGDRLLSFPACFLQMYLFH
SFSCSEAFILVVMAYDCYVAICRPLHYPVLMAPQTNAALAAGAWLTALLLPIPAVVQTSHMAFSPVAQVYHCFCDHLAVVQASCSDTTPQTFMGFCIAMVVSFLPLLLVL
LSYAHILASVLRISSREGRSKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGNVVYAILTPVLNPLIYTLRNKDVKVAIAKIACPRYPKNSGKA*
346 >lcl|XP_001495722.2|Plus14268298..4269257 NW_001867396 putative olfactory receptor ENSP00000348552-like LOC100064915 __SEG__ Chr25 {Equus caballus} MDRSNQTSPMVGFILLGLSAHPGLEKMFFVLILLMYLVVLLGNGVLMLVTTLDSHLHTPMYFFLGNLSFLDICYTTSSVPLILNSFLTPRKTISFSGCAVQMFLSFAMGA
TECVLLSMMAFDRYVAICNPLRYPVIMSKAVYVPMAISSWAAGLTTSIVQTSQAMRLPFCGDNIINHFTCEILAVLKLACADISINVISMVVANVIFLAIPVLFIFVSYM
FIIATILWIPSAEGRKKAFSTCSAHLTVVVVFYGTILFMYGKPKAKDPLGADKQDLSDKLISLFYGVVTPMLNPVIYSLRNKDVKAAMKKLIHQKHLTE*
347 >lcl|XP_001495811.2|Plus1582206..583144 NW_001867369 olfactory receptor 4P4-like LOC100065048 __SEG__ Chr12 {Equus caballus} MENQNNVTEFVFMGLWGNKQIELLFFFLFLLCYLTVLMGNFIILLTITCSHLIQQPMYYFLCHLSLMDLCYTSTVVPRLIRDLAAAKKNISYNNCMTQLFTAHLLAGVEI
FILVSMAFDRYVAIVKPLHYMVIMNRQRCNMLIVMAWVVGFWHSVALLLMVLNLPFCGPNQIEHYICDVKPLLKLVCKDIHVVSILVIANSGMVVVAIFFVLVASYILIL
YNLRTHSSAGRRKALSTCSSHITVVVLFFVPCIYTYVLPAGSENKDKEISVFYTVIAPMLNPLIYTLRNVEMKITMWKVWSQMAHSNLKFLR*
348 >lcl|XP_001495848.1|Plus1complement(4144035..4145810) NW_001867396 calicin-like LOC100065102 __SEG__ Chr25 {Equus caballus} MKLIFTEKNYDSFLLQKLNEQRKRKEYWDMALTVDHHVFYAHRIVLAAVSSVVKNIISGNDVKTTDELFITIDPSYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTTRLQIHCNDYLIKSIRRANCLRYLLLAELFGLKEVSDLAYTGIRDNFHYWASPEGSVQPKGFMRCPPVIFGRLLQDENLHVLNEDQALSALIDWVYFRKEEREKYFK
KFFTYINLNAVSNKTLIFASNKLMGMKNSSGHTSLIESVLMERQQERPSSLLSHQRKGALLDSVVILGGQKAHGKYNNGVFAYVIQENLWLKLSEMPYRAAALSATSTGR
YIYISGGTNEQITGLKTAWRYDVDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYFYDERKETWCLAGKMSIPMDATAVITKSDQSLYIVTGRCLVKG
YISRVGVVDCFDTNTGEVVQSITFPIEFNHRPLLSFHQDNILCVHSHRQSMEINLQKIKANKMTTSLPLLPNNCPLNVSHAICSIGDGRVFVCGGVTRASDVQEKDYTIN
PNAYLLDQKTGKWKTLAPPPEALDCPACCLVKLPCKILQRN*
349 >lcl|XP_001496008.2|Plus1complement(734300..735238) NW_001867369 olfactory receptor-like protein OLF2-like LOC100065349 __SEG__ Chr12 {Equus caballus} MDGENCSSLNEFLLLGISDNPGMKVTLFTTFLIVYLTILVANLGMIILIRIDSQLHTPMYFFLSHLSFSDLCYSTAIGPRMLVGFIAKNKSISFYGCALQWLIFCTFVDS
ECLLLVVMAFDRYKAISNPLLYTVNMSSRVCSLLMVVVYMTGIMDALINTILTFRLCFCGSNEINHFFCDIPPLLLLSCSDTQVNELVIFTIFGLIELVTLSGLFVSYCY
IILAVIKIQSAEGRFKAFSTCTSHISVVAIFQGALLFTYFRPSSSYSLDQDKMTSLFYSLVCPMLNPLIYSLRNKDVKDALKKLKNKKCFHL*
350 >lcl|XP_001496060.2|Plus1801112..802038 NW_001867369 olfactory receptor 8K5-like LOC100065423 __SEG__ Chr12 {Equus caballus} MDKQNITVLKEFIFMGVTDHPELQAPLFGLFLIIYVISVVGNLGMVILTKMDSRLQIPMYFFLRHLAFVDFGYSTAIGPKMLVNFVANHNTIPYNWCATQLALFILFIIS
ELFILSAMAYDRYVAICNPLLYTVIMSQRVCWVLVAVPYFYSAFLSLITTIKIFISSFRGSNVISHFYCDSLPLLTLLCSSTREIELIILIFSALNLVSSFLIVLVSYIL
ILVAILKMNSAEGRHKAFSTCGSHLTVVVVLYVTLLFMYLQPKSSHSFDTDKMASVFYTLVIPMLNPMIYSLRNKEVKGALHRIWKNL*
351 >lcl|XP_001496064.1|Plus1complement(17152911..17153990) NW_001867381 c-C chemokine receptor type 3-like LOC100065437 __SEG__ Chr16 {Equus caballus} MATTLDGTETVGEAEGTTPYDYDGSLPCEKINIKMLAAQFLPPLYSLVVVIGLLGNLMVVVILTKYKRLRIMTNIFLFNLAISDLLFLFTLPFWIHYVWRDEWVFGHHMC
KFLIGLCYTGLYSEIFFIILLTLDRYLAIVHAVFALRTRTVTFGIITSVFTWGLAGLAALPEFIFHGFQEEFGQYVCLPFYPEAAENIWKSTHVLRMNILSLALPLLIMA
VCYSGIIKTLLRCPNKKKYKAIRLIFVIMVVFFVFWAPYNLVLFFSTFQTTFLGTSCDQSKQLDMALLVTEMIAYTHCCVNPVIYAFVGERFQKNLHHFFHTYVAIYLCK
YIPFLPSEKLERASSVSPSTGEQELSAAF*
352 >lcl|XP_001496081.2|Plus117195450..17196517 NW_001867381 c-C chemokine receptor type 1-like LOC100065466 __SEG__ Chr16 {Equus caballus} MEISVTPNDYDMTTEFDYGVATPCQKEQLRAFGAQLLPPLYSLVFVIGLVGNILVVLVLMQYKRLKSMTSIYLLNLAISDLLFLFTLPFWIDYKLKDNWVFGDGLCKLLS
GLYYTGLYSEILFIILLTIDRYLAIVHAVSALRARTVTWGIVTSIITWVLALLASIPGLCFSKTQGEFSHYTCSLHFPSESLKEWKQFQALKMNILGLVLPLLVMIICYT
GIIKILLRRPNEKKAKAIRLIFVIMIIFFLFWTPYNLTMFVSAFQNFFFTNECEQSKQLDLAIQVTEVIAYTHCCVNPVIYVFVGQRFRKYLRQLFHRLVTVHLAKWLPF
LSIERLDRASSMSPSTGEHELSAGF*
353 >lcl|XP_001496111.2|Plus1complement(24841976..24842914) NW_001867389 olfactory receptor 2M2-like LOC100065498 __SEG__ Chr20 {Equus caballus} MEWENQTFSSDFILMEIFSHTPTHIFLFSLVLGIFTVALLTNTIMVLLIYLDTRLHTPMYFLLSQLSLMDLMLTCTTVPQMAYNYLSGRRSISVAGCETQIFFFVSLLGG
ECFLLAVMAYDRYVAICYPLQYHNLMNQKICGLMAASSWILGSLDGIVDVAATLSFSYCGSREIAQFFCDVPALLSLSCTDTSTFETVLFICCLLMLLFPLLLIVISYTR
VIAAVIRMSSGEGRHKAFTTCTSHLIVVGMYYAAAMFIYMRPTSNRSPTQDKMVSSFYSILTPMLNPLIYSFRNKDVAKAFSKVLGKGKSRE*
354 >lcl|XP_001496113.2|Plus1850573..851514 NW_001867369 olfactory receptor 5AL1-like LOC100065500 __SEG__ Chr12 {Equus caballus} MAKGNHSAITEFILLGLTGNPKLQAILFCVFLLIYLVTALGNLGLIVLIQISSQLQTPMYFFLCHLAFIDFFGTSAITPNTLVNSLREIKSTSFYACATQVCCFITFSVW
ELLMLSIMAYDRYVAICKPLLYVVLMPKKLCIQMVTSCYIYGFTVGLIQAVATFHMSFCDSNVVNQFYCDDVPLIALACSDTRVKELMLLTIAGFNVFCSLITVLISYVF
IVFTILRIHSAVGRQKAFSTCASHLFSITIYYGTLSFMYLQPKSKHSLDKDKFASVFYAVVIPMLNPLIYSLRNQEVKNALKKITEKLYSSNR*
355 >lcl|XP_001496131.2|Plus1complement(24823606..24824544) NW_001867389 olfactory receptor 2M3-like LOC100065521 __SEG__ Chr20 {Equus caballus} MEWENQTSSSDFILMGIFSHTPTHMFLFSLVLGIFTVAFLANTIMVLLIYLDTRLHNPMYLLLSQLSLMDLMLICTTVPKMAYNYLSGRRSISAAGCEAQIFFYVSLFGA
ECFLLAVMAYDRYVAICYPLQYHNLMNWKICGVMVASSWILGCLDGIVDVAATLSFSYCGSREIAQFFCDLSALLSLSCTDTSTFETLVFICCVLMLLFPLLLIVISYTR
VIMAVIRMSSEEGRHKAFTTCTSHLLVVGMYYGAAMFIYMRPTSNRSPTQDKMVSSFYTILTPMLNPLIYSFRNKDVAKAFSKVLEKGKFRE*
356 >lcl|XP_001496153.2|Plus1complement(24801080..24802027) NW_001867389 olfactory receptor 2M3-like LOC100065548 __SEG__ Chr20 {Equus caballus} MEWENQTSSSDFILMGIFSHTPTHMFLFSLVLGIFTVALLANTIMVLLIYLDTRLHNPMYLLLSQLSLMDLMLICTTVPKMAYNYLSGRRSISAAGCEAQIFFYVSLLGA
ECFLLAVMAYDRYVAICYPLQYPNLMNWKICGVMVASSWILGSFDGIVDVATTLSFSYCGSREIAQFFCDVSVLLTLSCTDTSTFETLVFICCVLMLLFPLLLIVISYTR
VIMAVIRMSSEEGRHKAFTTCTSHLLVVGMYYGAAMFIYMRPTSNRSPTQDKMVSSFYTILTPMLNPLIYSFRNKDVAKAFSKVLGKGKPGKLIG*
357 >lcl|XP_001496154.2|Plus1complement(863587..864546) NW_001867369 olfactory receptor 1038-like LOC100065549 __SEG__ Chr12 {Equus caballus} MAEVNITYVTEFILKGITDRPELQAPCFVVFLVLYVVTVLGNLGLITLIRIDARLHTPTYYFLSHLAFVDLCYSSAITPKMMVNFVVEHDTIPFHACATQLGCFLTFMTT
ECFLLASMAYDRYVAICSPLHYSTLMSKRVCIQLVAVPYIYSFLVALFHTIITFRLAYCGPNVINHFYCDDLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYIF
IIAAILRIHSTQGRCKAILTCGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDAFKKAMDKGCETSKILKLRK*
358 >lcl|XP_001496156.3|Plus1complement(11926376..11927320) NW_001867419 olfactory receptor 5V1-like LOC100065551 __SEG__ Chr5 {Equus caballus} MNNQTEVTEFIFLGFSNHPKLQGLLFLIFLVIYPTTLLGNTLIIMATRIGPALHTPMYYFLSNLSFLDVCYTSTTIPVLLMNFFLEKKTISYEGCLSQIFFLVTCAGTEG
VLLAAMAYDRYLAICHPCQYSVLMSVKVCAFLVTGSWLCGLVNSVTHTVLAATLTLCGPNQISHFLCDIPLLLKLSCSDTSLNESVLHVASATIGLSPCLFTAVSYILII
STILRIPSAQGRSKAFSTCASHLTVVVVFYGMANFNYDRPREGYNLDVDILVSVLFCFMTPMLNPIIYSLRNKEVKGALRKLSGRWVFPANICV*
359 >lcl|XP_001496181.2|Plus1complement(24779560..24780507) NW_001867389 olfactory receptor 2M3-like LOC100065589 __SEG__ Chr20 {Equus caballus} MEWENQTSSSDFILTGIFSHTPTHMFLFSLVLGIFTVALLANTIMVLLIYLDTRLHNPMYLLLSQLSLMDLMLICTTVPKMAYNYLSGRKSISVAGCEAQIFFYVSLFGA
ECFLLAVMAYDRYVAICYPLQYHNLMNWKICGVMVASSWILGSFDGIVDVAATLSFSYCGSRKIPQFFCDVSALLSLSCTDTSTFKTLAFICCVLMLLFPLLLIIVSYTH
VIVAVIRMSSQEGRHKAFTTCTSHLLVVGMYYGAAMFIYMRPTSNRSPTQDKMVSSFYTILTPMLNPLIYSFRNNDVAKAFSKVLGKGKPRKLFG*
360 >lcl|XP_001496182.3|Plus1complement(898871..899812) NW_001867369 olfactory receptor 5M3-like LOC100065591 __SEG__ Chr12 {Equus caballus} MTEKMLNFTDVTEFILLGLTGHREWQVLFIIFLVVYLITMVGNIGMIMLIKVSPQLNSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSETKTISYAGCLIQCFFFIALVH
VEIFILAVMAFDRYVAIGNPLLYGSKMSRVVCIRLISFPYIYGFLTSLAATLWTYGLYFCGKIEINHFYCADPPLIKLACAGTFVKEYTMIILAGINFTYSLTVVIISYL
FILIAILRMQSAEGRWKAFSTCGSHLTAVIIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMNKVISRTCLTQ*
361 >lcl|XP_001496191.1|Plus13795085..3796860 NW_001867396 calicin-like LOC100065605 __SEG__ Chr25 {Equus caballus} MKLIFTEKNYNSFVLQKLNKQRKRKEFWDMALTVDHHVFYAHRVVLAAVSSVVKNIISGNDVKTTDELFITIDPSYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNIPHLQIHCSDYLIKSIRHANCLRYLLLAELFGLQEVSDLAYTGICDNFHYWASPEGSVQPEGFMCCPPVIFGRLLQDENLHVLNEDQALSALIDWVYFRKEEREKYFK
KFFSYINLNAVSNKTLMFASNKLMGMKNSSAHTSLIESVLVERQQERPSSLLSYQRKGALLDSVVILGGQKAQGKFNNGVFAYVIQENLWLKLSEMPYRAAALSATSAGH
YIYISGGTNEQITGLKTAWRYNINDNSWTKLPDLPLGLVFHTMVTCRGTVYSVGGSIAPRQYVSSIYRYDERKEAWCPAGKMSIPMDATAVVTKGDQSLYIVTGRCLVKG
YVSRVGVVDCFDTNTEEVVQSITFPIEFSHRPLLSFNQDNILCVHSHQQSMEINLQKTKANKMSTLLPLLPNSCPLDVSHAICAIGDGRVFVCGGVTTATDVQKRDYTIN
PNAYLLDPKTGEWKTLAPPPEALDCPACCLAKLPCKILQRN*
362 >lcl|XP_001496201.1|Plus117425284..17426876 NW_001867410 [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial PDP2 __SEG__ Chr3 {Equus caballus} MSSSVSYWILNSARNSIATLQGGGRLYSRCASNWNKSKWRLFSPALATLKNDAPCGSFALQKAYRHTSTEEDDFHLQLSPEQVNEVLRAGESAHKILDLVNGVPNSVLRF
ESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSQQTLEQMEGAMESMKPLLPILQWLKHPGDSIYKDVTSMHLDHLRVYWQELLDV
HMEMGLNIEEALMYSFQRLDSDISLEIQAPLEDEMTRNLSLQVAFSGATACMAHVDGVHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKKEHPASED
KTVIMDDRLLGILMPCRAFGDVQLKWSKELQRSVLERGFDTEALNIYQFTSPHYYTPPYLTAKPEVTYHRLRPQDKFLVLASDGLWDMLGNEDVVRLVVEHLAEAGRHKP
DLAQRPANLGLMQSLLLQRKAQGLQAADQNAATHLIRHAIGSNEYGEMEPERLTAMLTLPEDLARMYRDDITVTVVYFNSDSIDACYKGD*
363 >lcl|XP_001496206.3|Plus124738927..24739865 NW_001867389 olfactory receptor 2M2-like LOC100065632 __SEG__ Chr20 {Equus caballus} MEWENQTSGSDFILMGIFSHTPTHIFLFSLVLGIFTVALLANTVMILLIYLDTRLHTPMYFLLSQLSLMDLMLICTTVPKMACNYLSGRQSISVAGCEAQIFFYVSLFGA
ECFLLAVMAYDRYVAICYPLQYHNLMNQKVCGLMVASSWILGSFDGIVDVTTTLSFSYCGSRKIPQFFCDVSALLSLSCTDTSTFETLVFICCVLMLLFPLLLIVISYAR
VIMAVIRMSSEEGRHKAFTTCTSHLLVVGMYYGAGIFIYMRPTSNRSPTQDKMVSSFYTILTPMLNPLIYSFRNKDVAKAFSKVLGKGKSRE*
364 >lcl|XP_001496207.2|Plus1complement(926729..927664) NW_001867369 olfactory receptor 5M8-like LOC100065634 __SEG__ Chr12 {Equus caballus} MRRNFTSVTEFILLGLTNRLELQIPLFLLFLAIYMATVAGNLGMIILIQVNARLHTPMYFFLRHLSFVDLCFSSSVTPKMLEIFLSEKKTISYPACLVQCYFFIALVHVE
IYILAVMAFDRYIAICNPLLYGSKMSSGVCKSLITVPYVYGVLTGLMETMWTYNLAFCGPNEINHFYCADPPLIKLACSDTYNKEMSMFVVAGCNLSTSLLFILISYLYI
FPSILKIHSTEGRHKAVSTCGSHLTAVTIFYATLFFMYLRPPSKESVEQGKMVAVFYTSVIPMLNPMIYSLRNKEVKEALTRELLRKNLFS*
365 >lcl|XP_001496295.2|Plus1complement(978793..979764) NW_001867369 olfactory receptor 5M11-like LOC100065735 __SEG__ Chr12 {Equus caballus} MSALFSFISSVGTGFQKISIKNDSTVTEFILLGLTDSPELQAPFFVLCLVVYLVTLLGNLRTMVLIRQDSRLYTPMYFFLANLAFVDLCYISNATPQMLTNFLSEKKTIT
FAGCFIQCYIFIALLLTEFYMLSAMVYDRYVATCNPLCYSVKMSRRVCICWATFPYVYGFSDGLFQAILTFRLTFCRSNVINHFYCADLPLIKLSCSDTYFKEHAMLISA
GFNLSNSLTIILVSYAFIFAAVLRIKSAYGRHKAFSTCRSHILAVTLFYGTLFCMYVRSPTYKTIEESEIIAVFYTFVSPVLKPFIYSLWNRDVKQALKNVLR*
366 >lcl|XP_001496305.2|Plus1complement(22367157..22368290) NW_001867427 p2Y purinoceptor 2 P2RY2 __SEG__ Chr7 {Equus caballus} MATGLGLWNGTKNGTWDGDELGYKCRFNENFKYVLLPVSYGVVCVLGLCLNAVALYIFLCRLKTWNASTTYMFHLAVSDTLYAASLPLLVYYYSGGDHWPFSTVLCKLVR
FLFYTNLYGSILFLTCISVHRCLGVLRPLLSLRWGRSHYARRVAAAVWVLVLACQAPVLYFVTTSTRGGRITCHDTSAPELFSHFVAYSSVMMGLLFLVPFAVILVCYVL
MARRLLKPAYGTTGGLPRAKRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKITRPLASANSCLDPVLYFLAGQRLVRFARDAKPPTDPIPAA
QAHRRLGLRRSNITDIKRIENALASSEDSRQTESTPAGSMNTKDIQL*
367 >lcl|XP_001496309.2|Plus1complement(991672..992610) NW_001867369 olfactory receptor 1030-like LOC100065755 __SEG__ Chr12 {Equus caballus} MSKKNYSAVTEFILLGLTDRAELQPVLFVIFLVIYLITVIGNVSMILLIRSDPKLHTPMYFFLGHLSFLDLCYVSNVTPQMLVNFLSKRKTISFIGCCIQFHFFIALVIT
EYYMLTVMAYDRYMAICKPLLYGSKMSRSVCHSLVATPYIYGFANGLAQTILMLRLSFCGPNEINHFYCAEPPLLVLACSDTYVKETAMFVVAGLNLTCSLTIILISYIF
IFMAILRIHSAEGRHKAFSTCGSHPTAVTIFDGTLFYMHLRPPSKASVEQGKIVAIFYIFVSPLLNPLIYSLRNKDVKRAMRKVIRKKFFTK*
368 >lcl|XP_001496345.2|Plus1complement(1000789..1001736) NW_001867369 olfactory receptor 5M10-like LOC100065803 __SEG__ Chr12 {Equus caballus} MSSQNHTIVMEFALLGLTNNPVLEKILFGIFLVIYLITLAGNLCMIILIRTNSHLQTPMYFFLSHLSFVDICYSSNITPNMLYNFLSDQKTISYAGCFTQCLLFIALVIT
EFYILASMALDRYVAICNPLHYSTIMSKNICISLVTVHYTYGFLNGLSETLLTFHLSFCGSLEINHFYCADPPLIMLTCSDTYVKKMAMFIVAGFTLSSSLFIIVMSYLF
IIVAILRIRSPEGKHKAFSTCGSHLTIVTIFYGTLFFMYLRTPSKKSVEDSKIIAVFYTFLSPMLNPVIYSLKNKDVIQAVQQMIKVNLFRKITV*
369 >lcl|XP_001496358.2|Plus1complement(1012311..1013249) NW_001867369 olfactory receptor 1020-like LOC100065831 __SEG__ Chr12 {Equus caballus} MSNLTAVTEFVLLGFRNYPELQCLLFMVFLVIYMITLFGNLGMILLIKIDSRLHTPMYFFLSNLALVDFCYSSVITPNMLVNFWVENPVISFNECVTQFFFFGSFAGIEG
FLLAVMAYDRYMAICKPLLYTVTMSPDLNVLLVLATYLAGFINAAIHTRLTFQLSFCRSNIINHFFCDTPPLLRLSCSDTHVNEVFNFAFASFNELSCLLTIVISYLYIL
ISILRIQSAEGRHKTFSTCASHLMVVTIFFGTILFMYLRPSSSYSMEQDKVVSVFYTVVIPMLNPFIYSLRNKEVKASLGKIFKTTSFYFCT*
370 >lcl|XP_001496511.2|Plus1complement(111383..112327) NW_001867401 olfactory receptor 2T33-like LOC100066044 __SEG__ Chr29 {Equus caballus} MEKRNTTSNFILLGLFEHTRPHLFLFMVVLTMAIASFMGNALMLLLIYWDHRLHTPMYFLLSQLSLMDVMLVATIVPKMAVDYLTGKKSISPAGCGLQIFFFLTVGGGEC
FLLAAMSCDRYVAVCYPLRYPVLMSQKLCLKMTLGSWFLGSADGLMQAAATLSFQFCSAPEIDHFFCEAPMLVRLACDDTSVFENVMYICCVLMLLVPFSLILTSYSFIL
LAVLQMRSREARKKAFATCSSHLAVVGIFYGAAIFTYMRPKSYRSANPDKVVSAFYTIFTPVLNPLIYSLRNSEVKGALKRWLGKCTNLKCQQT*
371 >lcl|XP_001496605.2|Plus1complement(1339156..1340103) NW_001867377 olfactory receptor 2V1-like LOC100066205 __SEG__ Chr14 {Equus caballus} MGILSNRSSIDGFILLGIFSCSQTDLVLFSVVMVVFTVALCGNVLLIFLVCTDPQLRTPMYFFLKQLSLMDLMLVCTIVPKMAVNFLSGRKYISFVGCGIQIGFFVSLVG
SEGLLLGLMAYDRYVAISHPLHYPILMSQRVCLQIAGSSWAFGILDGMIQMVAAMSLPYCGSRNVDHFFCEVSALLKLACADTSLFDTLLFACCVLMLFLPFSIVVVSYA
RLLGVVFQMRSAQARKKALATCSSHLMAVSLFYGAAMFIYLRPRRYRTPSHDKMVSIFYTVLTPMLNPLIYSLRNRDVMGALRKRLENCKFGSQP*
372 >lcl|XP_001496656.1|Plus1complement(6354932..6356029) NW_001867376 somatostatin receptor type 5-like LOC100067398 __SEG__ Chr13 {Equus caballus} MEPLSPASALASWNTSSAATSGGGENGTLVGPAPSPGARAVVVPVLYLLVCVAGLGGNTLVIYVVLRHAKMKTVTNIYILNLAVADVLLMLGLPFLATQNAISYWPFGHV
LCRLVMTLDGINQFTSIFCLTVMSVDRYLAIVHPIRSTRWRRPRVAKLASAAVWAFSLLMSLPLVIFADIQEGWNTCNLSWPEPVGLWGAVFIIYTSVLGFFGPLLVICL
CYLLIVVKVKASGVRVGSTRRRSERKVTRMVVVVVVVFVGCWLPFFIVNIVNLAFVLPEEPASAGAYFFVVILSYANSCANPVLYGFLSDNFRQSFRKVLCLRKGSGAED
ADATEPRPDKGGRPEEATLPARSSEANGLMQTSKL*
373 >lcl|XP_001496701.1|Plus1complement(34464848..34465933) NW_001867395 ovarian cancer G-protein coupled receptor 1 GPR68 __SEG__ Chr24 {Equus caballus} MGNITADNSSLSCTIDHTIHQTLAPVVYVTVLVVGFPANCLSLYFGYLQIKARNELGVYLCNLTVADLFYICSLPFWLQYVLQHDHWSHGDLSCQVCGILLYENIYISVG
FLCCISIDRYLAVAHPFRFHQFRTLKAAVSVSVVIWVKELLTSVYFLMHKEVVEDENQHRVCFEHYPLEAWQRSINYYRFLVGFLFPICLLLASYQGILRAVRRSHGTQK
SRKDQIQRLVLSTVVIFLACFLPYHVLLLVRSLWESSCEFATGIFNAYHFSLLLTSFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTSRAREAYPLGAPEASGK
SEEPELLMKLHSAFQTPNSSGVGGSPTGGLA*
374 >lcl|XP_001496735.1|Plus1complement(12130857..12133007) NW_001867380 leucine-rich repeat neuronal protein 1-like LOC100052909 __SEG__ Chr16 {Equus caballus} MARMCFVVAACQLVLGLLMTSLTGSSLQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNI
KEVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISANAFSGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLSNLRSL
VLAGMYLTDIPGNALVGLDSLESLSFYDNKLIKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHR
LAFRSVPALESLMLNNNALNAVYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYRGQQVKEVLIQDSSEQCLPMISHDTFPNHLNMDIG
TTVFLDCRAMAEPEPEIYWVTPLGNKITVETLSDKYKLSSEGTLEISNMQIEDSGRYTCVAQNVEGADTRVVTIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVM
TSNLKWSSATMKVDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYIAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW*
375 >lcl|XP_001496777.1|Plus1complement(23896082..23897101) NW_001867427 olfactory receptor 52B2-like LOC100066469 __SEG__ Chr7 {Equus caballus} MGEDGNTSTFNISYTNFFQVGFPGLHERRPLLVLPLTFLYVTIISANGLVIHTVVGQRSLHQPMYVLIALLLAVNICAATAVMPKMLEGFVHYANPISLLGCLAQMFFIY
FTLLLDYNLLLAMALDRYMAICHPLRYTDLMTSRLLGMLAILALTRSLGVAVPLVVLTSRAQFCRTAVIRHFTCEYIALLSIACGDLTFNNRLGLAMRLVTVTFDLALLG
TSYTRIIYVAFRISSGKARAKALHTCGSHLLVILTIYLSGLSTSIVFRVTRTVSQDVQNLLSAIYLLLPGALNPVIYGVRTREIREHVEKILCGNESAQEAREKPKRLQN
RRVDGKLPG*
376 >lcl|XP_001496827.2|Plus1complement(1757420..1758352) NW_001867377 olfactory receptor 10-like LOC100066541 __SEG__ Chr14 {Equus caballus} METTNDSTGGDFILVGFSERPELELILSLFVLIFYTITLLGNVTIILLSILDARLHTAMYFFLRNLSVLDLCFTTSTVPQMLVNMWGGNKKISYAGCMVQYWLALALGST
ECVLLAVMAVDRYVAVCWPLHYASIMYPKLCHLLAAVSWSSGFANSFLQSSMAMVLPRCGNRHVDHFFCELLIIVKLSCIDTGPTESKMFIARLTILGMPVSIILTSYVC
IARAVIKMHSAKGRKKAFGTCASHLMVVSLFYGTIMFLYLQPKDNYSQDQSKALAVLYMILAPTLNPLIYTLRNKDVKKAVRRVMGKEQV*
377 >lcl|XP_001496867.2|Plus1complement(13404201..13405454) NW_001867423 probable G-protein coupled receptor 19 isoform 1 GPR19 __SEG__ Chr6 {Equus caballus} MNMVFAHRMDDSKPPLVVPTLLVPLQNHSCTETATPLPSRDLTEFSEEHSWMSNRTDVQYGPKPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMA
CADLLISVASTPFVLLQFATGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWVFDAAFVTPVFFFYGSNWDNHCNYFLPSSW
EGTAYTVIHFSVSFVIPSVLIILFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHPHERDYKKSSIVFTAITWISFSSSAAKPT
LYSIYNANFRRGMKETFCMSSMKCYRSNAYTITTSSRMAKKNYVGISEIPPTAKTVTKDSIYDSFDREAKEKKLAWPINSNPPNTFV*
378 >lcl|XP_001496886.2|Plus123983497..23984441 NW_001867427 olfactory receptor 52B4-like LOC100066618 __SEG__ Chr7 {Equus caballus} MTTTNHTGVSHTVFRLLGIPGLEDQHMWISIPFFISYVIALLGNSLLIFIILTKRSLHEPMYLFLCMLAGADIVLSACTVPQALAIFWFHAGEISLDCCITQVFFYSSTF
ISESGILLVMAFDRYIAICYPLRYGTILTHALIGRMSITIFLRSYGTIFPIIFLLKRLTFCQNNIIPHTFCEHIGLAKYACNDIQVNIWYGLFVIVSTVVLDVLLIFISY
VLILHAVFHIPSQDARHKALNTCGSHVCIIILFYGPGIFTSLIQRFGRHIPPHIHILLANVCILVPPMLNPIIYGIKTKQIRDQVVEVLFTKQK*
379 >lcl|XP_001496900.2|Plus1complement(24001595..24002539) NW_001867427 olfactory receptor 52B4-like LOC100066640 __SEG__ Chr7 {Equus caballus} MATLNHTAVSHTVFHLLGIPGLEDQHMWISIPFFISYVIALLGNSLLIFIILTKRSLHEPMYLFLCMLAGADIVLSTCTVPQALAIFWFHAGEISLNCCIIQLFFIHSTF
ISESGILLVMAFDRYIAICYPLRYTTILTHALIRKIGVSIFLRSYGTIFPIIFLLKRLTFCRSNILPHTGCEHIGLAKFSCDDVRVNIWYGFFVLMSTLVLDLMLIFVSY
MLILCAVFRMPSRDARHKALNTCGSHVCVIILFYGPEIFTTLTQQFGRHIPPHVHILLANVCIVAPPMLNPIIYGIKTKQIRDQVTHILFPKEI*
380 >lcl|XP_001496959.2|Plus1complement(24034228..24035172) NW_001867427 olfactory receptor 52B4-like LOC100066712 __SEG__ Chr7 {Equus caballus} MTTINHTGVSHTVFHMLGIPGLEHQHMWISIPFFVSYVIALLGNSLLIFIILTKSSLHEPMYLFLCMLAGADIVLSTCTVPQALAIFWFHAGDISLDHCITQFFIIHCTF
ISESGILLVMAFDRYIAICYPLRYTTILKHALIGKIGVIIFLRSYCTIFPIIFLLKRLTFCQNNIIPHTFCEHIGLAKYACNDIQVNIWYGLFVIVSTVVLDVLLIFVSY
VLILLAVFHMPSQDARHKALNTCGSHVCIIILFYGPAIFTTLTQQFGHYIPPHVHILLANVCILVPPMMNPMIYGIKTKQIREQVAHMLFPKQK*
381 >lcl|XP_001497007.2|Plus115167994..15168941 NW_001867402 olfactory receptor 2G3-like LOC100066777 __SEG__ Chr2 {Equus caballus} MQGLGKQNQSSVSEFLLLGFSSESQIRMALFTFFLLLYLITLLGNGLIITLIYLDSHLHTPMYFFLSILSLVDVSYITTTVPQILVNMTHPRRTISWGACVAQMFIFLVL
GIAECVLYAIMALDRYVAICFPLHYTLLMSHPICIKMVIVCCFISIAGALIYTVFTKRLPYCGPHEINHFFCEVPAALKLTCADTSLNDQVDFILGFILLLVPLSLILAS
YVCIFASILRIRSSQGRLKSFSTCASHITVVTMFYGPAMIMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSLRNKDVKGAFLKVFGDRGTAQ*
382 >lcl|XP_001497017.2|Plus11861578..1862507 NW_001867369 olfactory receptor 5AK2-like LOC100066784 __SEG__ Chr12 {Equus caballus} MGQNNGTEVTEFILLGFSGQHKSWHILFIVFLLIYVATLVGNIGMILLIKIDSSLHTPMYFFLQHLAFVDLCYTSAITPKMLKNFVGTEQSISFLGCMVQLLVYGAFATS
DCYILAAMAVDRYVAICNPLRYPVVMTQKVCIQLLIGSYFMGFLNASINTSFTFSLNFCNSNKINHFFCDEPPILSLSCSNVYFTITLLTVFVGFNLTFTVLVVIFSYIY
ILAAILETSSAAGRKKAFSTCASHLTAVTIFYGTLSYMYLHHRSIRSQEQEKMASMFYGIIIPMLNPLIYSLRNQDVKAALKGLGKKHF*
383 >lcl|XP_001497049.2|Plus1complement(24113433..24114380) NW_001867427 putative olfactory receptor 52P1-like LOC100066824 __SEG__ Chr7 {Equus caballus} MQFSNHSHQNPTSFLLMGIPGLEASHFWIAFPFCSMYALAVLGNTAVLLVVHSEPSLHQPMYLFLCMLSTIDLVLCTSTVPKLLALFWANAAEIAFEACATQMFFIHGFS
AIESGILLAMAFDRYLAICRPLHYGSLLPLEAVGKLGAVAVFRGLGLMTPLTCLLARLSYCNRVVAHSYCEHMAVVKLACRGTKPNNIYGISAATLVVGTDSICIAVSYA
LILRAVLGLSSKEARAKTFGTCGSHLGVILLFYTPGLFSFYTQRFGQHVPHHIHILLADLYLVVPPMLNPIIYGMKTKQIRDGALRLLKQVTVQS*
384 >lcl|XP_001497052.3|Plus1<1905975..1906910 NW_001867369 olfactory receptor 5AK2-like LOC100066827 __SEG__ Chr12 {Equus caballus} LAMEQNNGTEVTEFILLGFAGQHKSWHTLFILFLLIYVATLVGNIGMILLIKIDSCLHTPMYFFLQHLAFVDLCYASAITPKMLQNFVGTEKSISFIGCMVQLLVYGTFV
TSDCYILAAMAVDRYVAICNPLRYPTVMSQKVCIQLLVGSYFMGFLNASVNTGFTFSLNFCKSNKINHFFCDEPPILTLSCSNIDFNIVLLTAFVGCNLTFTVLVVIFSY
AYILAAILMMSSAAGRKKAFSTCASHMTAVIIFYGTLSCMYLHHGTNKSQEEEKVASVFYGIMIPMLNPLIYSLRNQDVKEALKGIGKKCF*
385 >lcl|XP_001497055.3|Plus1complement(332218..333153) NW_001867386 olfactory receptor 287-like LOC100066831 __SEG__ Chr1 {Equus caballus} MTWGRGWNLSVQGPFVLLGFPGPRGLHAGLFLLFLVLYVLTVAGNLAIMSLVGAHRRLQTPMYFFLCNLSFLEIWFTTACVPKALATFASQSGAISFAGCAAQMYFVFSL
GCTEYFLLAVMAFDRYLAICLPLRYGVIMTPGLSARLALGAWLCGFSAIAVPAALITRLSFCGSRVINHFFCDIAPWIALACSDRRVVELVFFGIAFCVILGSCFITLIS
YTCIIATIVRIPSAQGRHRAFSTCSSHLTVVLIWYGSTIFLHVRTSVESSLDLTKAVTVLNTVITPVLNPFIYTLRNKDVKEALRRWVQGN*
386 >lcl|XP_001497069.2|Plus1complement(24142038..24142991) NW_001867427 olfactory receptor 52M1-like LOC100066846 __SEG__ Chr7 {Equus caballus} MFVSNNACLVPTTFWLMGIPGLESLHIWLSIPFSSMYLVAVVGNVTILAVVKVECSLHQPMYFFLCMLAIIDLVLSTSTMPKLLAIFWFGAHNIDLDACLAQMFFIHCFA
TVESGIFLAMAFDRYVAICDPLRHTLVLTRTVVGHLGLAALLRGVLYIGPLPLMIRLRLSLYRTQIIAHSYCEHMAVVTLACGDTTVNNLYGMGIGFLVLILDSLAITAS
YVMIFRAVMGLATPEARLKTLGTCSSHICAILVFYIPIAVSSLTHHFGHHVPPHIHILLANFYLLIPPLLNPVVYAVRTKQIRERLLHILKTMAQTK*
387 >lcl|XP_001497088.2|Plus124176526..24177479 NW_001867427 olfactory receptor 52M1-like LOC100066863 __SEG__ Chr7 {Equus caballus} MLIFNNVCSVPSSFQLTGIPGLESLHIWLSIPFGSMYLVAVVGNVTILAVVRVEHSLHQPMYFFLCMLAIIDLVLSTSTMPKLLGIFWFGAGDIGLDACLAQMFLIHCFA
TVESGIFLAMAFDRYVAICDPLHHTTVLTHTVVGRLGLAALLRGVLYIGPLPLMIRLRLPLYKARVISHSYCEHMAVVTLACGDSRVNNVYGLSIGFLVLILDSMAIAAS
YVMIFRAVMGLATPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRERLLQILKIEIKIR*
388 >lcl|XP_001497094.2|Plus115335234..15336181 NW_001867402 putative olfactory receptor 2B3-like LOC100066878 __SEG__ Chr2 {Equus caballus} MQDLPWENHSSISEFILLGFSRDSQINAILFNIFIFLYLSTLVGNGLIVTLIHLDSRLRTPMYFFLSVLSMLDMSYVTTTVPQMLVHLVCQKKTISYVGCVAQMYIFLVL
GITEGWLFSVMAYDRYVAICYPLRYKVIMSPWLCGTMVVFCGLWGVSCSLVYTVFTMRLPYCGPNEINHFFCEVPAVLKLACADTSLNDQVDFILGFILLLVPLSFILAS
YVRIFATILRIRSAQGRLKAFSTCASHITVVTMFCGPAMFMYMNPGANASPERDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKLTGQGRAPE*
389 >lcl|XP_001497107.2|Plus1complement(234228..235235) NW_001867386 olfactory receptor 13G1-like LOC100066894 __SEG__ Chr1 {Equus caballus} MNQTLVTQFLILGFSETPGLQMLLFPAFLLLYMVALSGNLLIVLLISSSPALHTPVYFFLVNLAAVDILCTSTILPKLLGSMVAGRTISFGGCMAQLFFFTWSLGAELLL
FSAMALDRYVAICRPLHYGALMGPRVCVLLASAVWAVSLTNTTVNTVLTGRLPFCGSNVVKHFFCEIPPLLKLSCAPTRLNEAMAFTADVVLALGSFSVTMLSYGCIIAC
INASILRIRSAAGKRRAFSTCSSHLLVVSMYYSTVVYTYFRPASSYALDKDKVVSVVYTSVAPSLNPLIYSLRNTDVKAALRRVLSRSRGLCAPRGPATSPLEGGQQAPP
RASLP*
390 >lcl|XP_001497183.1|Plus1complement(1865588..1867360) NW_001867396 calicin-like LOC100066986 __SEG__ Chr25 {Equus caballus} MELEFTEKNYDSFLLQKLNEQRKRKEYWDVALTVDNHVFFAHRNVLAAISPAVKSLISRNDVKSTNELFITLDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRNHCNDVLIKSIRHANCLRYLILAEMFGLKEVSDLAYSGIRDNFHYWASPEGSMPEDFMCCPPVIFGRLLQDENLHVLNEDQALSALLHWVYFRKDEREKYFKK
FFSYINLNAVSNKTLMFASNKLMDMENSSGHTSLIESVLVERQQDRPSSLLSYQRKGALLDSVVILGGQKAQGQFNDGVFAYVIQENLWLKLSEMPYRAAALSATSTGRY
IYISGGTTDRISGLKMSWRYDMDDNSWTKLPDLPLGLVFHTMVTCRGTVYSVGGSIAPRQYVSNIYCYDEWKEVWCLAGKMSIPMDGTAVITRGDQNLYIVTGRCLVKGY
ISRVGVVDCFDTITGEVVQSITFPIEFNHRPLLSFNQDNILCMHSHRQSMEINLQKTKANKMSTLLPLLPNSCPLDVSHAICSIGDGRVFVCGGVTTATDVQKRDYTINP
NAYLLDPKTGEWKTLAPPPEALDCPTCCLAKLPCKILQRN*
391 >lcl|XP_001497205.1|Plus19587464..9588408 NW_001867414 olfactory receptor 9A4-like LOC100064514 __SEG__ Chr4 {Equus caballus} MLKNYSSTIEFYLLGFHGSKELHNTLFATFFFLYSVTFIGNTVIIMVVCVDKRLQSPMYFFLGHLSVLEILTTSVAVPLMLWRLLLPGMQAISLIVCGAQLYLYLSLGTS
ELVLVGAMAVDRYVAVCNPLRYNIIMNSHTCIWVVILSWVFGFLFQIWPVYATFQLTFCKSNVLDHFYCDRGQLLKLSCDDSHFTQFVLFLMAVFIIFGSLIPTIVSYTC
VISTILKIPSVSGQRKAFSTCVSHFAFVVIAYGSCLFLFVKPKQTQAAEYDRVASLMVLVVTPFLNPFVFTLRNEKFVEAFRDVMKRCCQRLKD*
392 >lcl|XP_001497218.2|Plus124343973..24344926 NW_001867427 olfactory receptor 51E1-like LOC100067037 __SEG__ Chr7 {Equus caballus} MVVPSGNESSATYFILIGLPGLEEAQFWLAFPLFSLYVIAVLGNLMIIYVVRTEHSLHEPMYIFLCMLSGLDILISTSSMPKMMAIFWFNSTTIQFDACLLQMFAIHSLS
GMESTVLLAMAFDRYVAICHPLRHATVLTLPRVTKIGMAAVVRGAALMAPLPVFIKQLPFCHSNILSHSYCLHQDVMKLACADIRVNIIYGLIVIISAIGLDSLLISLSY
LLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSIVHRFGKPHDSLLPIIMANTYLLVPPVLNPIVYGVKTKEIRQRIIRLFHVTTHTSDP*
393 >lcl|XP_001497221.2|Plus1complement(183807..184739) NW_001867386 olfactory receptor 13A1-like LOC100067042 __SEG__ Chr1 {Equus caballus} MNNQSLVTEFILRGFSEEPQLQSLFLILFLCLYTVALCGNSLIVAAITFNSGLHTPMYFFLVNLAVLDVICASTVVPKLLEILVAEKRNISYGGCMAQMFFLSWSVAAEV
LLFTAMAYDRYVAICQPLHYGSMMNPRVCAVLAGAVWGMSVLGAGVNACLMLQLSFCGPNVVDHFFCEIPPLLLLSCSSTYVNDIMAIVADIFFAVLNFLLTMVSYGFII
STILKIRTAEGKRRAFSTCSSHLIVVTMYYSTIVYTYLSPGSGYSPGMGKVMAVLYATVSPALNPLIYTLRNKDVKGALKKVLMLIVEKL*
394 >lcl|XP_001497237.2|Plus1complement(24355472..24356434) NW_001867427 olfactory receptor 51I2-like LOC100067059 __SEG__ Chr7 {Equus caballus} MLPSQSYVNISFFQPPAFLMIGIPGLEAIHGWISIPFSAMYTAALTGNCLILLAVRRTPSLHQPMYYFLSMLALTDVGLTLSTLPTTLAVLWFDYRLIGFNACLVQMFFL
HSFSVMESSVLLAMSFDRFVAISNPLRYAAILTNNVIFRIGLAIVARATLCLFPVPFLIKRLNFCPGNNFLSHSFCFHADVMRKACADIIINIHYGLYVVVSTGGIDSLL
IVLSYTLILYIVMGLASPRECTRALNTCVSHILAVFVFFIPGITMSMIHRFGRHLPHIVRALVAYVYLMVPPVLNPIIYSVKSKPIREAMLRILRVKGQG*
395 >lcl|XP_001497244.2|Plus1complement(171786..172751) NW_001867386 olfactory receptor 13A1-like LOC100067067 __SEG__ Chr1 {Equus caballus} MERGVGTPSGQGTRSNHTLVAEFKLQGFSEHPRLRLPLFSCFLSLYAVALGGNAVIIAVVSCSVNLRSPMYFFLCNLATMDIVCTSSVLPKVLVGLVFEENTISFPGCMA
QLFFLLWSVSSELLLLTVMAYDRYVAICHPLHYSSRMSPLLCRALVTGVWAVCALNASVHTGLMVQLSFCGPNIITHFFCEIPPLLLLSCSSTLMNSVMTVLADAFFGVV
NFLLTLASYGCIIASILRIRSAAGRRRAFSTCSSHLLVVSVYYSAVFCAYISPASSYGPERSKVSGVLYTTLSPSLNPIIYSLRNREVKHALRRLVPLSRH*
396 >lcl|XP_001497256.2|Plus1complement(24365895..24366857) NW_001867427 olfactory receptor 51I2-like LOC100067079 __SEG__ Chr7 {Equus caballus} MLPSQSYVNISFFQPPAFLMIGIPGLEAIHGWISIPFSAMYTVALTGNCLILLTVMRTPSLHQPMYYFLSMLALTDVGLTLSTLPTTLAVLWFDYRLIGFSACLVQMFFL
HSFSVVESSVLLAMSFDRFVAISNPLRYAAILTNNVIFRIGLAIVARATLSLFPVPFLLKRLNFCPNKILLSHSFCFHPDVMRRACADITINILYGLYVVVSTAGIDSLL
IVLSYTLILSTVLGLASPRERIQALNTCVSHILAVFVFFIPVIGVSMIHRFGRHLPPIVHALVAYLYLVVPPVLNPIIYSVKSKPIREAMLKMLRRKSQS*
397 >lcl|XP_001497259.2|Plus1complement(2869659..2870618) NW_001867369 olfactory receptor 1020-like LOC100067085 __SEG__ Chr12 {Equus caballus} MTPGELALASSNHTPVTQFILLGFSNYADLQELLFGVFLLIYTVTVVGNLGMMVLIFTDSRLHSPMYFFLSVLSFLDICYSSVVTPKLLINFLASDKSISFEGCVVQLTF
FVVHVTAESFLLASMAYDRFMAICRTLHYGSVMTKGMCLQLVAASSAFGGINSSIQTGNVFALPFCGPNQVTHYFCDIPPLLHLVCGSKAAAGVVLYLFSALVTLLPAAV
ILTSYSLVLVAIGRMRSAAGREKALSTCASHFLAITIFYGTVVFTYVQPHGPTDDTSGQVVSVFYTVIIPMLNPFIYSLRNKEVKGALQRKLQVNIFPC*
398 >lcl|XP_001497283.2|Plus1complement(32884..33822) NW_001867397 olfactory receptor 2L3-like LOC100067113 __SEG__ Chr26 {Equus caballus} MENYNQTSTDFILLGLFPPSKIGLFFFILVVLIFLMALFGNLSIMLLIFLDTRLHTPMYFLLSQLSIIELNHISTIVPKMVSNFLFGNKSISFIGCGVQSFFFLTLGGAE
ALLLTSMAYARYIAICFPRHYSSSMSKRVCVLMIIGSWIMGFVNSCAHTTYAFHVRYCQSRAINHYFCDVPPMLTLACMDTWVYEYTLFMSTILFLMLPFIGIACSYGRV
VLAVYHMHSAEGRKKVSSTCSTHLTVVTFYYVPLVYTYLHPRSLRSPTKDEVLAVFYPILTPMLNPIIYSLRNREVMGALRRVIQRICTEKM*
399 >lcl|XP_001497294.3|Plus118220651..18221601 NW_001867422 olfactory receptor 12-like LOC100067126 __SEG__ Chr6 {Equus caballus} MPRHGDGNVSAAPFQEFVLEGFEGCLETQALLFAVFLALYLGTVLGNLTMIVVITLDARLHSPMYFFLKNLSFLDLCYSSVIAPNALANFFSSSKVITFQGCAAQLFFFS
LLVTTEGFLLGVMAYDRFMAICSPLRYPITMCPSACFRLVLGTYCGGCLNSIVQTSFTFSLPFCSSNHIDHFFCDVPPLLQLACANTALNKLIMFGICGLIIVSVTLVVL
VSYGYITVTILRMQSAGGKHKVFSTCGSHMTAVTLFVGTVFVMYAQPGAVDSMEQGKVVSVFYTLVIPMLNPLIYSLQNKDVKEALGRLSQKHTAT*
400 >lcl|XP_001497295.2|Plus1complement(24390984..24391940) NW_001867427 olfactory receptor 51I2-like LOC100067128 __SEG__ Chr7 {Equus caballus} MLPSQTCINTSFFQPSAFLMIGIPGLEAIHGCISMPFSAMYTAALTGNGLILLAVRRTPSLHQPMYYFLSMLALTDVGLTLSTLPTTLAVLWFDYRLIGFNACLVQMFFL
HSFSVVESSVLLAMSFDRFVAISTPLHYAAVLTNNVIIRIGLAIVARATVSLFPLPFLLKRLNFCPGKILLSHSFCFHADVMKRACADITVNIIYGLYIVLSTVGIDSLL
VVLSYILILHTVMGLASPRERVRALNTCVSHISAVLVFYIPVIGVSMIHRFGRHLSPIVHALVAYVYLMVPPVLNPIIYSVKSKPIRGAMLRVLMRPG*
401 >lcl|XP_001497297.2|Plus1complement(2923055..2924002) NW_001867369 olfactory receptor 476-like LOC100067132 __SEG__ Chr12 {Equus caballus} MELGQNHTTVTRFILLGLTDQADEKQLLFAIFLLIYSMTLVGNLGMIDVIRASSTLHTPMYFLLSVLSFLDICNSSVFTPRLLISFLTTDQSISFAGCVAQMALMILHGT
GECLLLAIMAYDRFVAICHPLLYHTIMSKRLCVQLVVVTYAMGVFISALQTGNAFILPYCGPNVIDHYFCDIPPVLQLACSDTTVANIILLFFSALVTVPTISVILVSYA
YILVTIYKMRSLEAQRKAFSTCASHLTALSLFYGSVFLVYFQPNPESASAYNKILSVFYTIVIPMLNPLVYSLRNKDVKAAVQIRVLNLSRKRIC*
402 >lcl|XP_001497312.2|Plus118236157..18237107 NW_001867422 olfactory receptor 12-like LOC100067149 __SEG__ Chr6 {Equus caballus} MPPHRDGNVSAVPLQEFVLEGFEGGLGTQALLFAVFLALYLGTVLGNLTMIVVITLDARLHSPMYFFLKNLSFLDLCYSSVIAPNALANFFSSSKVITFQGCATQFFFFS
LLGTTEGFLLTVMAYDRFMAICSPLRYPITMCPSACTRLVLGTYCAGCLNSIVQTGFTFSLPFCSSNHIDHFFCDMLPLLRLACTNTALNKLVMFGICGLIVVGTTLMVL
VSYGYITVTILRMQSGAGRHKVFSTCGSHMMAVSLFYGTLFVTYAQPGAVESMEQGKVVSVFYTLVIPMLNPLIYSLQNKDVKEALGRLRQKHTAM*
403 >lcl|XP_001497313.2|Plus1complement(24403695..24404657) NW_001867427 olfactory receptor 51E2-like LOC100067151 __SEG__ Chr7 {Equus caballus} MNSCNFTHSTFVLIGIPGLEEAHFWIGFPLLSMYAVAVFGNCIVVFIVRTERSLHAPMYLFLCMLAAIDLALSTSTMPKILALFWFDSREITFDACIAQMFFIHALSATE
STILLAMAFDRYIAICHPLRHAAVLNNTVTVQIGMVAVVRGSLFFIPLPLLIKRLVFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLTAILLVMGVDVLFISLSYFLI
IRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRTRVLAMFKMSCDKDLQTVGGR*
404 >lcl|XP_001497340.1|Plus1complement(19955250..19956404) NW_001867381 chemokine-binding protein 2-like LOC100067183 __SEG__ Chr16 {Equus caballus} MAATASPLPLTTEVTSSENSSSFYDYEYYLEDVAFMLCRKDEVVSFGKVFLPVFYSLIFVLGLGGNLLLLVILLWYVPRRRMTEVYLLNLAISNLLFVVTLPFWGISVAW
HWVFGSFLCKMVSTLYTINFYSGIFFISCMSLGKYLEIVHAQPHLRLRTRARSLLLAAIVWAVALAISIPDMVFVQTHEYPTGVWSCHADFGGHGTIWKLFLRFQQNLLG
FLLPLLAMIFFYSRIGSVLIRLRPPGQGRALRIAIALVVAFFVLWFPYNLTLFLHSLLDLKVFGDCEVSQHLDYALQVTESIAFLHCCFTPILYAFSSRRFRQYLKAFLA
AVLRRQQTPRPAQAPPSSCSESTRLTPQGEMTSMNDLGERQAEDSPNTGDMGKN*
405 >lcl|XP_001497349.2|Plus124433740..24434684 NW_001867427 olfactory receptor 51F2-like LOC100067194 __SEG__ Chr7 {Equus caballus} MPSFNQSIFHPAVFFLTGIPGLEIYHAWISIPFCCLYAIAISGNGMILLVIITESSLHEPMYYFLSMLSFTDLGLCLSTLVTMLGIFWFNAREISFDACIGQMFFIHGFT
FMESSVLLAMAFDRFIAICNPLRYATILTNSRIIKVGFAIVIRGTTALVPLLLLLKHLSFCHSRILHHSYCFHPDVMKLSCTDTKINSAFGLTIVISTAGLDSILILLSY
VLIIHSVLSIASPEERKKAFGTCVSHVSAVAIFYIPMISLSLVHRFGKHAPPLVHTLIANVYLLIPPVMNPIIYSVKTKQIRKAMLKVFLSKLT*
406 >lcl|XP_001497372.2|Plus1complement(3059073..3060026) NW_001867369 olfactory receptor 9I1-like LOC100067223 __SEG__ Chr12 {Equus caballus} MAKNNLTTVTEFILMGFTDYPELEIPLFVMFLSFYVVTLLGNVGMIILIQVDVQLHTPMYFFLGHLSLLDACYTSVITPQILATLPTGKMVISYSQCAAQFFFFTICAST
ECFLLAVMAYDRYVAISNPLLYTVVMNPRICWSLVLGAYVCGMSGTILRTTCIFTLHFCDNNKINFFFCDDPPLLKLACSDTTNSEIVIVFFGNLVILANALVILISYML
IIKAILRVKSSGGRAKTFSTCASHLTAVAIFFGTLIFMYLRSGSGKSLEEDKVVSVFYAVVIPMLNPLIYSLRNKDVKAAFKTVTGRFQGPRACRSE*
407 >lcl|XP_001497377.1|Plus120388210..20388596 NW_001867366 keratin, high-sulfur matrix protein, IIIA3-like LOC100067230 __SEG__ Chr11 {Equus caballus} MTGSCCGSTFSSLSLGRGCCQPCFRRNPCCCRPVSCQTTVCRPVTCVPRYTRSICEPCRRPICCDPCSLQEGCCRPISCCPTSCTAVVCRPCCWASTCCQPISVQSPCCR
PRFCQPAPCRTVCRTSRC*
408 >lcl|XP_001497381.1|Plus1complement(33738292..33740199) NW_001867389 zinc finger and BTB domain-containing protein 22 ZBTB22 __SEG__ Chr20 {Equus caballus} MEPSPLSPSGTALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASAATATITTAAATSVTVPGAGVPSGSGGTMAPATMGSMRSHASSRASENQSPSSSNYFSPRESTDFSS
SSQEAFAASAVGSGERRGGGPVFPAPAVGSGAATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYAPPSIMPQKHWVYVKRGGNCPAPAPLVPQDPELEEDEEEEDLV
LTCEDDEDEEMGGGSGVPARGGPEATLSISDVRTLTEPPEKGEEQVNFCESSNDFGPYEGGGPGAGLDDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFPSSSSSSSSQ
APGQPPGNQAEHGAVTLGGTSAGGLGVPSGAGGTTGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCAKK
FMWRDSFMRHRGHCERRHRLGGGGAGPGPGGPSGPALPPKRESPGVGGASGDEASGATPPSNRRVWSPPSVHKVEMGFSGGGGAN*
409 >lcl|XP_001497394.1|Plus121452279..21453334 NW_001867363 n-formyl peptide receptor 2-like LOC100062735 __SEG__ Chr10 {Equus caballus} METNFSIPLNGSGEEPHEPPGYAVVNILSLVVLGITFVLGILGNGLVIWVTGFRMARTVTTLCYLNLAIADFSFSATIPFLMVSMAMREQWPFGWFLCKLVDSVVDINLF
GSVFLIAFIALDRCICVLHPVWAQNHRTVGLATKLIIGPWVLAVLLTFQIFIFVTTAKDEKGNTYCTFNFRSWGNTMEERIKVFITVMTTRGIIRFIIGFSMPMSIIAIC
YGLIAAKMHKKAMIKSNRTLRVLTAVVASFFLCWFPFQLLALLDTVWIKEIYFGGKYRIIAVLLIPTSSLAFFNSCLNPILYVFVGRDFRKRLIHSLPASLERALSEDSA
QTTDTTTKSSSSPAEVQLQAM*
410 >lcl|XP_001497395.2|Plus1complement(3068825..3069769) NW_001867369 olfactory receptor 9I1-like LOC100067246 __SEG__ Chr12 {Equus caballus} MAKNNLTTVTEFILMGFTDYSKLEIPLFVMFLSFYVVTLLGNVGMIILIQVDVQLHTPMYFFLSHLSLLDACYTSVITPQILATLPTGKIVISYSQCAAQFFFFTICAGT
ECFLLAVMAYDRYVAISNPLLYTVVMNPRICWSLVLGAYVCGMLGAILRTTCTFTLPFCDNNKINFFFCDLPPLLKLACSDTTNSEIVIVFFGNFVILANALVILISYMP
IIKAILRVKSSSGRAKTFSTCASHLTAVAIFFGTLIFMYLWSGSGKSLEEDKVVSVFYTVVIPMLNPLIYSLRNKDVKAAFKKVTGRFQGSQSM*
411 >lcl|XP_001497416.2|Plus124455626..24456564 NW_001867427 olfactory receptor 51F2-like LOC100067271 __SEG__ Chr7 {Equus caballus} MPSFNQSIFHPAVFFLTGIPGLETYHAWISIPFCCLYAIAISGNGMILLVIITESSLHEPMYYFLSMLSFTDLGLCLSTLVTMLGIFWFNAREISFDACIGQMFFIHGLT
LMESSVLLVMAFDHFIAICNPLRYATILTNSRIIKVGFAIVIRGTTALVPLLLLLKRLSFCHSHILHHSYCFHPDVMKLSCTDTKINSAFGLTIVISTTGLDTILILLSY
VLIIHSVLSIASPEERKKAFGTCVSHVSAVAIFYIPMISLSLVHRFGKHAPPLVHTLIANVYLLIPPVMNPIIYSVKTKQICKAISKYSFLS*
412 >lcl|XP_001497420.2|Plus13087172..3088113 NW_001867369 olfactory receptor 9I1-like LOC100067275 __SEG__ Chr12 {Equus caballus} MAENGTVTTDFILMGFQLRAELQMGLFFVFLIVYLITMVGNLGMIVLIQCDLHLQTPMYFFLSHLSLLDICYSSVIVPQLLESLGTDKMVISYERCATQFFFFTFCASTE
CFLLAVMAYDRYVAVCNPLLYATTMTPQTRLGLVSGAYVGAMVNSVIRTGCTFSISFCKSNHLDFFFCDLPPLLKLACSETRPRERVIYLLAFLVITTSISVILISYLFI
IQAILKIHSAGSKAKTFSTCVSHMTAVALFFGTLIFIYLKGNMGKSLMEDKIVSVFYTVVIPMLNPMIYSLRNKEVKEALKKVLNRMRVSQVE*
413 >lcl|XP_001497422.1|Plus120397171..20397557 NW_001867366 keratin, high-sulfur matrix protein, IIIA3-like LOC100067281 __SEG__ Chr11 {Equus caballus} MTGSCCGSTFSSLSLGRGCCQPCFRRNPCCCRPVSCQTTVCRPVTCVPRYTRSICEPCRRPICCDPCSLQEGCCRPISCCPTSCTAVVCRPCCWASTCCQPISVQSPCCR
PRFCQPAPCRTVCRTSRC*
414 >lcl|XP_001497429.2|Plus1complement(40217650..40219503) NW_001867394 kelch-like protein 9 KLHL9 __SEG__ Chr23 {Equus caballus} MKVSLGNGDMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAAC
RWLRLEDPRMECAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMCEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
415 >lcl|XP_001497440.2|Plus13124218..3125153 NW_001867369 olfactory receptor 9Q1-like LOC100067304 __SEG__ Chr12 {Equus caballus} MENKNLTLVTEFLLIAFTDYPGWTLPLFFLFLFIYLITLLGNLGMIILIRVDLRLHTPMYFLLSHLSFMDICYSSVTVPQMMAMLLEHGIVLSYTRCAAQFFLFTFFGSI
DCYLLALMAYDRYVAVCQPLLYVTIMTQKARLGFVAGAYIAGLFSALVRTVSAFTLSFCGTNEINFIFCDLPPLLKLTCGDSYTQEVVIIVFAIFVIPACMVVILVSYLF
IILAIMRISSARGRAKTFSTCASHLTTVLLFFGTLIFMYLRDDSGRSPQEDQVVSVFYTTVIPMLNPLIYSLRNKEVKEALRKILNRAKLS*
416 >lcl|XP_001497459.2|Plus1complement(24486928..24487887) NW_001867427 olfactory receptor 51F1-like LOC100067320 __SEG__ Chr7 {Equus caballus} MLQIQNNMEILSNLTSKFPTFMLTSIPGLESVHAWISIPFCFLYTVALSGNCMILFVVITQKSLHEPMYYFLSMLSAADLGLTVSTMSTTLGILWFDAREISLDTCIVQM
FFLHGFTIIECGVLVAMAFDRYVAICDPLRYTAILTNSRIIQMGLLMIIRTVVLIVPLLLLLKPLYFCRVNVLSHSYCYYPDVIKLACSDTRANSICGIIDLFLTTGVDT
LCIILSYILIVRSVLHIASPEERHKVFSTCVSHIGALTIFYIPMISLSLVHRYSRSAPKVVHSLMANIYLLLPPVLNPIIYSVKTKQIHKVIFSLLLTK*
417 >lcl|XP_001497461.1|Plus121413885..21414940 NW_001867363 n-formyl peptide receptor 2-like LOC100062768 __SEG__ Chr10 {Equus caballus} METNFSVPLNGSNVRPHQPPGYAVVNILSLVVLGITFVLGILGNGLVIWVAGFRMARTVTTLCYLNLAIADFSFTTTIPFLMVSMAMGKQWPFGWFLCKLVHIVVDINLF
GSVFLIAFIALDRCICVLHPIWAQNHRTVGLATKLIMGPWILALILTSQIFLFFTTKSDGKGNTLCTFSFESWGNTTDEKRKITVTVLTVRGIIRFIIGFSMPMSIVAIC
YGLIAAKMHKKGMIKSSHPLRVLTAVVASFFLCWFPFQLFALLGTVWIKEIYFEGKHKIIILLINLTSSLAFFNSCLNPILYVFVGRDFRKKLIHSLPASLERALSEDSA
QTSDTITKSSSSPAEVQLQAM*
418 >lcl|XP_001497492.2|Plus1complement(24508537..24509571) NW_001867427 olfactory receptor 51F2-like LOC100067367 __SEG__ Chr7 {Equus caballus} MYIQLQLKIILTSKFRKSRSYKKFLLLQTVMPIFCNSTFPTFLLTGVSGLEWAHAWISIPFCCLYFTALSGNTLILFVVLTEPSLHEPMYYFLSMLSTTDIGLCISTLGT
VLGIFWANIREISFSACLSQMFFIHLFTFMESSVLLAMAFDRFVAISNPLRYATILTYARITQIGLAVITRGTVILTPLVLLLKRLSFCCSHVLHHSYCFHPDVMKLSCS
DTKINSAFGLTAIISTAGVDSIFILLSYVLIIRSVLNIASPEERKKAFSTCISHITAVAIFYIPLISLSFVHRFGKHVPPYVPTLIANVYLLIPPVMNPIIYSVKTKQIQ
KAMLKLVCSKGTHI*
419 >lcl|XP_001497496.2|Plus13178185..3179144 NW_001867369 olfactory receptor 10Q1-like LOC100067372 __SEG__ Chr12 {Equus caballus} MFSRSPVLNLSGPTEFVFRVFTAVPEFQVLLFLLFLFLYLMILCGNTAIIWVVCAHSSLRTPMYFFLSNLSFLEICYTSVVVPLMLSNIFGAQKPIALAGCGTQMFFFVT
LGSTDCFLLAVMAYDRYMAICHPLHYTLIMTQKLCIQMVASALGLAVFLSLQLTSLIFTLPFCGHYQEINHFLCDVPPVLRLACADIHVHQAVLYVVGILVLTVPFLLIC
VSYVFITCAILRIRSAEGRRRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSTSEDEDRQIALVYTFVTPLLNPLIYTLRNKDVRGALRNVIIGKAASDTS*
420 >lcl|XP_001497510.2|Plus1complement(24525535..24526494) NW_001867427 olfactory receptor 51F1-like LOC100067391 __SEG__ Chr7 {Equus caballus} MLPIQNNMEILSNLTSKFPAFFLTSIPGLESVHAWISIPFCCLYTVALSGNSMILFVIITQQSLHEPMYYFLSMLSAADLGLTLSTMSTTLGILWFDAREISLDTCIVQM
FFLHGFTFMESGVLVSMAFDRYVAICDPLRYTTSLTNSRIIQMGLLMIIRTVVLIVPLLLLLKPLYFCKMNTLSHSYCYHPDVIKLACSDTRANSIWGLINLILTTGVDT
PCIILSYILIVRSVLHITSPEERHKVFSTCVSHIGAVTIFYVPMMSLSLVHRYGRTAPKVVHSMMANIYLHLPPVLNPIIYSVKTKQIRKAVCSLLLTK*
421 >lcl|XP_001497513.2|Plus1<3186923..3187909 NW_001867369 olfactory receptor 1S1-like LOC100067396 __SEG__ Chr12 {Equus caballus} YENLCSFLWISRNMHRRNQSTISEFLLLGLSNQPEQQNLIFALFLGMYLVTVVGNGLIILTIGLDSYLHTPMYIFLANLSFADISSISTSVPKMLMNIQTKSQSISYESC
ITQMYFSIMFVAIDNFLLGAMAYDRFVAICHPLNYMTIMQPRLCILLTVISWVLSNIVSLTHTLLLLQLLFCDSNTLPHFFCDLALLLELSCSDTMINELVLFLVGLPVI
TFPFAVILFSYICIVRAVMRISSTEGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTHRDDRDKIGAVLFTVVTPMVNPFIYSLRNKDMKGALRKLISRKSFLPLMP*
422 >lcl|XP_001497539.1|Plus19991711..9992796 NW_001867416 probable G-protein coupled receptor 52 GPR52 __SEG__ Chr5 {Equus caballus} MNESRWIEWKILNVSSGIVNASERHSCPLGFGHYSAVDVCIFETVVIVLLTFLIIAGNLTVIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGIHE
SLTCQVFGYIISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAAFVIC
FTYFHIFKICRQHTKEINDRRARFPSHEVDASGETGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFQLGLRR
LSKTMCTSCVCVKDQEARDPKPRKRANSCSI*
423 >lcl|XP_001497544.2|Plus1complement(3221022..3221981) NW_001867369 olfactory receptor 10Q1-like LOC100067443 __SEG__ Chr12 {Equus caballus} MFSRSPVLNQSGPTEFVFRVFTTVPEFQVLLFFLFLFLYLMILCGNTAIIWVVCTHTSLRTAMYFFLSNLSFIEISYTTVVVPLMLSNILGARKPIPLAGCGAQMFFFLT
LGAADCFLLAIMAYDRYVAICHPLHYTLIMTQKLCIQMVASALGLALFLSLQLTSLIFTLPFCGHHQEINHFLCDVPPVLQLACADIHVHQAVLYVVSILVLTVPFSLIS
VSYVFITSAILHIHSAEGRRRAFSTCSSHLTVVLLQYGFCALVYLRPQSRSSVDEDRQFALVYTFVTPLLNPLVYTLRNKDVKGALKKAIGIKGTVETL*
424 >lcl|XP_001497571.2|Plus1complement(3246544..3247488) NW_001867369 olfactory receptor 5B3-like LOC100067487 __SEG__ Chr12 {Equus caballus} MENNTEVTEFILLGLTNAPELQVPLCIIFTFIYLTNVLVNLGMILLILLDSCLHTPMYFFLSNLSLADICYSTAVTPKMMAGFLLGDKVISYNACAAQMFFFAVFATVES
YLLASMACDRYAAVCKPLHYSTMMTTSMCTRLAIGSYICGFLNASIHVGDVFSLSFCKSNMVPHFFCDVPALMALSCSYRHVSELILALLESFNIFFALLVILISYLFIF
VTILKMPSVEGYMKALSTCASHLTAVSIFYGTVIFMYLQPSSSHSMDTDKIASVFYTMIIPMLNPMVYSLRNKEVKSAFKKAVEKAKLSLGFRS*
425 >lcl|XP_001497579.3|Plus1complement(24601161..24602105) NW_001867427 olfactory receptor 52R1-like LOC100067502 __SEG__ Chr7 {Equus caballus} MLASGKNSSHPVFFILLGIPGLENSQFWIAFPLGIMYVVAIVGNITILHIIRTDHTLHEPMYLFLAILAITDLVLSSSTQPKMLAILWFHAHEIEYHACLIQVFFIHAFS
SVESGVLMAMALDRYVAICFPLHHPSILTPSVVGKLGAVVMARGLLWVSPFCFMVSRMPFCLNQVIPQSYCEHMAVLKLVCADTTINRAYGLFVAFSVVGFDTIVISISY
VMILRTVLGLPSAEARLKAFGTCASHICVILAFYIPALFTFLTHRFGHNVPRVVHIMFANLYLLVPPMLNPIIYGVRTKQVRDRVIQGCCGKDP*
426 >lcl|XP_001497598.3|Plus124620198..24621148 NW_001867427 olfactory receptor 51F2-like LOC100067529 __SEG__ Chr7 {Equus caballus} MLVLSNTNAQPLTFFLTGIPGLRAALVWISIPFCLLYIIALSGNSMILFVILREQSLHEPMYYFLSILSTTDLTLSLCTLSTTLGVFWFEARAITLNACIAQMFFLHGFM
FMESGVLLAMAFDRFVAICDPLRCSTILTNTRIAQIGGGMLIRNFADMLPVVLLVKRLSFCSSTVLSLSYCYHVDLIQLSCTDNRINSILGLIALFSTTGFDCPCILLSY
VLIIRSALSIASSEGQQKAFNTCISHISAVAIFYIPLISLSLVHRYGHSAPPFVHTIMANVFLLIPPVLNPIIYSVKTKQIRKAIVKVLIQKWLQM*
427 >lcl|XP_001497647.2|Plus1complement(3322289..3323224) NW_001867369 olfactory receptor 5B12-like LOC100067599 __SEG__ Chr12 {Equus caballus} MENISEVTEFILVGLTDALEMQVPLFIIFTLIYFITLVGNLGTVMLILLDSRLHTPMYFFLSNLSVVDCVYASAVTPKVMVGFLIGDMIISYNACAAQMFFFAAFATSES
FLLASMAFDRHAAVCKPLHYTTTMTGTVCALLVTGSHICGLLQSFIHVVFTFHLSFCHSNVVNHFFCDIPPLLALSCSDIYPNEIVLFTLAAFNVFFTLLVILNSYIFIF
IAILRMHSDEGQKKAFSTCASHLTTVSIFYGTIIFTYLQPSSSHFMDTNKMASVFYTMIIPMLNPLVYSLRNKEVKSAFKKVIGKAKCSLG*
428 >lcl|XP_001497650.2|Plus123765824..23766759 NW_001867387 olfactory receptor 4S2-like LOC100067603 __SEG__ Chr1 {Equus caballus} MEKINNVTEFIFWGLSQNLEIEEVCFVVFSVFYIVILLGNLLIMLTVYVGNLFKSPMYFFLSYLSFVDICYSSVTAPKMIVDLLAKRKAISYVGCMLQLFGVHFFGCTEI
FLLTVMAYDRYVAICKPLHYMTIMDQDRCNKLLLGTWVGGFLHSIIQVALVVQLPFCGPSEIDHYFCDVHPVLKLACTDTYVVGVVVTANSGTIALGSFVILLISYSIIL
VSLRKQSAEGRRKALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAIFYTIITPMLNPLIYTLRNAEVKNAMKKVWGGKVFWKANAK*
429 >lcl|XP_001497690.2|Plus13370183..3371127 NW_001867369 olfactory receptor 5B12-like LOC100067663 __SEG__ Chr12 {Equus caballus} MENSTEVTEFILVGLTDDPELQIPLFIIFSLIYLITLVGNLGMIKLILLDSRLHTPMYLFLSNLSLVDFGYSSAVTPKVMAGFLTGNKIISYNACVTQFFFFVAFITVES
FLLASMAYDRYAAVCKPLHYTTTMMTSVCTRLAIGCYFCGFLNASIHTGNIFRLSFCRSNVVDHFFCDAPPLLTLSCSDSYISEMVIFFVVGFNALFSILVISITYLFIF
ITILRMRSSEGRQKAFSTCASHLTAVSIFYGTVIFMYLQPSSGHSMDIDKITSVFYTMVIPMLNPLVYSLRNKEVKSAFKKAMGKAKYSIGFIF*
430 >lcl|XP_001497704.2|Plus124730181..24731119 NW_001867427 olfactory receptor 51A7-like LOC100067684 __SEG__ Chr7 {Equus caballus} MSVLNNSEVQLFLLIGIPGLEDAHIWISIPICLMYLVAIMGNSTILFIIKTEPSLHEPMYYFLAMLAFSDLGLSLSSLPTMLRIFLFNAMGISPNACFAQEFFIHGFTVM
ESSVLLVMSLDRFLAIHSPLRYSSLLTSNRVAKMGLTLAIRSILLVLPFPFTLRRLKYCQKNLLSHSFCLHQDTMKLACSDNKINVIYGFFVALCTVLDLALIVLSYTLI
LKTVLSVASLAERLNVLNTCVSHICAVLIFYVPIITLAAMHRFAKYKSRLVVILIADVFLLLPPLMNPIVYCVKTRQIREKVLGKLFNIWRR*
431 >lcl|XP_001497723.2|Plus1complement(24747350..24748291) NW_001867427 olfactory receptor 51G2-like LOC100067701 __SEG__ Chr7 {Equus caballus} MTLGSLENKSSISSTFLLSGIPGLEHMHMWISIPLCFMYLVSILGNCTILFVIKTEPSLHEPMYLFLSMLALTDLGLSLCTFPTVLGIFWMGSRDIGHDACFAQLFFIHC
LSFLESSVLLSMAFDRFMAICRPLHYSSILTNTVISRIGLASLGRSVALIFPLPFMLKRFPYCGSPVLSHSYCLHQEVMKLACADIKANSIYGMFVIVSTVGVDSLLILF
SYALILRTVLSIASRAERLKALNTCVSHICAVLLFYTPMIGLSIIHRFGKQAPHLVQVIMGFVYLLFPPLMNPIVYSVKTKQIRDRVTHAFCR*
432 >lcl|XP_001497727.2|Plus1complement(3411069..3412013) NW_001867369 olfactory receptor 5B3-like LOC100067704 __SEG__ Chr12 {Equus caballus} MGNNTEVKEFILMGLTNAPELQVPLFIIFTLIYLITLIWNLGLIMVILLASHLHTPMYFFLTNLSLVDFCYSSTVTPKVIAGFLIRDKVISYNACAAQMFFFVVFATVES
YLLASMAYDRYTAVCKPLHYTTMMTTTLCTHMTICSYVFGFLTAAVHVGDTFCLSFCMPNVVHHFFCDILAVMVLSCSDRHVSELVLVYMVSFNIFFALLVILISCVFIF
ITILKMHSAAGYQKAISTCASHLTAVSIFYGTIIFMYLKPSSSHSMDIDKIASVFYTMLIPMLNPVVYSLRNKEVKNAFKKAAEKAKYPLGLVF*
433 >lcl|XP_001497744.2|Plus13443049..3443966 NW_001867369 olfactory receptor 10W1-like LOC100067725 __SEG__ Chr12 {Equus caballus} MEFVFLGYPSNPEVCILFFLGVSLAYTLIICGHVLILVAIQTEARLHTPMYYFLGSLSAVEICYTAVVVPHILANILQPEKTITLLGCATQMIFFIGLGSADCFLLAAMA
YDRYVAICHPLQYPLIMTLTLCIHLVVASVVIGLFLSLQLVAFIFSLPFCRAQSIEHFFCDVPPVMHLVCANSHIHEQSVLVAATLAVAAPFFLITTSYAFIMVAVLKIH
SAAGRHQAFSTCSSHLTVVLLQYGCCAFMYLRPNSIYYPKQDQFISLVYTLGTPLLNPLIYTLRNSEIKGILGRCLTRNYLFQNN*
434 >lcl|XP_001497758.2|Plus1complement(24787485..24788426) NW_001867427 olfactory receptor 51A7-like LOC100067738 __SEG__ Chr7 {Equus caballus} MSTVNTSETEISNFFLIGIPGMESDKIWVSIPICLMYLVALLGNCTILFFIKTEPSLHEPMYYFLSMLALSDLGLSLSSLPTMLRIFLFNAPGISPDACIAQEFFIHGFS
AMESSVLLLMSFDRFIAICNPLRYTSILTSAKVTKIGLAFSLKNVLLILPFPFTLKHLKYCKKNLLSHSYCLHQDVMKLACSDNKVNVIYGLFVALTGVLDLTFIFTSYM
MILKAVLSIASQRERLKVLNTCVSHICAVLIFYVPIISLAAIYRFAKHSSPIIRILMADVFLLVPPLMNPIVYCVKSQQIRNMVLGKLCQKQG*
435 >lcl|XP_001497764.3|Plus1complement(3460010..3461014) NW_001867369 olfactory receptor 1S1-like LOC100067742 __SEG__ Chr12 {Equus caballus} MCSFLQISRNMHQGNQTTISEFLLLGLSNQPEQQQLLFVLFLGMYLVTVAGNGLIILAIGLDSYLHTPMYLFLANLSFADISSISTSVPKMLMNIHTSSQSISYESCITQ
MYFSIVFVNIDNFLLGVMAYDRFVAICHPLNYLTIMQLRFCIFLTVVPWVLSNIVALTHTLLLLQLIFCDSSTLPHFFCDLALLLKLSCSDTMINELVLFFVGLLVITFP
IALIFFSYICIIRAVLRISSTEGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSMLPDDRDKIGAVLFTVVTPMVNPFIYSLRNKDMKGALRKLINRKSFLLLMPWASTF
LSSQ*
436 >lcl|XP_001497803.2|Plus1complement(3492015..3492959) NW_001867369 olfactory receptor 9Q2-like LOC100067779 __SEG__ Chr12 {Equus caballus} MAGRNYTVVTEFFLIAFTEHPEWGLPLFLVFLSFCLLTLLGNLAMIILIHKDHRLHTPMYFFLSHLSFMDICYSSVIVPQMLAVLLEHGTAISQARCAIQFFLFTFCASL
DCYLLAIMAYDRYVAVCRPLLYVTIMTERARLGLVAGAYIAGFSSAFIRTVTAFSLTFCGNNEINFIFCDLPPLLKLSCGDSYTQEVVIIVFAIFVMPACILVILVSYLF
IIVSVMQIRAAGGWAKTFSTCASHLTAVALFFGTLIFMYLRDNSGQSSEEDRVVSVLYTVVTPMLNPLIYSLRNKEVKEAVRKALSRSKTSGWP*
437 >lcl|XP_001497817.2|Plus124876477..24877412 NW_001867427 olfactory receptor 52J3-like LOC100067800 __SEG__ Chr7 {Equus caballus} MFYTNNSIFHPATFFLIGIPGLEEVHVWISLPFCSVYLVALLGNATILLVIKMEHMLREPMFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEINFGACVAQMFLIHAFT
GMEAEVLVAMAFNHYVAICAPLHYTSILTSRVLMGISLYIVICPVLLTLPMIYLIYRLPFCQAYILSHSYCEHMGIAKLSCGNIHINAIHGLFVVSLFLLNLVLINISYV
YILCAVFHLPSQDARLKALSTCGSHVAVLCVFYIPSVFSFLTHRFGHNIPHYVHILVANLYLVFPPSLNPIIYGVRTKQIRERVFRIFIKK*
438 >lcl|XP_001497833.2|Plus124892543..24893511 NW_001867427 olfactory receptor 52J3-like LOC100067826 __SEG__ Chr7 {Equus caballus} MTTSPNLSFGRIFYSNSSVFHPATFFLIGIPGLEEVHAWISMPFCSVYLVALLGNATILLVIKTEHMFREPMFYFLAILSTIDLALSTTSVPRMLGIFWFNAHEINFGAC
VAQMFLIHAFTGMEAVVLVAMAFDRYVAICAPLHYTTILTSRVLMGISLYIVIFPVFLTLPMIYLIYHLPFCQAHIIAHSYCEHMGIAKLSCGNIRINAIYGLFVVSVFL
LILVLIGISYVYILRAVFHLPSQDARLKALSTCGSHVAVLCVFYIPSVFSFLTHRFGHNIPHYVHILVANLYLVIPPSLNPIIYGVRTKQIRERVLCALTKK*
439 >lcl|XP_001497850.2|Plus1complement(3540424..3541365) NW_001867369 olfactory receptor 9I1-like LOC100067855 __SEG__ Chr12 {Equus caballus} MAESGTVVTDFVLIGFQLREELQMGLFFVFLVLYLITVVGNLGMIVLIQSDLHLKTPMYFFLSHLSLLDTCYSSVIVPQLLETLGTDKMVISYECCAAQFFFFTLCASSE
CFLLAVMAYDHYVAVRNPLLYATTMTPQTYRGLVSGAYAGAMVNSTIHTGCTFPISFCKSNHLDFLFCDFPPLLKLACSETRPREQVVYLLAFLVITTSITVILISCLFI
IWDILKIHTASGKAKTFSTCASHMTAVALFLGTLMFMYLKGNMGKSLTEDKIVSVFYTMVIPMLNPMIYSPRNKEMKEALKKVLNRMTVSQVE*
440 >lcl|XP_001497863.2|Plus1complement(24937684..24938664) NW_001867427 olfactory receptor 51G1-like LOC100067873 __SEG__ Chr7 {Equus caballus} MAAWDSLRTISNASIRQSPSFYLTGIPGYENLHHFISIPFCAFYLIGIVGNCTILHIIHTDKGLHEPMYYFLAMLSFTDIGMSISTLPTVLKILWFEAREIEVNACVAQM
YFIHTFSLMESAVLLAMAFDRYIAICDPLRYSSKLTPQRIIYIGIFIVIRCSIVLPVVLARIPTFSFCHSHVLSHSFCLHQDVIRLACTDISFNISYGLFVVAFYWGIDS
LGIFLSYAFILHSVLGIASQGGKLKALNTCASHICAVLILYVPMIGLSLVHRFAKHSSPIIHITMANIYLLVPPVLNPIIYSIKTKQIRQGFLRILSAKRVGFAHT*
441 >lcl|XP_001497864.2|Plus1complement(209323..210267) NW_001867372 olfactory receptor 1F12-like LOC100067876 __SEG__ Chr13 {Equus caballus} MERGNHTSASEFILLGLSSQNEEQELIFGLFLVIYLVGAAGNLFIILAIGSDSHLHTPMYFFLSNLSLVDFCFISTTVPKMLVNIQTQTQSICYSGCLAQIYFCILLANM
DNFLLTAMAYDRYAAICHPLHYSTTMSLQTSALMLGSSWLIANFHSLLHTLLMARLEFCASNVIPYFFCDLVPLLQLSCSDTHLNQLMILLVGGLIVLIPFFGILVSYSY
IVSAVLKVPSARGKQKAFSTCGSHLTVVILFYGTITGVYLSPSSSHSADKDSLASVMYMVVTPMLNPFIYCLRNKDMKRALWKLFSVKVLSRGL*
442 >lcl|XP_001497865.2|Plus13558516..3559460 NW_001867369 olfactory receptor 9I1-like LOC100067877 __SEG__ Chr12 {Equus caballus} MAKNNLTTVTEFILMGFIDYPKLEIPLFVMFLSFYLVTLLGNVGMIILIQVDVQLHTPMYFFLSHLSLLDACYISVIIPQILVTLAKGKMVISYGQCAAQFFFFTICAAT
ECFLLAVMAYYRYVAISKPLLYTVAINPRICWSLVVVAYVCRMLGAILRTTCTFTLPFCDNNQINFFFCDLPSLLKLACIDTTSTEIVIVFFGNFVILANALVILISYLL
IIKAIWRVKSSGGRTKTFSTCASHLTAVALFFGTLIFMYLRSGSGKSPEEDKVVSVFYTVFIPMLNPLIYSLRNKDVKVAFRKVTGRFQGSRSM*
443 >lcl|XP_001497884.3|Plus124951973..24952914 NW_001867427 olfactory receptor 52E1-like LOC100067901 __SEG__ Chr7 {Equus caballus} MALINTTLFHPYSFLLRGIPGLEHMHIWMGFPFFAVYLTAVIGNISILSVIHTETSLHQPMFYFLAILSSIDLGLSTSTIPKMLGIFWFNLREITFEGCLIQMFFIHLCT
GMESAVLVAMAYDRYVAICNPLHYTLVLTNRVVFIIALVILLRPLSFVIPFVLLILRLPFCGHHIIPHTYCEHMGIARLSCASIRVNIIYGLCAISILMFDIIAIVISYV
QILRAVFRLPSHDARLKALSTCGSHVCVMLVFYTPAFFSFMTHRFGQNIPHYIHILLANFYIVVPPALNPIIYGVRTKQIREQVLKVFSKKKT*
444 >lcl|XP_001497916.2|Plus1complement(24990408..24991361) NW_001867427 olfactory receptor 52E2-like LOC100067950 __SEG__ Chr7 {Equus caballus} MFLPNYTQLHLSSFLLLGIPGMETYHIWIGFPFCAVYLIAIIGNFIILFVIQAESSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFSLREIIFGACLTQMFFIHNFT
LMESAVLLAMAYDRYVAICNPLRYSTILTNQVVRMIGLGVLVRAFIFVIPFVFLILRLPFCGNHVIPHTYCEHMGLARLSCASIKINIIYGLCAICNLVFDITAIALSYG
QILRAVFRLPSREARLKSLSTCGSHVFVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQIYDHVKKIILKKQGKEKE*
445 >lcl|XP_001497952.2|Plus13675591..3676538 NW_001867369 olfactory receptor 1020-like LOC100067995 __SEG__ Chr12 {Equus caballus} MELGQNHTPVTRFILLGLTDHPDEKQLLFAIFLLIYSMTLVGNLGMIDMIRASSTLHTPMYFFLSVLSFLDICNSSVFTPRLLISFLSTDQTISFAGCVTQMALMTLHGT
GECLLLAIMAYDRFVAICHPLLYHIIMSKRLCVQLVMVTYVMGVFIAALQTGNAFILPYCGPNVIDHYSCDIPPVLQLACSDTTVANIILLFFSALVTVPTISVILVSYA
YILVTIYKMRSLEAQRKAFSTCASHLAALSLFYVPVFLVYVQPNPESSSASNKILSVFYTIVIPMLNPLVYSLRNKDVKAAVQLRVLNFSRQGIC*
446 >lcl|XP_001497990.2|Plus13714691..3715650 NW_001867369 olfactory receptor 5B12-like LOC100068042 __SEG__ Chr12 {Equus caballus} MTPGELALASGNHTPVTQFILLGFSNYPELQQLLFGVFLLIYAVTVVSNLGMIVLILTDSCLQSPMYFFLSVFSFLDICYSSVITPKLLVNFLASDKSITFWGCVVQMTF
FVAHATAESFLLASMAYDRFMAICQPLHYGSSMTKGTCLQLVAASYAFGGVNSAIQTGNAFTLPFCGPNQVTHYFCDIPPLLRLACGNKDTAGMVLYIFSALVTLLPAAV
ILTSYSLVLVAIGKMRSAAGKKKALSTCASHFLAITIFYGTVVSTYDQPHGPTYDTKDQVVSVFYTTIIPMLNPFIYSLCNKNVKEALQRKLQVNIFPC*
447 >lcl|XP_001498039.1|Plus1complement(25118032..25118976) NW_001867427 olfactory receptor 52D1-like LOC100068096 __SEG__ Chr7 {Equus caballus} MLGYNRTCLQPTTFLLLGIPGLESAHIWISIPFCLVYLQSLLGNVALLLIVKRDHKLHEPMYLFLSMLSVADLMLTSSTLPKILSIFWFNDREIYFEACLTQMYLIHSLS
TMESGFILAMAFDRYVAICHPLRHSTLLTPAVIVGLGLLIVFRGAVLLSPHPFLLRWLSYCKTNVISHTYCEFMALIKLVCTETKIRRAYSLIVAFLTGGLDFILIICSY
VLILLTVFSLPSKAARLKTLSTCVSHVWVILVFYTPAFFSFLTHRFGHHIAPHIHIFIANIYLLIPPMMNPIIYGVKTKRIREGFFKFLKIKCA*
448 >lcl|XP_001498042.2|Plus1complement(3779928..3780872) NW_001867369 olfactory receptor 5B2-like LOC100068100 __SEG__ Chr12 {Equus caballus} MKNNTEVTEFVLLGLTNTPELQIPLFIIFTLIYLVSVVGNLGMILLIVMDFHLHTPMYFFLSNLSLVDFCYSTAVTPKVMAGLLIGDKIISYNACAAQMFFFVALATVEN
FLLASMAYDRFAAVCKPLHYTTTMTTSVCACLAIGSYIYGFMNASVHIRDTFSLSFCMSNMVHHFFCDIPAVMSLSCSDRHVSELILVVVASFNIFFALLVILISYMFIF
ITILKMHSAEGYHKALSTCASHLTTVAIFYGTAIFMYSQPSSSHSMDTDKIASVFYTMVIPMLNPLVYSLRNKEVKNAFKKLVDKVNFSLGFAF*
449 >lcl|XP_001498055.1|Plus1complement(25126982..25127932) NW_001867427 olfactory receptor 52M1-like LOC100068121 __SEG__ Chr7 {Equus caballus} MPPLNASCPSPVTFLLMGIPGLEHLHVWIGIPFCSMYLVAVVGNVTILAVVKAERSLYEPMFLFLCMLSVTDLVLSTSTLPRMLCLFWLGVHDIAFDACLAQMFFIHSFT
AMESGFFLAMAVDRYVAICDPLHHTTILTHAHITMMGTIVVIRGVAFFSPHPILLKQLPYCRARIIAHTYCEFMAVVKLACVDTGATKRYSLSVASIIGSCDAILIAVSY
AFILRSVLRLPSREASFKALGTCGSHVCVILVFYSTAGFSIFTHRFGKNVPARIHIFIANMYLLVPPFLNPIVYGVRTKKIREHVFRTLMVKVSQF*
450 >lcl|XP_001498058.2|Plus13798716..3799660 NW_001867369 olfactory receptor 5B2-like LOC100068124 __SEG__ Chr12 {Equus caballus} MENRTEVTQFILLGVTDTSELQVPLFIIFTFIYLINVTGNLGMIILILSNSHLHTPMYFFLSNLSLVDFSYSSAVTPKVMAGLLIGDKIISYNACAAQMFLFVGFATVEN
YLLASMAYDRYAAVCKPLHYTRTMTTSVCAHLAIGSYICGFLNASIHVGDIFSLFFCKSNTVHHFFCDVPAVMALSCSDKHINEVVLVFLSSFNVFFALLVILISYLFIF
LTILNMHSAQGHQKALSTCASHLTTVSIFYGTVIFMYLQPSSSHSMDTDKMASVFYSMVIPMLNPVVYSLRNKEVKYAFKKVVEKGNFSKDLGC*
451 >lcl|XP_001498073.2|Plus13814920..3815858 NW_001867369 olfactory receptor 5B3-like LOC100068140 __SEG__ Chr12 {Equus caballus} MKNRTEVTQFILLGLTNAPELQLPLFITFTLIYIITLIGNLGIIMLILLNSHLHTPVYFFLSNLSLVDLCYSSAVTPTVMAGFITVDKVISYNACAAQMFFFVAFATVEN
YLLASMAYDRYAAVCKPLHYSTTMTTGVCACLTTGSYICGFLNASIHIGDTFSLSFCMSNVVHDFFCDIPAVMVLSCSDRHVSELVLVYVVSFNIFFALLVILISYVIIF
ITILKMHSASGYQKALSTCASHFTAVSIFYGTIIFMYLQPSSSHSMDTDKMASVFYSMIIPMLNPVVYSLRNKEVKVAFMKVVSEAKLSLGL*
452 >lcl|XP_001498109.2|Plus1complement(91373431..91374387) NW_001867387 olfactory receptor 10G2-like LOC100068177 __SEG__ Chr1 {Equus caballus} MRKTKNTSLDTVVTDFILLGLSHPPNLRTLLFLVFFCIYFLTQLGNLLILLTVWADPKLHARPMYILLGVLSFLDMWLSSVIVPRIILNLTSASKAIPFSGCVAQLYAFH
FLGSTQCFLYTLMAYDRYLAICHPLRYPMLMNGRLCTILVAGAWLAGSIHGSIQAILTFRLPYCGPNQVDYFICDIPAVLRLACADTTVNELVTFVDIGVVAASCFMLIL
LSYANIARAILKIHTADGRQRAFSTCGSHLTVVTVYYVPCIFIYLRAGSKSPLDGAVAVFYTVVTPLLNPLIYTLRNQEVKSALKRITAGRGAASENK*
453 >lcl|XP_001498110.2|Plus13834228..3835175 NW_001867369 olfactory receptor 5B3-like LOC100068179 __SEG__ Chr12 {Equus caballus} MDNRTEVTQFILLGLTNIPELQMPLFILFTLVYLISVVGNLGMVLLILMDSHLHSPMYYFLSNLSLVDLCYSSAVTPTVMAGFVTVDRVISYNACAAQMFFFAVFATVEN
YLLASMAYDRYAAVCKPLHYTTTMTMSVCARLIIGCYVCGFLNASIHIGDTFHLSFCMSNVVHHFFCDIPAVIALSCSDRHVSELVLIYISSFNIFFALLVIFISYLLIF
ITILKMQSSSGYQKALSTCASHLTAVSIFYGTVVIMYLQPSSSHSMDTDKMVSVFYSMIIPMLNPLVYSLRNKEVKSAFKKVLLQAKLSLGLGML*
454 >lcl|XP_001498121.3|Plus125162215..25163153 NW_001867427 olfactory receptor 52J3-like LOC100068196 __SEG__ Chr7 {Equus caballus} MMPQQNITIFHPSTFFLLGIPGLETAHAWISLPFCCVYLMAFIGNVTIFTVIWTERTLRDPMFFFLAILSTIDLALFTSSVPRMLGIFWFNAHEIGFGACVAQMFLLHTF
TGMESAVLLAMAFDHYVAICAPLHYTTILTASVLSGIGMGIVLSTVVLSLPMIYLIHHLPFCNAHIIAHTYCEHMGIAKLACANVQINAMYGLFVASFLVLVLVLVGISY
GYILHTVFYLKSPDARHKTLSTCGSHAGVMFIFYTPSLFSFLTHRFGQKIPPYVHILVANIYVVLPPALNPIIYGVRTKQIRKCVIQVFTGK*
455 >lcl|XP_001498124.2|Plus1complement(3840273..3841217) NW_001867369 olfactory receptor 5B12-like LOC100068199 __SEG__ Chr12 {Equus caballus} MENRTEVTEFILLGLTDDPELQIPLFIIFSLIYLITLVGNLGMIKLILLDSHLHTPMYFFLSNLSLVDLGYSSAVTPKVMARFLTGDNIIPYNSCVTQFFFFVAFITVES
FLLASMAYDRYAAVCKPLHYTTTMTTSVCTCLVIGPYICGFLNASIHTGNIFRLSFCRSNVVDHFFCDAPPLLTLSCSDNYISEMVILFVVGFNDLFSVLVILISYLFIF
ITILRMRSSEGCQKAFSACASHLTAVSIFYGTGIFMYLQPSSSHSMGTDKLASVFYTMVVPMLNPLVYSLRNKEVKSAFKKTVGKAKSSVGLMF*
456 >lcl|XP_001498150.2|Plus125177962..25178912 NW_001867427 olfactory receptor 52A1-like LOC100068228 __SEG__ Chr7 {Equus caballus} MASINVSYLNPRTVILIGIPGLEHVQFWIGFPFFAVCLVSVLGNIILLIIIPTERSLHQPMYIFLAVLAATDIGLCAAIVPKMLAIFWFRSCSMAFDTCLAQLFSIHALQ
CIESGILLAMAFDRYTAICDPLRHKSILTPSILSRMIVMVAIRATVLVGLLPILIKRLHLFHSIVIAHSYCEHMAVVKLAAEDIQVNKICGLFVGFTILGFDMIFILISY
ILIFQAVFRLHQKEARLKAFNTCTAHIFVFLEFYILAFVSFFSHRFGHVAPSTHILLSTIYLLVPPALNPIVYGVKNKVIRKRVAQIFLLNHESQQ*
457 >lcl|XP_001498151.3|Plus1complement(3876856..3877806) NW_001867369 olfactory receptor 5B21-like LOC100068230 __SEG__ Chr12 {Equus caballus} MENSTEMVEFILLGLTDDPNLQLPLFLVFLFVYLITLVGNAGMMVIIYSDFRLHTPMYFFLSNLSFVDLCYSSAIVPKMVAALQPENRVISYSGCAAQFFFFAGFGTVEC
YLLASMAYDRHAAVCRPLHYTTTMTAGVCALLTIGSYVCGFLNASIHTADTFRLSFCDSNEINHFFCDMPPLLALSCSDIRISELVVLFVVGFNVFFTLVVILISYLFIY
MAIQRMSSAEGRKKAFSTCASHLTAVFIFYGPMIFMYLHPSSSQSMDTDKIASVFYSVVTPMLNPLIYSLRNKEVKNAAWKMLNKFYPQSLSVNRK*
458 >lcl|XP_001498175.1|Plus1complement(26640482..26641888) NW_001867391 relaxin-3 receptor 1 RXFP3 __SEG__ Chr21 {Equus caballus} MQVGVRATIATMNKAAGGDELAELFRLIPDLLQAANSSGNTSLQLQDLWWELGLELPDGAAPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSKQ
GWRKSYINLFVTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSIVTSINMYASVFFLTAMSVARYHSVASALKSHRTRGHSRGDCCGQSLEDSCCFSAKALCVL
IWASAVLASLPNAIFSTTIKVMGEELCLVRFPDKLLGGDRQFWLGLYHLQKVLLGFVLPLGIISLCYLLLVRFISDHRVAGTEGGAPAAGGGLAGASARRRSKVTKSVTI
VVLSFFLCWLPNQALTTWSILIKFNAVPFSQEYFLCQVYAFPVSVCLAHSNSCLNPILYCLVRREFRKALKNLLWCIASPSLTSMRPFTATTKPEPEDQGLQALAPLHPA
AEPDLYYPPGVVVYSGGRYDLLPSSSAY*
459 >lcl|XP_001498181.2|Plus1complement(25213914..25214858) NW_001867427 olfactory receptor 52M1-like LOC100068268 __SEG__ Chr7 {Equus caballus} MGPTNKSQISPNTFLLMGIPGLEHLHAWIGIPFCSMYLVAVVGNVTILAVVRTERSLHEPMFLFLCMLSVTDLVLSTSTLPRMLCLFWFGAHDIAFDACLTQMFFIHSFT
AMESGFFLSMAIDRYVAICHPLRHTTILTHARIVKMGASVVLRGVGFFTPHPILLRQLPYCRTNIIAHTYCEFMAVVKLACVDTRATKRYSLSVASVIGSCDGFFIALSY
VLILHAVFRLPSREASLKALGTCGSHVCVILVLYSTAVFTFLTHRFGHNVAPQIHIFVANMYLLVPPFLNPIVYGIRTKKIRDHVLGSLRVKVA*
460 >lcl|XP_001498184.2|Plus1complement(930184..931143) NW_001867372 olfactory receptor 2AE1-like LOC100068271 __SEG__ Chr13 {Equus caballus} MWQRNQTSLADFILEGLFDDSLTHLFLFSLTMVVFLIAVSGNTLTILLICADPQLHTPMYFLLSQLSLMDLMHVSTTIPKMATNYLSGKKSITFVGCVTQHFLYLSVGGA
ECLLLALMSYDRYVAICHPLRYTVLMNRRVGLMMAVVSWLGASINSLIYTAMLMQYPFCGPRNIRHFYCEFPAVVKLVCGDITVYENTVFISSVLLLLLPIFLVSTSYAF
ILHSVIQMRSAGSKRNAFATCSSHFIVVSLWFGACMFSYMRPRSRRTPLQDKVGSVFYSIITPTLNPLIYTLRNKDVAKALRRVLGRDVITQRQQLQLS*
461 >lcl|XP_001498200.2|Plus1complement(25231289..25232233) NW_001867427 olfactory receptor 52M1-like LOC100068286 __SEG__ Chr7 {Equus caballus} MPLLNASRPSPVTFLLMGIPGLEHLHVWIGIPFCSMYLVAVVGNVTILSVVKAERSLHEPMFLFLCMLSVTDLVLSTSTLPRMLCLFWFGAHDIAFDACLTQMFFIHSFT
TMESGFFLAMAVDRYVAICDPLHHTTILTHARITIMGIIVVTRGVAFFSPHPILLKQLPYCRTRIIAHTYCEFMAVVKLACVDTGATTRYSLSVASIIGSCDAILIAVSY
AFILRSVFCLPSREASFKALGTCGSHVCVILVFYSTAGFSIFTHRFGKNVPAHIHIFIANMYLLVPPFLNPIVYGVRTKKIREHVLRALMVKVS*
462 >lcl|XP_001498215.2|Plus125244560..25245510 NW_001867427 olfactory receptor 52A1-like LOC100068309 __SEG__ Chr7 {Equus caballus} MASINTSYLDPTTVTLIGIPGLEHVQFWIGFSFLVVCLVALVGNIILLIIIPSERSLHQPMYIFLAVLAATDVGLCVAIAPKMLAIFWFGSCSMAFDACLTQLFFIHTLQ
GMESGILLAMAFDRYIAICNPLRHTSILTPFVLVIMVLVVAIRATVLVGVLPVLIKRLHLFHSIVIAHSYCEHMAVVKLAAEDIQVNKTCGLLVGFTILGFDMIFILISY
ILIFQAVFRLHQKEAQLKAFNTCTAHIFVFLEFYLLAFFSFFSHRFGHVAPSTHILVSTIYLLVPPALNPIVYGVKNKVIRKRAAQIFLLNHRSLQ*
463 >lcl|XP_001498256.1|Plus122739128..22740198 NW_001867381 CX3C chemokine receptor 1-like LOC100068350 __SEG__ Chr16 {Equus caballus} MPTHFPEPISDDFQYDESAEACNMEDIVVFGTAFLSVVYSLVFVFGLVGNLLVIFSLSNSRKRKSITDIYLLNLALSDLLFVATLPFWTHYLRSEQGFHNAVCKLTTAFF
FIGFFGGIFFITIISIDRYLAIVLAANSMNNRTVTHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQDIWPVLRNVEANALGFLLPLLILIYCYFRIMRTLF
SCKNRKKAKAIKLILLVVIVFFLFWTPYNIMIFLETLNLYDFFPDCDMKRDLKLAIGVTETIAFIHCCLNPIIYAFAGEKFRRYLSHLYRKCLAVLCCYSVDTGFSPPES
QTGRRESILSSNFTHYTSDGEVSLHV*
464 >lcl|XP_001498264.2|Plus1complement(25282181..25283125) NW_001867427 putative olfactory receptor 52P1-like LOC100068355 __SEG__ Chr7 {Equus caballus} MSLSNDTNLHPSTFVLLGIPGMEAIHSWLSVPFCLIYLSALLGNFSILFIIRTDSNLHEPMYFFLCMLIVADLIISTTAMPKILSNFWFHDREIYFEACLVQVFLIHSLC
SMASGFILAMAFDRYVAICNPLRHSTILTHRVIKNLGLAIVFRGALLFSPQPFMLCWLPYCRTNVVPHTYCEFMALIKLACSETRTYRIYSLTAAFLTGGIDFILILCSY
VVILYTVFRLPSKAAQLKTLGTCGSHVCVILVAYTPAFFSFLIHRFGHHVAPHIHIFVANIYLLVPPMVNPMIYGVRTKRIRERFLQVLTSHKF*
465 >lcl|XP_001498280.1|Plus1complement(7225082..7226191) NW_001867366 somatostatin receptor type 2-like LOC100052744 __SEG__ Chr11 {Equus caballus} MDMAYELLNGSQAWLSSSFDLNGTVAAANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPF
GKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVP
LTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLV
KVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI*
466 >lcl|XP_001498314.1|Plus125327001..25327960 NW_001867427 olfactory receptor 51G2-like LOC100068425 __SEG__ Chr7 {Equus caballus} MATLNSSNSLSSTFYLTGIPGYEEFHHWISIPFCLLYLGGIMGNCTILHIVRTDPRLHEPMYYFLAMLSLTDMGMSMPTMISLFRVLWSISREIQFNICVVQMFFIHTFS
FTESSVLLAMALDRYVAICHPLRYVTILTPRLITKIGIAALLRNAFAVIPLLARLPFFPFCHSHILSHSYCLHQDIIRLACADTKFNIIYGMIVITMLWGMDSLGIFVSY
VFILHSVLKISSREGRFKSLNTCASHICAVLILYVPMIGLSIIHRFGKHSSPLSLILMGHIYLLVPPVLNPIIYSVKTKQIRQGILHLLLPPKITRAVM*
467 >lcl|XP_001498317.1|Plus16776260..6777126 NW_001877049 protein sprouty homolog 3-like LOC100062480 __SEG__ ChrX {Equus caballus} MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTALPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQ
SIIRTQPGAGTNSKADGALKGEAEQSAVHPSEHLFICEECGRCKCVLCTAARPLPSCWLCNQRCLCSAESLLDYGSCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFV
RWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKTQEKSV*
468 >lcl|XP_001498385.2|Plus1complement(25399944..25400894) NW_001867427 olfactory receptor 52A5-like LOC100068501 __SEG__ Chr7 {Equus caballus} MFKFNSTVFMPSVLTLIGIPGLESVQCWIGIPFCAMYIIALLGNFLLLVIIKSEQRLHEPMYLFLAMLRTIDIALSTCILPKMLGIFWFHAPDIYFDVCLLQMWLVHTFQ
CIESGILLAMALDRCVAICDPLRHATIFTHQLLTQIGVGVTLRAALLSAPCLILIKCRLKYYRTTVVSHSYCEHTAIVKLAAEDVRINKIYGLFVAFSILGLDIVFIILS
YFQIFITVFNLPLKEARLKAFNTCIAHICVFLEFYLLGFFSFFTHRFGFHIPPCIHILLSNLYLLVPPLLNPIVYGVKTKQIRDRVSKIFYAKNPS*
469 >lcl|XP_001498404.2|Plus1complement(4317854..4318804) NW_001867369 olfactory receptor 5AN1-like LOC100068520 __SEG__ Chr12 {Equus caballus} MAGGRNNTTVAKFILLGFSDFPKLKIALFTVFLGTYLLTVAWNLSLIILIKMDSSLHTPMYFFLSNLSFIDLCYVTSTTPKMLSGFFQKTKFISFVGCAIQYFFFSSLGL
TECCLLAAMAYDRYAAICNPLLYTNIMSPTLCEQMVVAAYITGIFGSSIQLCALLQLDFCGPNIINHFFCDLPQLLVLSCSETFFLHVIKFVIAVIFGLTSVIIIMISYG
YIVATILKISSLEGRSKAFNTCASHLTAVTFYFGSGLFVYMHSSTDSSLGYDKMASVFYTVVIPMLNPLIYCLRNQEIKDALTRCKKKRIFSHCHS*
470 >lcl|XP_001498432.3|Plus1complement(25447559..25448536) NW_001867427 olfactory receptor 51G2-like LOC100068560 __SEG__ Chr7 {Equus caballus} MMLYINNNTSAISTFLVTGIPGLEGVHVWISIPFCVMFFITLVGNMSIMTVILQEQTLHAPMYLFLAMLAASDLGLSLFTFPTMLRIFWLDARELTFSVCFTQMFFIHSF
QDFESAVILAMAFDRYVAISHPLHYCSIFTNSVIARIGLAIVVRTLTLQVPLPILLRRLCFCNSNVLSHSYCLHPDLIKLSCSNTEINSIFGLFVVLSTMGLDFVLIIIS
YVLILKTVLTIASHGGRLKALNTCISHLCAVILFFTPMICLSMLHRFGPKLPSHIYMTMANMHFLIPPLMNPIVYVVKTKQIRDKILKLLSKKDKRNPKLRLFHK*
471 >lcl|XP_001498452.2|Plus125462124..25463080 NW_001867427 olfactory receptor 51I1-like LOC100068578 __SEG__ Chr7 {Equus caballus} MLAFNNTASDRPTFSFIGIPGLEAAHMWISIPFCLLYFVSLVGNSLLLILVRAEQNLHEPQFYFLAMLALTDLGLSLSTMPSVLAIFWFDVHHISLDACLTQMFFIHILS
SVESGVLVAMAFDCLIAVCAPLHYTRILTHYTVACLSGAALLRATTLLAPLPFFLRTFPFCGANILSHSYCYYPDMLNLACGDVTFSSAYGWVFVLCTFVVDVIFILASY
MKILGTIMRMGTQDRNWRTLHTCACHLCTVLVFYLPLISLAVLHHYTQDISPVVYTTMSNAYLLMTPLLNPLVYSLKSRQIQAALRKRFWVQRVIAGE*
472 >lcl|XP_001498453.2|Plus1complement(4415667..4416605) NW_001867369 olfactory receptor 5AN1-like LOC100068580 __SEG__ Chr12 {Equus caballus} MIEERNITEITYFILLGFSDFPRITAVLFAVFLLIYIMTLTWNLCLIMLIRMDSHLHRPMYFFLCNLAFIDICYATSTVPKMLFNFFQEQQTITFVGCLIQDLVFSTMGL
SESCLMTAMAYDRYAAICNPLLYSSIMSPTLCVQMVLGSYMAGFSASITQLCAIHQLQFCGSNVINHFFCDMPQLLVLSCTDTFFVQLMTAVLTVIFGIINVSIIMISYG
CIVISIMKITSAKGRSKAFSTCASHLTAVTLFYSSSIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKKRKYC*
473 >lcl|XP_001498455.2|Plus12298659..2299585 NW_001867417 olfactory receptor 2T33-like LOC100068584 __SEG__ Chr5 {Equus caballus} MEKRNTTSDFILLGLFKHTGPHLFLFMVVLTMAMASFMGNALMLLLIYWDPRLHTPMYFLLSQLSLMDVMLVATIVPKMAADYLTGKKSISPAGCGLQIFFYLTVGGGEC
FLLAAMSSDRYVAVCHPLRYPVLMSWQLCLRMTLGSWFLGAADGLMQAAATLSLPFCSTREINHFFCEAPMLVRLACADTSVFENVMYICCVLMLLVPFSLILTSYSFIL
FAVLQMHSREARKKAFATCSSHLAVVGLFYGASIFIYMRPKSYRSASHDKVVSAFYAIFTPVLNPLIYSLRNSEVKGALKRWLGKYAN*
474 >lcl|XP_001498468.3|Plus1complement(4426417..4427328) NW_001867369 olfactory receptor 5A1-like LOC100068597 __SEG__ Chr12 {Equus caballus} MFVLLGLSDKKEVQLMLFPIFLVIYLVTLIWNLGLIILIRMDSQLHTPMYFFLSFLSFIDMCYSSSATPRMLSDFLKEEKVISFITCATQYFVGSWMAHAECCLLATMAY
DRYVAIGRPLQYSAVMSPSLCQKMVAWTYGTGFLGSIIQTVSCFHLYYCGPNTIPNFFCDITHIISLSCSNPFISQMILFMESIFVGFSSFLVILLSYAFIAASILKISS
VKGSAKAFNTCASHLAVVTIFYGTGFSVYLHRSSSHNEKQDKVLSVFYVVLIPMLNPLIYSLRNKEIKEALKRVIKRATHLPH*
475 >lcl|XP_001498487.2|Plus1complement(4445472..4446434) NW_001867369 olfactory receptor 5A1-like LOC100068612 __SEG__ Chr12 {Equus caballus} MVPIRSMEGERNHTSVVMFVLLGLSDEKELQLILFPIFLGIYLVTLIWNLGLIILIRMDSHLHTPMYFFLSFLSFLDICYSSSTSPRMLSDFLRDVKMISFTACAAQYFV
GCWMGLAECCLLAAMAYDRYIAIGRPLQYSVVMTPSLCQKMVAGACGSGFLGSLFLTVACFHLYYCGSNIIPNFFCDITQIISLSCSDPSISQMVLFLVCTFVGFNSFLV
TILSYGFIAASILKISSVKGSAKAFNTCASHLAVVTIFYGTSLSVYLLPSSNHSNKQDKVLSVFYVIFIPMLNPLIYSLRNKEIKEALKKVIKRLTHFTQ*
476 >lcl|XP_001498500.2|Plus125505635..25506591 NW_001867427 olfactory receptor 52Z1-like LOC100068626 __SEG__ Chr7 {Equus caballus} MTSSSNHTNLRDIWYTMIGIPGLEDAHTWISIPICSMYIVAVVGNTLLLFLIFTERSLHEPMYLFLSMLALADIFLSTVTTPKMLAIFWFQDGGISFGSCVSQMFFLHFI
YVAESAILLAMAFDRYIAICYPLRYTTVLTPSVIGKIGVASVIRSFFICFPLVFLVYRLTYCGKNIIRHSYCEHMGIARLACDSIKVNIYYGVIGPLFSTCLDVVLIIIS
YIFILCSVFRIASQDARLKALGTCGSHVCVILLFYTPAFFSFFAHRFGGHNIPLHVHILLANLYVVVPPSLNPIIYGIKTKQIQEKFLQVFSLSRKFC*
477 >lcl|XP_001498583.1|Plus1complement(45593792..45595612) NW_001867394 leucine rich repeat and Ig domain containing 2 isoform 2 LINGO2 __SEG__ Chr23 {Equus caballus} MLHTATSCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIRDKKLQHLLVDEGQTVQLECSADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
478 >lcl|XP_001498620.2|Plus1complement(25620937..25621875) NW_001867427 olfactory receptor 52A1-like LOC100068750 __SEG__ Chr7 {Equus caballus} MSMANITIFMPSMLALIGIPGLESVQCWIGIPFCVMYLTAVIGNSLLLIIIVSERSLHEPMYIFLGMLAVIDIALGTSIVPKMLGIFWFHIQEIYFDSCLFQMWLIHTFQ
IMESGILLAMALDRYVAICYPLRHTSIFTHQLITQIGAVVTLRAAILVAPCLVLIKCRFQFYHTTIISHSYCEHMAIVKLAAENVRVNKIYGLFVAFTVGGFDLTFIALS
YIQIFITVFRLPQKEARLKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHIPPYIHILFASFYLLVPPFLNPLVYGAKTKQIHIHGVKMFCS*
479 >lcl|XP_001498639.2|Plus1complement(25639935..25640885) NW_001867427 olfactory receptor 52A1-like LOC100068769 __SEG__ Chr7 {Equus caballus} MSMSNTTVSMPSVLRLIGIPGLEAVQRWIGIPFCAMYLIAMIGNTLLLITIISERRLHEPMYIFLGMLAVIDIALGTSIVPKMLGIFWFHIQEIYFDSCLLQMWLIHTFQ
GTESGILLAMALDRYVAICYPLRHTSIFTHQLITQIGAVVTLRAAILVAPCLVLIKCRFQFYHTTIISHSYCEHMAIVKLAAENVRVNKIYGLFVAFTVAGFDLTFITLS
YIQIFIAVFRLPQKEARLKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHFPPYIHILFSNLYLLVPPFLNPLVYGAKTKQIRVRVVKMFCSQNPP*
480 >lcl|XP_001498656.2|Plus1complement(25669537..25670487) NW_001867427 olfactory receptor 52A5-like LOC100068784 __SEG__ Chr7 {Equus caballus} MSITNGTVFMPSVLTFIGIPGLETVQCWIGIPFCAMHVIALIGNSLLLIIIKSEPSLHEPMYIFLAMLGATDIALSTSIVPKMLGIFWLHLPEIYFDACLFQMWLIHTFQ
GIESGVLLAMALDRYVAICYPLRHATIFTRQVVTHIGVRVALRPAVLVIPCLLLIKYRLKLYRTRLISHTYCEHMALVKLATEDIYINKCYGLLGAFIVGGLDFILTTLS
YIQIFITVFHLPQKEARLKAFNTCVPHICVFFQFYLLAFFSFFTHRSGSYIPAYIHITLSNLYLLVPPFLNPFVYGMKTKHIRDKVVKVFFPKHQA*
481 >lcl|XP_001498670.2|Plus1complement(25681760..25682710) NW_001867427 olfactory receptor 52A5-like LOC100068803 __SEG__ Chr7 {Equus caballus} MLIFNGSIFMPSVLTLIGIPGLESVQCWIGIPFSVMYLSAVIGNSLILVIIKYEKSLHKPMYIFLAMLGATDIVLSTCILPKMLGIFWFNLPEISFEVCLLQMWFIHSFQ
AVESGVLLVMALDRYVAICDPLRHATIFSQRLLTRIGVGVTLRAAVLVAPSIVLIKCRLKLYRTTIISHSYCEHMAIVKLAIEDIRINKIYGLFVAFTILGFDIIFVTLS
YVQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHIPPYVHILLSNIYLLAPPFLNPIVYGVKTKQIRDHVLKMFFSKKTP*
482 >lcl|XP_001498680.1|Plus151792251..51794641 NW_001867411 toll-like receptor 6 TLR6 __SEG__ Chr3 {Equus caballus} MTKDNKCVVRIFNFVYIVTLIVGTIIQFSDESKFAVDMSKIGLTHVLKDLPPETKVLDMSQNCISELHLSDMSFLSGLKVLRLSRNSIRYLDFSIFKFNPDLEYLDLSHN
QLQKISCHPIMSLKHLDLSFNDFEVLPICKEFGNLTQLDFLGLSATRLQQLDLLPIAHLHLSCILLDLEGYYVKENQTESLQIPNTKTLQLVFHPYNLFSVQVNISLNSL
GCLQLTNIKLNDDNCQVLIKFLSDPIRQPTLLNITLNHVETTWKCLVRVFQFLWPKPVESLHICNLTIVKSIGKEDFTYSKTALKALKIEHITNRVYIFSQQVLYTVFSE
MNIMMLTISDTPFIHMVCPQAPSTFKFLNFTQNVFTDSIFQNCSTLVRLETLILQKNELKDLFKVGLMTKNMPSLEILDVSWNSLEYHGPDGNCPWVESLVVLNLSSNIL
TDSVFRCLPPRVKVLDLHNNRIRSIPKDITSLEALQVLNVAFNSLVDLPGCGAFNSLSILIIDYNLISDPSADFFHSCQKIRSIKAGNNPFQCTCELREFIQSIGQVSSD
VVEGWPDSYKCEYPESYKGTPLKDFHLSQLSCNTALLVVTIVVPVLVLAVTVSILCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRTLQFHAFISYSERDSAWVKNEL
VPCLEKEDIRICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSDNLILILLEPIPQNNIPSKYHKLRALMTQRTYLEWPKEKSKR
GLFWANIRAAFNMKVALVIENNDVKT*
483 >lcl|XP_001498683.2|Plus1complement(25694901..25695839) NW_001867427 olfactory receptor 52A1-like LOC100068820 __SEG__ Chr7 {Equus caballus} MSTSNKTVFMPSMLTLIGIPGLESVQCWIGIPFCAMYLIAVIGNSLLLIIIISERSLHEPMYIFLGMLAVTDMALSTSIVPKMLGIFWFHIPEIYFDSCLFQMWLIHTFQ
AMESGILLAMALDRYVAICYPLRHAVIFTHQLITQIGSVLALRAVILVTPFLLLIKCRFQFYHTTVISHSYCEHMAIVKLAAENIRVNKIYGLFVAFTVAGFDLMFITVS
YIQIFITVFRLPEKEARLKAFNTCIAHICVFLQFYFFAFFSFFTHRFGSHIPPYIHILFSSLYLLVPPFLNPLVYGAKTKQIRVHVVKIFCS*
484 >lcl|XP_001498694.2|Plus151827542..51829902 NW_001867411 toll-like receptor 1 TLR1 __SEG__ Chr3 {Equus caballus} MTKTNSGIFHFAIIFVLILEIGIQSSDEREFFVDRSKAGLTHVPKDLSLKTTILDISQNYISELRTSDIQLLSKLRILIISHNKIQYLDISVFKFNLELEYLDLSHNKLG
KISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLEFLGLSATQLQKSSVLPIAHLHISKVLLVLGDPYGEKEDSESLRHLNTESLHIVFPTRKEFHFILDVSLSTAVNL
ELSNIKCVLDDNRCSYFLNVLSKLQKNPRLSSLTLNNIETAWDSFIMILQLVWHTSVENFSIKNVKLQGHLGFRDFDYSNTSLKALSIYQVVSDVFSFPQSSIYKIFSNM
TIQNFTVSGTHMIHMLCPSQISPFLHLDFSNNLLTDTIFRDCGTLTKLETFSLQINQLKELTNIAHMTKEMKSLHQLDISQNFLRYDENEGNCSWTRSLLSLNMSSNILT
DSVFRCLPPRIKVLDLHNNRIRSIPKQIMKLESLQKLNVALNSLTNLPGCGAFNSLSTLIIDHNSISNPSVDFFQSCQKIRSIKAGNNPFQCTCELREFIQSIGQVSSDV
VEGWPDSYKCEYPESYKGTPLKDFHLSQLSCNTALLVVTIVVPVLVLAVTVSILCIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRTLQFHAFISYSGHDSAWVKSELL
PNLEKEDIRICLHERNFIAGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEAFNNLILILLEPIPQYSIPSSYHKLKILMAKRTYLEWPKEKSKHG
LFLANLRAAINIKLME*
485 >lcl|XP_001498698.2|Plus1complement(25723661..25724611) NW_001867427 olfactory receptor 52A1-like LOC100068835 __SEG__ Chr7 {Equus caballus} MSVSNNTVFMPSVLTLIGIPGLESVQCWIGIPFCAMYLIAVIGNSLLLIIIISERSLHQPMYIFLGVLGVTDIVLGTSVVPKMLGIFWLHIPEIYFDSCLFQMWLIHTFQ
GMESGILLAMALDRYVAICYPLRHAVIFTHQLITQIVSVVALRAAILVAPCLVLIKCRFQFYHTTVISHSYCEHMAIVKLAAENVRVNKIYGLFVAFTVAGFDLTFITLS
YIQIFIAVFRLPQKEAGLKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHIPPYIHILFSSLYLLVPPFLNPLVYGAKTKQIRVRVVKMFRSQYPP*
486 >lcl|XP_001498701.2|Plus1complement(35361601..35363988) NW_001867402 kelch domain-containing protein 7A KLHDC7A __SEG__ Chr2 {Equus caballus} MLPGGGGTKAQDPHLDMQLTGKVVLSTVALLLLTVAYRLYKSRLALAPLWDRNTKAEAEEEAEGSGQPAIPGAAPGAPHWGPRRRRGSKGAGAPLDCSWESPRGSRVLET
EASSRDSEARETQKPERKGAGEEASGQRLGSDLAPPRGSDQEAGTAVGGKPQLPQPPDLGSEPESSAAGLAAADGSGVGGESAPWQDGRPPEQPGARQQEAPHQCWMVHS
EGSSDMNKSWVFTQVTGVRKEEAGALQAASDMGLALCQQEGAVTASYTFSSVARVRVEENFIRKVEGTRPRLKGKVYDYYVESTSQATSRGRLAPGTAALAEAPPPLPLP
GPPGAGAASEGPSGDTDGRADAAASSQPALSPPTRGLSRKESLLQISEHAELQLPLNGFGAPTPSCLDQSALPGGPISQDSLRSSSSRSSQESHVQLVAGTNFFHLPIAP
GSAPDVHLHLGNCYEVLTLAKRQKLETLKEAAYKVMSDNYLQVLRSPDIYGRLSGAERDLILQRRLQGRKHLVVADVCPLEDSGRLCCYDDEQDVWHVLARLPPEAVSWG
CAICSLFNYLFVVSGCQGPGHQPSNRVFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLNTVECYNPLLDRWTFAPPLPNDTFALAHTATACAGDIFVTGGT
LRYLLLRFSAQQQRWRAGPTAGSKDRTAEMVAVNGFLYRFDLNRSLGIGVYRCNASTRLWYECATYRTPYPDAFQCAVVDDLVYCVGRQRTLRFLADYISPRFMPKELRS
LPSPRGTLLPAVLTLPSPDVPQTRV*
487 >lcl|XP_001498732.1|Plus18293801..8295255 NW_001867423 c3a anaphylatoxin chemotactic receptor-like LOC100053275 __SEG__ Chr6 {Equus caballus} MESFSAESNSTDLHSQPQNKLQVILSMVILSLTLLLGLPGNGLVLWVAGLKMKRTVNTVWFIHLTVADFLCCLSLPFSLAHLALQGHWPYGWLLCKLIPSIIVLNMFASV
FLLTAISLDRCLLVLKPIWCQNHRNVGTAFTICGCIWVVAFVMCIPVFIYREMFSVDNHNMCGYNFGPYSSLDYSDFTFDLLENGSLDNAFVQLPGEMNNRLDSFSLQAG
DHPWTATTVLHSQTFQRPSGDSLSTDSARLSNQHLYYNLFKPADEISPTGPGGFPIEDHRINPLDNSDASLSTDLELFSNASSNSFYTYEPSQDFLDDNLGQFAYSNQMS
TPLVAITITRLVVGFLGPFLIMVACYSLIILRMRRGRLTKSRSKTLQVAMVVVVVFFVCWAPYHIVGVLLLFIDSETPFGEALLAWDHVSIALASANSCFNPFLYALLGK
DFRKKARQSMQGILEAAFSEELTHSTSCTPSKVFSEKNSISTVV*
488 >lcl|XP_001498733.3|Plus1complement(25735966..25736925) NW_001867427 olfactory receptor 52Z1-like LOC100068867 __SEG__ Chr7 {Equus caballus} MAPFFYNHTNPQNVWYILTGIPGMEDFHTWISIPICSMYIVAVIGNIFLIFLVMTERSLQEPMYLFLSMLALADVLLSTATVPKMLAIFWFHFTYISFWSCVSQMFFIHF
IFVSESAILLAMAFDRYVAICYPLRYTTILTSSVIGKIGIVAVVRSFIICFPFIFLVHRLIYCGRNIIPHSYCEHMGVARLACDDINVNIIYGLTVALLSTGLDIVFIIM
SYTMTLCTVFQIASWTSRFKALNTCGSHICVILMFYAPAFFSFFAHRFGSKTIPHHIHILVANLYVVVPPMLNPIIYGVKTKQIQDRVILLFTPISTCW*
489 >lcl|XP_001498770.1|Plus1complement(48824268..48825878) NW_001867379 suppressor of cytokine signaling 5 SOCS5 __SEG__ Chr15 {Equus caballus} MDKVGKMWNNFKYRCQNLFSHEGGSRSENMDMNSSRCSSVKERNPGVGDSGPQQHSSPLRESVAFQLGLSPSKTSSRRNQNCAAEIPQIVEISIEKDNDSCVTPGTRLAR
RDSYSRHAPWGGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSMHDMDSISSRTVGSRSLRQRLQDTVGLCFPMRTYNKQSKPLFSNKRKIHLSELMLEKCPF
PAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTT
LCLQSRRQKQRQVSGDSHAHVSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFD
AHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK*
490 >lcl|XP_001498860.2|Plus125877943..25878881 NW_001867427 olfactory receptor 51B6-like LOC100068986 __SEG__ Chr7 {Equus caballus} MWINASASSFLLTGFPGMEEAHHWISIPLLVVYISILLGNGTLLFLVRDDHNLHEPMYYFLAMLAATDLGVTLTTMPTVLGILWLNHREIGHGACFSQAYFIHTLSIVES
GVLLAMAYDRFIAICNPLRYTSILTNTRVMKIGMGLLTRAGLSIMPIIIRLHWLPYCRSHILSHAFCLHQDVIKLACADITFNRLYPVVIVFAMVLLDFFIISFSYILIL
KTVMGIASGEERAKALNTCVSHICCILVFYVTVVGLTFIHRFGKHAPRVVHITMSYIYFLFPPFMNPVIYSIKTKQIQSGVIRLFSLPCPRA*
491 >lcl|XP_001498899.2|Plus125916245..25917183 NW_001867427 olfactory receptor 51I2-like LOC100069020 __SEG__ Chr7 {Equus caballus} MGLFNVTHPASFLLTGIPGLESSHSWLAGPLCLMYAVALGGNTVILQAVRVEPSLHEPMYYFLSMLSFSDVAMSMATLPTVLRTFCLNARNIAFDACLIQMFLIHSFSMM
ESGILLAMSFDHYVAICDPLHYATVLTNQVIAGMGLAVTVRSFIILFPLPFLIKRLPICRSNVLSHSYCLHPDMMKLACADITINSIYGLFVLVSTFVMDLLFIFLSYVV
ILHSVLAITSREECLKALNTCVSHILAVLAFYVPMIGVSTVHRFQKHVPRYIHVLMSNIYLFVPPVLNPLMYSAKTKEIRRAIVRMFHRIKM*
492 >lcl|XP_001498925.2|Plus1complement(25935231..25936175) NW_001867427 olfactory receptor 51I2-like LOC100069048 __SEG__ Chr7 {Equus caballus} MGSNPHNSSELPPFTLTGLPGLETSQHWMFLLLGTLYVVSIVGNALILFIIKKEQSLHQPMYYFLSLLSINDLGVSFSTLPTVLATFCLHLRKISFDCCMVQMFFIHFFS
FVESGILLIMSFDRYVAICNPLRYATVLTDTQVARMGISVVIRSFCMVFPLPLLLKRLPFCKANVLSHSYCLHPDLIRLPCGNITVNNIFGLFIVISTFGLDSALILLSY
ILILRSVLAIASWEERLKTLNTCVSHMCAVFIFYVPMVGVSMAARYGRHAPQYVHTLMSLIYLFVPPMLNPVIYSIKTKEIRRRLCKILLGTKF*
493 >lcl|XP_001498952.2|Plus1complement(25946553..25947500) NW_001867427 olfactory receptor 51I2-like LOC100069078 __SEG__ Chr7 {Equus caballus} MGNFKINTSDAPTFILTGFPGMEAMEAWLSVPLLLLYAISIVGNTLILLVVKQEQSLHQPMYCFLSLLSVNDLGVSFSTLPTVLSALCFHAQVIAFNACLAQMFFIHFFS
WTESGILLAMSFDRYVAICNPLRYATILTNAHIMAMCLCTVVRSFAFILVFPLLLHRLSFCHSKNILSHAYCLHVDMIKLACTDVSLNSYYGLSIVLFTFGLDSVLIFIS
YILILRSVLAISSQEERLKALNTCVSHILAVLIFYVPMVSVSIVHRFGAGLPHAVHILMSILYLFVPPMLNPIIYSIKTKEIRHRLLKMFFRSKF*
494 >lcl|XP_001498974.2|Plus1complement(25959291..25960229) NW_001867427 olfactory receptor 51B5-like LOC100069113 __SEG__ Chr7 {Equus caballus} MWPNSSFNSFLLTGFPGLEAAHHWISIPFFLIYISVIFGNGILLFLVKEDRNLHEPMYYFLAMLAATDLAVTLTTMPTVLGVLWLDHREVGNVACFSQSYFIHSLSFVES
GVLLAMAYDRFIAICNPLRYTSILTDTQVVKIGFGVMMRGFVSVVPPILPLYSFPYCHSHVLSHAFCLHQDVIKLACADTTFNRLYPIVLVVLIFVLDSVIILISYVLIL
KSVLRITSREEKAKTLNTCVSHICCVLVFYITVIGLSLIHRFGKQVPHIVHLIMSYVYFLFPPLMNPVIYSAKTKQIQSGILYLFTTHRVGA*
495 >lcl|XP_001499040.3|Plus126036864..26037862 NW_001867427 olfactory receptor 51Q1-like LOC100069212 __SEG__ Chr7 {Equus caballus} MEFLLLNTQILVLHSSSMSEVTNTTQDSFYFILTGIPGLEASHIWISIPFCGLYIISIIGNTTILSAICTEPSLHQPMYLFLSMLALTDLGLTLTTMPTVMQLLWFSIRK
ISFEACFVQFFFLHGFSFMESSVLLAMSFDRYVAICRPLHYATILTNEVIGRIASAMICRCVLAVLPSLFLLKRLPFCDSRLLSHSYCLHQDMIRLVCADIRINSWYGFA
LVLLIIVLDPLLIVLSYTLILKSILGTATWTERLRALNNCLSHVLAVLVLYIPMVGVSMTHRFAKHASPLVHVIMANIYLLAPPVMNPIIYSVKTKQIRHAIFHLLFLRK
VH*
496 >lcl|XP_001499050.2|Plus1complement(4329815..4330753) NW_001867376 olfactory receptor 1F1-like LOC100069220 __SEG__ Chr13 {Equus caballus} MRGANQSSVSEFLLLGLSRQPQQPQLLFMLFLSMYLATVLGNLLILLAISMDSRLHTPMYFFLSNLSFVDICFSSTTVPKMLANHILGTETISFSGCLTQMYFVFMFVDM
DNFLLTVMAYDRFVAVCHPLHYLTKMTPQLCALLVAGSWVIANLNALLHTLLMARLSFCADNAIPHFFCDVTPLLKLSCSDTYLNEVMILTEGALIMITPFVCVLASYVH
ITRAVLRVPSTKGRWKAFSTCGSHLAVVSLFYGTIIAVYFNPLSSHSSEKDTAATVMYTVVTPMLNPFIYSLRNRDLNRALGKVVDRRRFSV*
497 >lcl|XP_001499069.1|Plus1complement(26062279..26063223) NW_001867427 olfactory receptor 51I1-like LOC100069245 __SEG__ Chr7 {Equus caballus} MLGLNGTPFQPATLQLTGIPGLQTGQAWVALIFCILYLISVIGNLSILTLVVREPALHQPMYYFLSMLSLNDLGVSFSTLPTVLATFCFNYRHVAFDACLVQMFFIHTFS
FMESGILLAVSFDRFGAICDPLRYAAVLTNSRILAMGLGILAKSFTTLFPFPFLVKRLPFCKGNVLHHSYCLHPDLMKVACGDIQVNNIYGLFVVVFTYGIDSTFILLSY
TLILRAVLAIASWEQRLKALNTCMSHICAVLAFYVPIIAVSMIHRFWKSAPAVVHVMMSNVYLFVPPMLNPIIYSVKTKEIRRGILKVFFKSQC*
498 >lcl|XP_001499073.2|Plus1complement(4308687..4309640) NW_001867376 olfactory receptor 1F1-like LOC100069249 __SEG__ Chr13 {Equus caballus} MRGANQSSVSEFLLLGLSRQPQQPQLLFMLFLSMYLATVLGNLLILLAISMDSRLHTPMYFFLSNLSFVDICFSSTTVPKMLANHILGTETISFSGCLTQMYFVFMFVDM
DNFLLTVMAYDRFVAVCHPLHYLTKMTPQLCALLVSGSWVIANLDVLLHTLLMARLSFCADNAIPHFFCDATPLLKLSCSDIYLNEMMILIEAGLIMIAPFVCILVSYIL
ITCAVWRVPSTKGRWKAFSTCGSHLAVVFLFYGTIIFLYFNPLFSHSAETDIAAAVMFTVVTPMLNPFIYSLRNKDIRGALGKVVAMKFFLLNNEMG*
499 >lcl|XP_001499121.2|Plus126120217..26121173 NW_001867427 olfactory receptor 52D1-like LOC100069291 __SEG__ Chr7 {Equus caballus} MSASNISDNSLPATLFLTGIPGLEWAHTWIAIPFCAMYLVALAGNASLILVILTDGALHAPMYLFLCLLSLTDLALSSTTVPKMLAILWLQAGEISFGGCLAQMFCVHSI
YALESSVLLAMAFDRYVAICNPMRYTMILNHSIIGRIGLVGIFRSVAVVSPFIFLLRRLPYCQHRVMAHTYCEHMGIARLACANITVNIVYGLTVALLAMGLDSILIAIS
YGFILRAVFHLPSHDAQHKALSTCGSHLGVILVFYIPAFFSFLTHRFGQHRVPKPVHIFLANLYVLVPPVLNPIIYGARTKEIRSRLLRLLHLEKVSL*
500 >lcl|XP_001499131.2|Plus126129143..26130099 NW_001867427 olfactory receptor 52D1-like LOC100069304 __SEG__ Chr7 {Equus caballus} MSASNISDNNLPATLFLTGIPGLEWAHTWIAIPFCAMYLVALAGNVTLIFIIMTDRVLHAPMYIFLCLLSLTDLALSSTTVPKTLAILWLQAGEISFGGCLAQMFCIHSI
YALESSILLAMAFDRYVAICHPLSYTTILNHSIIGRIGLVGIFRSVAVVSPFIFLLRRLPYCQHRVMAHTYCEHMGIARLACANITVNIVYGLTVALLAVGLDSILIAIS
YGFILRAVFHLPSHDAQHKALSTCGSHLGVILVFYIPAFFSFLTHRFGQHRVPKPVHIFLANLYVLVPPVLNPIIYGARTKEIRSRLLRLLHLEKVSL*
501 >lcl|XP_001499183.2|Plus1complement(26169158..26170123) NW_001867427 olfactory receptor 52D1-like LOC100069357 __SEG__ Chr7 {Equus caballus} MELDPALPTLNQTVLISGPGPFVLLGVPGLEALHAWLSVPVCLLYVAALAGNALLLGLVAADKALQAPMYQLLGLLAATDLVLATSTVPKALAVLWGLSGKISFGVCLAQ
VFVAHVAFIAESSVLLAMAVDRYVAIFQPLHYGALLTQRVVGIVAVAAVTRGACVMAPAVVLLHRLPYCGQRALPHTYCEHMGVARLACGDTRPNIWYGLATTLLSSALD
LGLIGTSYARILQAVCRLPSHGARRKALGTCVAHASVITLFYTPTLFSFLAHRFGHHTVPSHIHILLANLYVVVPPALNPVVYGVRTWQIAQRLRHLPLLC*
502 >lcl|XP_001499189.3|Plus1complement(26181126..26182073) NW_001867427 olfactory receptor 52H1-like LOC100069365 __SEG__ Chr7 {Equus caballus} MIIFNVSNYNPATFILVGIPGLEQARVWIGIPFCIIYIVAIVGNCILLYLILVERSLHEPMFFFLSMLAMTDLILSTACVPKTLSIFWFGAQEITFPGCLTQMFFLHYSF
VLDSAILMAMAFDRYVAICSPLRYTTILTPKTIIKIIVGISFRSFCIILPVVFLLTRLPFCRTHVIPHTYCEHIGVARLACADIAINIWYGFCVPIMTVISDVILIAVSY
TLILCAVFRLPSQDALQKALGTCGSHVCVILIFYTPAFFSILAHRFGHNVSRTFHIMFANLYIVVPPALNPIVYGVKTKQIRDKVILLFSAKGTE*
503 >lcl|XP_001499196.3|Plus1complement(26192436..26193383) NW_001867427 olfactory receptor 52H1-like LOC100069376 __SEG__ Chr7 {Equus caballus} MALYNLSSYNKDAFTLLGIPGLEHYHVWISIPFCFIYLAAIVGNSILLYLIAVEHSLHAPMFFFLSTLAVTDLMLSTTCVPKTLTIFWLGPQKISFPGCLTQLFFLHYSF
VLDSAILLAMAFDRYVAICSPLRYTTILTPRTVVKIVVGISFRSFCVFVPCVFLVNHLPFCRTHIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVIIDVILIAVSY
ILILCAVFQLPSRDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPHTFHIVFANLYVIIPPALNPIVYGVKTKQIWDKVILLLFLKGSQ*
504 >lcl|XP_001499198.2|Plus1complement(4184218..4185225) NW_001867376 olfactory receptor 2C1-like LOC100069382 __SEG__ Chr13 {Equus caballus} MEGTNDSSLEGFILLGISDHPQLEIIFFIVILFSYLLTLFGNSTIILLSCLDARLHTPMYFFLSNLSSLDLTFTTSSVPQMLINLWGPDKTISYGGCVIQLYVFLWLGAT
ECILLVVMAFDRYVAICRPLHYTTFMNPWLCWLLAAIAWLGGLGNSVIQSTFTLQLPLCGHRRVDNFLCEVPAMIKLACGDTSLNEAVLNGVCTFFTAVALSIILISYCY
IAQAVLKIRSVEGRRKAFNTCLSHLMVVLFFYGSAIYGYLLPAKTSSQDQGKFISLFYSVVTPMVNPLIYTLRNKEVKGALRRLLGKRSLLRGGKNSIIYSLFISTHFFS
FSLSG*
505 >lcl|XP_001499225.2|Plus1complement(26218820..26219764) NW_001867427 olfactory receptor 52H1-like LOC100069403 __SEG__ Chr7 {Equus caballus} MIIFNVSNYNPATFILVGMPGLEQAHVWIGIPFCTIYIVAIVGNCILLLIMVERSLHEPMFFFLSVLAMTDLILSTACVPKTLSIFWFGAQEIIFPGCLTQMFFHHYSFV
LDSAILMTMAFDRYVAICSPLRYTTILTPKTIIKIVTGISFRSFCIVLPDVFLLTRLPFCRTRIIPHTYCEHIGVARLACANISINIWYGFCVPIMMVISDVILIAVSYT
LILCAVFRLPSREAHQKALGTCGSHVCVILTFYTPAFFSILAHCFGHNVSCTFHIMFANLYIVIPPVLNPIVYGVKTKQIRDKVIDLFSTKGTE*
506 >lcl|XP_001499234.3|Plus1complement(26226531..26227481) NW_001867427 olfactory receptor 52H1-like LOC100069414 __SEG__ Chr7 {Equus caballus} MMATLNFTSFNPGSFILVGIPGLEHFHIWIGIPFFAIYLVALAGNGVLLYLITMDSSLHEPMFFFLSMLASADLILCTTCVPKILGIFWLNAQEITFPGCLTQLFFLHFS
FFLDSAILLGMAFDHYMAICSPLRYTSILTPKRIVKIMVGIAGRSFSVILPVVFLVKRLPFCRTRIILHTYCEHIGVARLACADISINIWYGFAVPVMTIISDLILIGIS
YILILHAVFHLPSRDARQKALSTCGSHVSVILIFYTPAIFSVLTHRFGHSISRTFHILFANLYVAIPPALNPIIYGVKTKQIREKVIFLFFPKGMH*
507 >lcl|XP_001499244.2|Plus126237349..26238359 NW_001867427 olfactory receptor 52B6-like LOC100069426 __SEG__ Chr7 {Equus caballus} MAQVRALKEIMALLSANSTAAVNSSDTRMAGCLLIGIPGLEHLHTWLSIPFCTMYVAALAGNSILICVILSQPSLHEPMYIFLSMLASADVLLSTSTMPKALANFWLGSS
HISFDGCLTQMFFIHFLFVADSAVLLAMAFDRYVAICSPLQYAIILTNTVIGKIVAATLIRSFIIMFPSIFLLKRLHYCRINIITHTFCEHMGIARLSCSDISINVWYGL
AAALLSTGLDIILIAVSYIHILRAVFHLPSRDARSKALSTCSSHVCVILVFYIPALFSVFAYRFGERRIPRYIHILLANLYVVVPPMLNPIIYGMRTQQILEGAKQMFSN
LAKKSR*
508 >lcl|XP_001499325.1|Plus126568519..26569460 NW_001867427 olfactory receptor 52H1-like LOC100069529 __SEG__ Chr7 {Equus caballus} MYNFSCYNPGSFILVGIPGLEKFHIWIGIPFCVIYVVAIVGNCVLLYLIAVEHSLHEPMFFFLSMLATTDLILSTATVPKVLSNLWLGSQEITFSGCLTQMFFLHFSFVV
DSAILLAMAFDRYVAICFPLRYTTILTPQVMIKLVVSIAVRSFSIILPDIFLLKRLPFCGTHIIPHTYCEHIGVARLSSADISINIWYGFSVPLMTVISDVIFIAVSYSF
ILHAVFQLSSQGARQKALSTCGSHVCVILIFYTPAFFSILAHRFGHSVPRNVLILFANLYVAIPPALNPIVYGVKTQQILDKFNLCCSLNKKQ*
509 >lcl|XP_001499337.2|Plus126580120..26581070 NW_001867427 olfactory receptor 52H1-like LOC100069540 __SEG__ Chr7 {Equus caballus} MMATFNLSSFNSGPFILLGIPGLEQFHIWIGIPFFIIHLVALVSNSALLYLIYMERRLHEPMFFFLSILAATDLILSNTCVPKTFSIFWIGPQEITFPGCLTQMFFLHYS
FAMDSAILLAMAFDRYVAICFPLRYTTILTRQIITKIVIGIVSRSFCIIFPCVFLLKRLPFCQTLIIPHTYCEHIGVAQLACADISINIWYGFAVPIVTVTSDLILIGIS
YALILHTIFNLPSQDARWKALNTCGSHVCVILIFYTPAMFSVLTHRFGHNIPHSFHILIANLYVAIPPALNPIIYGVKTKDIREKIILLFFLRGTK*
510 >lcl|XP_001499370.1|Plus1complement(26629850..26630977) NW_001867427 putative olfactory receptor 52P1-like LOC100069580 __SEG__ Chr7 {Equus caballus} MLIFNHSSFTTFTLVGIPGLESQHLWLSLSFFSMFLAILICNGAILFLVATDPTLHTPMYLLLALLMVADLISTLALLPKLLCLFWFNHRDITSNACFTQMFFIHGASVV
RSALLVAMAFDRFVAVCEPLHYNTILSHSLVGRLGLAALAKGVILILPMPLLLQRLTFCHVVIPHTYCDHMAVVKMACDHTRPNRIYGLFVILIVVGLDMLLIGFSYGLI
LQAVVHLNSRDATCKALNACSAHLFVILVTYVPALFSSFTHRIGHNIPPHAHILLANLYLLLPSMLNPIIYGIKMKEMRDKVAKYLCRGTTWAVGPGNIPVSKRPMRTAD
NAFTQPSKIQLYSKMSCRKNRPWSSILFCFLAYMKDQFVCTFIEL*
511 >lcl|XP_001499385.1|Plus126065614..26067272 NW_001867386 inositol 1,4,5-triphosphate receptor-interacting protein-like LOC100069597 __SEG__ Chr1 {Equus caballus} MALGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALEPVAEEGQQQNESRVAWDLWSTLCMILFLVIEVWRQDHQDG
PSPECLGGDEDELPGLQGAPLRGLTLPNKATLDHFYERCIRGATADAARTREFVEGFVDDLLEALRSLCNRDTDMEVEDFIGVDSMYENWQVDKPLLCNLFVPFMPPEPF
HFHPELWCSSRSVPLDRQGYGQIKVVRADEDTRGCICGKTKLGEDMLCLLHGKNNLLQPGREVKDPLCARDSPYLDTMQVMKWFQMALTRAWHRIAHKYEFDLAFGQLET
PGSLKIKFRSGKFMPFNLIPVIQCDDSDLYFVSYLAREPSGGTPASSTDWLLSFAVYERHFLRMTSKALPEGACHLSCLQIASFLLSKQSRLTGPSGLGNYHLKTALLHL
LLARRAADWKAGQLDARLQELLCFVEKSLLEKKLHHFFIGNRKVPEAMGLPEAVRRAEPLNLFRPFVLQRRLYRKTVDSFYEMLKNAPALINEYSVHIPSDHASLPQKAV
IL*
512 >lcl|XP_001499423.2|Plus126683572..26684561 NW_001867427 olfactory receptor 52N4-like LOC100069636 __SEG__ Chr7 {Equus caballus} MLMLNKTDLSPASFILDGVPGLEDTHLWVSFPFCSMYVVAMVGNCGLLYLICCDDSLHKPMFYFLALLSLTDLVMCSSTIPKALCIFWFHLKEIGFEECLVQMFFIHTFT
GMESGVLMLMALDRYIAICYPLRYSTILTNPVIAKVGLATFLRGVLLIIPFIFLTKRLPYCRGHVIPHTYCDHMSVAKLSCGNVKVNAIYGLLVALLIGGFDILCITVSY
TMILRAVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGSHTIPPSCHIIVANVYLLLPPTMNPIVYGVKTKQIRDCVIRILSSSKDTKSHGISVSIFQDR*
513 >lcl|XP_001499439.1|Plus1complement(39568653..39569735) NW_001867435 G-protein coupled receptor 20-like LOC100069651 __SEG__ Chr9 {Equus caballus} MPSASTAGPLALAAPNATVAAAAWANSSAPEVPLFHLFALLDEELHAAFPGLWLALVVVHGVIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRF
AVFYGTRGCLRCAFPHVFSYFLNMHCSILFLTCICVDRYLAIVQPDGSRRWRQPACARVVCALVWLAAGAVTLSVLGVTAGGRPCCHIFALTVLEFLLPLLVISVFTGRI
VCALSRPGLLRQGRQRRVRAMQLLLTVLVIFLVCFTPFHARQVAVALWPDVPRQASLVVYHVAVTLSSLNSCMDPIVYCFVTSSFQATVRGLFRWRGAEGEPSIGHAVSM
HKSSKASGQPRILSTGPGALTQALTNGPEA*
514 >lcl|XP_001499486.2|Plus1complement(34522814..34524076) NW_001867399 somatostatin receptor type 3-like LOC100069706 __SEG__ Chr28 {Equus caballus} MDTPSYASSVPMTSEPGNTSSAWPLDVTLGNVSSDPSTTGLAISGVLIPLVYLVVCVVGLLGNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYW
PFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSVAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPL
LVICLCYLLIVVKVRSAGRRVRAPSCQRRCSERRVTRMVVAVVALFVLCWMPFYVLNIINVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLLR
PSRRVRSQEPPEGPPEKTEEEEEDGQKDGEEGAGKQGQRKGKKDRVSRITQPGTRGQERPASSTAGKEQLFLPQEPSAGEKSGTLHISYL*
515 >lcl|XP_001499489.2|Plus128632072..28632998 NW_001867389 olfactory receptor 12D2-like isoform 1 LOC100051972 __SEG__ Chr20 {Equus caballus} MLNQTSVTEFLLLGITDIQVLQPFFFVVFLAVYFVNVAGNGAILMVVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLQNFLSTHKAISFSECISQLHFFHFLGSTEA
MLLGVMAFDRFVAICKPLHYPLIMNHQLCTQMAITIWTIGFFHALLHSIMTSRLNFCGSNHIHHFFCDVKPLLELACGNTELNQWLLNTVTATLGMGPFFLTLLSYFYII
IYLFFKTHSCSLLHKALSTCASHFMVVILFYAPVVFTYIRPASRSSMDQDRVIAIMYSVVTPVLNPLIYTLRNKEVKGALRRVIRMRL*
516 >lcl|XP_001499553.2|Plus11376096..1377040 NW_001867390 olfactory receptor 2Z1-like LOC100069770 __SEG__ Chr21 {Equus caballus} MGESNLSVTSDFTLMGLFSHSGPPLVLFSLVVTIFTVGLLGNAILLFLICTDSRLHTPMYFLLSQLSLLDVGFPLVTIPKMAVDFLQGESSISFQGCGAQMFFLMLMGVS
EGVVLSFMSYDRYVAVCHPLHYPLLMRRQVCLLMMGTSWLSGVLVACIQTSIILHFPYCASRAVDHFFCELPALLKLSCADTSAYDLALSISGVLILLLPLSLIATSYSQ
VLGAIFRMHSAEARHKAFTTCSSHIAVVGLFYGAAVFMYMVPGTYHSPQQDNVVSLFYSLVTPTLNPLIYSLRNREVRMALVKVLDRAGFRSKR*
517 >lcl|XP_001499561.2|Plus11402895..1403836 NW_001867390 olfactory receptor 1F1-like LOC100069781 __SEG__ Chr21 {Equus caballus} MEGANLTWVSEFLLLGLSEDPKQQQLLFILFLSVYLVTGLGNLLIVLVITSDIRLHTPMYFFLANLAFVDICFTSTTIPKMLANHVSGHKGIPSAGCLTQIFFFIWFAGI
DSFLLTAMAYDRYAAICHPLHYATSVTPQLCGLLVAASWTAAFGNALTHTVLLTRLSFCSHNRVPHFFCDLSPLLKLACSDIFLNNAMVYTVGALSVIAPFVGILVSYTH
IFAAVLRIPSTRGKRKAFSTCGSHLCVVSLFYGTLIGVYFSPTSSHTAQKDTAAAVMYSVVTPMLNPFIYSLRNNDMKSALGALISKRPVFIQ*
518 >lcl|XP_001499568.2|Plus1complement(26962833..26963828) NW_001867427 olfactory receptor 52L1-like LOC100069788 __SEG__ Chr7 {Equus caballus} MLLVSFPSSLSEPLMMALSNSSRRLLQPSFFLIGIPGLEESQHWIALPLCVLYLLALVGNVTIIFIILTDSSLHHPMYLFLAMLSGIDLVLSSSTAPKTLAVLLAHAHEI
GYTDCLIQMFFIHAFSSMESGVLVAMALDRYVAICHPLHHSTILHPGLIGRIGMAVLVRGFLLLLPFPILLRRLVFCQTTVIGHAYCEHMAVVKLACSETTVNQAYGLAV
ALLVIGLDVLVIGISYALILQTVLNVPGGEAQLKAFSTCGSHICVILVFYVPGIFSFLTHRVGHHVPHHVHVLLATLYLLVPPALNPLVYGVKTQQIRQRVLRVFYTKGW
I*
519 >lcl|XP_001499581.2|Plus1complement(2454570..2455508) NW_001867427 olfactory receptor 7D4-like isoform 2 LOC100055475 __SEG__ Chr7 {Equus caballus} MGAGNHTEVSDFLLLGLSEDPELQTLIFGLLLSMYLVTVFGNLLIILIISCDSHLHTPMYFFLFNLSFVDICFTSTTVPKMLVNIQTQSKTISYVGCFTQIYFFMIFAGL
DGFLLTVMAYDRFVAICHPLYYMVIMNPRLCGLLVLMCWFIIFWVSLLHILLLRQLNFCIGTEIPHFFCELAQVLKLACSDTFINNIVLYVATALLGVFPLVGILFSYSQ
IVSSLMGMSSAEGKYKAFSTCGSHLSAVSLYYGTSLGVYFGSAATHSSQRSSIASVMYTVVTPMLNPFIYSLRNKDVKRALGRLLCQAASCP*
520 >lcl|XP_001499631.2|Plus1complement(27021078..27022046) NW_001867427 olfactory receptor 52B2-like LOC100069860 __SEG__ Chr7 {Equus caballus} MTHANLTIFHPAVFALLGIPGLEAHHIWLSIPLCLMYITAVLGNSILIMVIITERNLHEPMYFFLSMLAITDILLSTTTVPKALAIFWLHAHDIAFDACVTQVFFVHMMF
VGESAILLAMAFDRFVAICAPLHYTTVLTWPIVGRIALAIVTRSFCIIFPVIFLLKRLPFCRTNIIPHSYCEHIGVARLACSDITINIWYGFSVPIVMVILDVILITVSY
SLILRAVFHLPSQDARHKALSTCGSHLCVILMFYVPSFFTLLTHRFGHNIPLHVHILLANLYVVVPPMLNPIVYGVKTKQIREGVAHWFFDIKAWCCASLPG*
521 >lcl|XP_001499731.3|Plus1complement(23613278..23616004) NW_001867402 toll-like receptor 12-like LOC100069988 __SEG__ Chr2 {Equus caballus} MGMCLLLPGLFLSLPLTTGWTASNCLVTEGSRLPLVSRFFLTCPTDSRLHLLAACSSVTNLTQALEAVPQNVEGLCLAGSTSVLHPDAFSLFPGLKLLGLSLHLTQLLPG
ALRGLGQLQQLFFISRQKDYLFLPPEAFSNLSSLQYLAFLGPCLDGNLGVRLPPSLQRLAIKFSCLQNVGKLADIFPDLVFGPSSGDARTLDMLDLSFNNQLKMASPGAL
QGLKLGTLLLDHTKMEAAAVGGLGLQRLDTLSAMYTATAELPAVAVAHFELEELNLGSTPLGHIALEALASCYSLRSLGLKSSGLTDLPSGFLAAMPRLQRLNLASNQLR
SAMLCTNETGAVSGLQVLDLSQNGLRTLPPAAFSCLPHLRELLLQGNQLVCLEGQVFQGLRRLEMLDLGRNPLEALGEDWLAPLPALTTLNLLDTHMVLSSAWVFRGPEN
LHDLRLQLPSGPSRVALPLPVRLTSLELHAISGREHWKLASNIFPVLQTLTLKGWGLQLKTQNVTEIFPALRQLSLLGNSLEALCSQDNSSYFLWQLPGLQYLRVQGDGH
SSRPCCITGLPSLRELKLQAVQSRARPRLVRLEELVGELPSLEVLYLAQTGLETLSAAAFQGLGSLQVLVLDWETGLVLDSSLQEHSPQMPQYMYILSASLACQCANAWV
GPWHERSPRTYMHVVSQLCHSEAGGRLKNPLFPFLQSHCPTTVGLELFLGSSALLLLLISLPLLQEARNSWILYLQALLRAWLQGLKCRRSEGKRFLYDVFVSHCGQDEG
WVVWELLPALEGCRPAGQGLRLCLPERDFEPGKDVTDNVADSMASSRVVLCVLSRQALRTPRCCLELRLATSLLLAAPRPPGLLLVFLEPVSRHQLPRYHRLARLLRRGD
YCMWPKEDERKAEFWAWLRSRLRQLGLG*
522 >lcl|XP_001499860.2|Plus127641824..27642768 NW_001867427 olfactory receptor 2AG2-like LOC100070134 __SEG__ Chr7 {Equus caballus} MEHWNSTLESGFILMGILNDSGSPKLLCATITVLYMLALTSNILLLLVITMDARLHVPMYLLLGQLSLMDLLFTSVVTPKAIVDFLRCANTISFGGCALQLFLALMLGSA
EDLLLAFMAYDRYVAICYPLNYMVLMSPRVCWLMVTTSWILAFLCALGHTMYTMHFPFCKSRKISHLLCEIPPLLKLACADASRYELMVYVTGVTFLLLPLSVIVASYSL
ILLTVLHIPSNEGRQKALVTCSSHLTVVGMFYGAATFMYVLPSSLHSPKQDNIISVFYTIVTPALNPLIYSLRNKEVMGALIRVLGKYMLLTHS*
523 >lcl|XP_001499876.2|Plus1complement(27662737..27663660) NW_001867427 olfactory receptor 2D3-like LOC100070156 __SEG__ Chr7 {Equus caballus} MGEENQTYVTEFVFLGLSQDPQTQVLLFFLFLIIYMLTVLGNLLIIVLIHTDSRLHTPMYCFLRNLSFADLCFSTTTVPQVLAHLLVKRKTISFAGCSIQIVVLLLVGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTHWVCVQLAIGSWAIGALGSLVDTIFTLSLPYRGNNVINHFFCEPPALLKLASADTYSTEMVIFVMGVVILLAPVSLILVSYWN
IISTVIQMQSGEGSLKVFSTCGSHLIVVVLFYGSAIFAYMRPNSKIMNERDKMISVFYSAVTPMLNPIIYSLRNKDVKDALRRVTAK*
524 >lcl|XP_001499885.2|Plus1complement(27676274..27677197) NW_001867427 olfactory receptor 2D3-like LOC100070169 __SEG__ Chr7 {Equus caballus} MGTENQTCFTEFILLGLSSDQQTQILLFVVFLTFYLLTLFGNLLIIVLIHVDSRLHTPMYFFLKNLSFTDLCFSTTIIPQMLFHLLVTRKTISFARCSIQMIVFLVAGCT
ESSLLAVMSYDRYVAVCKPLHYSTFMTHRICVHLAIGSWASGAFVSLVDTTFTLCLSYHRQNVINHYFCEPPALLKLASEETYKAEMAISSMGVLILLGPLSFILFSYWN
IISTVVRIQSGKRRLKIFSTCGSHLIVVVFFYGSTIFTYMRPNSKKMNERDKVVSVFYSVITSMMNPFIYSLRNKDVKEAFRKVFGR*
525 >lcl|XP_001499903.2|Plus1complement(27725008..27725952) NW_001867427 olfactory receptor 6-like LOC100070187 __SEG__ Chr7 {Equus caballus} MLEENITLVSEFILVGFPTAPWLQVLLFFLFLVVYLLVVVENLVIMLTVWVTGSLHKPMYYFLSSLSFLEVWYVSVTVPKMLDGFLLRRRHISFTGCMTQLYFFISLACT
ECVLLAAMAYDRYVAICHPLQYSVIMTTGYCVQLVAFSYMTGFMITMIKVYFISNVTFCGSNVMNHFFCDISPILKLACKDMSTAELVDFALAIVILVFPLTTTVFSYVY
IVSTILHIPSSQGRKKAFSTCASHLTVVIIYYTAMIFMYVRPRAIASFNSNKLISAVYAVLAPMLNPFIYCLRNQEVKNAIKKTVGVVQCLLLS*
526 >lcl|XP_001499946.1|Plus115338592..15339680 NW_001867422 c-X-C chemokine receptor type 7 CXCR7 __SEG__ Chr6 {Equus caballus} MDLHLFDYPEPANFSDMSWPCNSSDCIGVDMVLCPNMPNKSILLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVVTIPVWVVSLVQHNQW
PMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFNNTSSRKKKIARRAVCVLVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSVKEWLISMELVSVVLG
FAIPFSVIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHIVVLLDIFSILHYIPFTCQLENFLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAF
IFKYSAKTGLTKLIDASRVSETEYSALEQSTK*
527 >lcl|XP_001499998.2|Plus127985199..27986149 NW_001867427 olfactory receptor 2AG2-like LOC100070293 __SEG__ Chr7 {Equus caballus} MERWNSTRGSGFILTGIRNDSGSPELLCATVAVLYMLALTSNGLLLLVITMDAQLCVPMYLLLRQLSLMDLLFTSVVTPKAIVDFLRGENTISFGGCALQMFLALMLGGA
EDLLLAFMAYDRYVAICHPLNYMVLMRPRICWLMAATSWILASLSALGHTLYTMHFPFCASRKIRHLLCEIPPLLNLACADTSRYEFLVYVTGVTFLLFPLSIIAASYTL
ILLTVFHMPSNEGRQKALVTCSSHLSVVGMFYGAATFMYVLPSSLHSPKQDNIISLFYTIVTPALNPLIYSLRNKEVMGALRRILSKNVLLTYSNI*
528 >lcl|XP_001500019.2|Plus128002825..28003775 NW_001867427 olfactory receptor 2AG1-like LOC100070314 __SEG__ Chr7 {Equus caballus} MERWNSTRGSGFILVGILNDSGSPELLCATVAVLYMLALTSNGLLLLVITVDARLHVPMYLLLRQLSLMDLLFTSVVTPKAIVDFLRGENTISFGGCALQLFLALMLGGA
EDLLLAFMAYDRYVAICHPLNYMVLMRPRVGRLMMATSWILASLSALAYTWYAMHYPFCKARKIRHLLCEIPPLLKLACADTSRYELTVYVMGVTFLMPPLVAILASYTL
ILFTVLHIPSNDGRQKALITCSSHLTVVGMFYGAATFMYVQPSSLHSPKQDNIISVFYTIVTPALNPLIYSLRNEEVMGALRRVLGKYMLPTQSTI*
529 >lcl|XP_001500026.2|Plus1complement(22386397..22387767) NW_001867404 neuropeptide Y receptor type 5 NPY5R __SEG__ Chr2 {Equus caballus} MSFYSKQDYNMDLELKDYYNKTLATENSTAATRNADFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMRKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLT
SVLLDQWMFGRVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIA
FTISLLLVQYILPLVCLTVSHTSVCRSVSCGLSNKENKLEENEMINLTLHPSKKRGPQEKLSNSQKWSYSFIRKHRRRYSKKTACVLPAPARPLQENHSRTLPENFGSVK
TQLSSSSKFIPGVPTCFEMKPEENSDGHEMRVNRSIMRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNN
GIKADLMSLIHCLHMS*
530 >lcl|XP_001500032.2|Plus1complement(28011358..28012287) NW_001867427 olfactory receptor 2D3-like LOC100070325 __SEG__ Chr7 {Equus caballus} MGEENQTSVTEFVFLGLSQDPQIQVLLFFLFLILYVLTVLGNLLIIVLTHIDSRLHTPMYFFLRNLSFADLCFSTTTVPQVLVHFLAKRKTISFAGCSIQLVVLLLVGGT
EGALLAVMSYDRYVAVCKPLHYSTIMTHWVCVQLAIGSWAIGALGSLVDTIFTLHLPYRGNNVINHFFCEPPALLKLASADTYSTEMAIFVMGVLILLTPVSLILVSYWN
IISTVIQMQSGESRLKVFSTCGSHLIVVVLFYGSGIFAYMRPYSKIMNERDKMISVFYSAVTPMLNPIIYSLRNKDVKCALRRVTTKSF*
531 >lcl|XP_001500062.2|Plus1complement(28048078..28049034) NW_001867427 olfactory receptor 6-like LOC100070356 __SEG__ Chr7 {Equus caballus} MWKKNITHISELILVGFPTSPWLQVLLFLLFLITYLFVLLENLVIILTVWVTGSLHKPMYYFLGTMSFLETWYISVTVPKMLTGFLLRPNTISFLGCMTQLYFFISLACT
ECVLLAAMAYDRYVAICLPLRYPVIMTTGFCIQLTISSWVSGFTISMAKVYFISQVAFCGNNILNHFFCDVSPILKLACTDFSMAELVDFALAIIILVFPLSATVLSYVF
IVSTILHIPSATGQWKAFSTCASHLTVVVIFYTAVIFMYVRPRAITSFNSNKLISVIYAVFTPMLNPIIYCLRNKDVKDAIRKTMASGRSLFLRDSLC*
532 >lcl|XP_001500074.2|Plus1complement(28068952..28069893) NW_001867427 olfactory receptor 6-like LOC100070370 __SEG__ Chr7 {Equus caballus} MLEENITLVSEFILVGFPTAPWLQVLLFFLFLVVYLLVAVENLVIMLAVWVTGSLHKPMYYFLSSLSFLEVWYVSVTVPKMLDGFLLQRRHISFTGCMTQLYFFISLACT
ECVLLAAMAYDRYVAICHPLRYPVIMTTGYCAQLVTSSYMTGFMVSVIKVCFISHVTFCGSNVMNHFFCDISPILKLACKDMSTAELVDFALAIFILVFPLTTTVLSYVY
IVSTILRIPSTQGRKKAFSTCASHLTVVIIYYTAMIFMYVRPRAIASFNSNKLISAVYAVLTPMLNPFIYCLRNQEVKNAIKKTVGFRGWPRG*
533 >lcl|XP_001500094.3|Plus128118752..28119711 NW_001867427 olfactory receptor 10A5-like LOC100070392 __SEG__ Chr7 {Equus caballus} MSMAEGNWTKVNEFILMSFSSLPAKIQSLLFLTFLIIYLVTLMGNSLIILVTLADPVLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFFFFF
GVAECFLLATMAYDRYVAICNPLHYPVIMNQRTRAKLAVASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCS
YTCIAAAILNIPSAKGKHRAFSTCSSHLLVVSLFYVSSSLTYFRPKSNNSPKSKKLLSLSYTVVTPMLNPIIYSLRNNEVKNALSRTFRKALGLRNCIP*
534 >lcl|XP_001500103.2|Plus128155437..28156390 NW_001867427 olfactory receptor 10A5-like LOC100070398 __SEG__ Chr7 {Equus caballus} MAEGNWTRVNEFILMSFSSLPAKIQSLLFLTFLIIYLVTLMGNNLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFFFFFGV
AECFLLATMAYDRYVAICNPLHYPVIMNQRTRAKLAVASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYT
CISAAILKIPSAKGKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNNEVKNALSRTFRKALGLRNCIP*
535 >lcl|XP_001500116.2|Plus128167444..28168391 NW_001867427 olfactory receptor 10A4-like LOC100070409 __SEG__ Chr7 {Equus caballus} MTWGNWTIVSEFVLVSFSALSSELQALLFLLFLTIYLVTLMGNVLIILVTTADSSLQSPMYFFLRNLSFLEIGFNLVIVPKMLGTLIIQGTTISFLGCATQMYFFFFFGA
AECCLLATMAYDRYVAICDPLRYPVIMGHRACAQLATASWFSGFPVATVQTTWIFSFPFCGPNRVNHFFCDSPPVIALVCADTSLFELEALTATVLFILLPFLLILGSYV
RILSTIFRMPSAEGKRKAFSTCSSHLLVVSLFYSTAILTYFRPRSSNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKAALRRVIRRTLDPQKL*
536 >lcl|XP_001500126.2|Plus1complement(28170654..28171601) NW_001867427 olfactory receptor 2D2-like LOC100070417 __SEG__ Chr7 {Equus caballus} MTQTNQTQVTEFLLLGLSDDPHTQQLLFILFLGVYLVAVLGNLLLMSLVQVDSQLHTPMYFFLFNLSLADLCFSTNIVPQALAHLLSRKKPISFTRCAAQLLLFLIFGCT
QCALLAVMSYDRYVAICNPLHYPSIMTWRVCARLAAGSWVIGVLVSLVDTTFTLKLPYQGCNSIAHFFCEAPALLILASTDTRTSEMVIFLMGVMILLIPVSLILISYGR
IIETVVRMKAAEGRLKAFSTCGAHLMVVILFYGSGIVMYMTPKSSEEQEKLVSVFYAMVTPMLDPLIYSLRNRDVKAALRKVATRNIPCRLGIFH*
537 >lcl|XP_001500129.3|Plus1complement(28371632..28372081) NW_001867401 calmodulin-like protein 3-like LOC100070422 __SEG__ Chr29 {Equus caballus} MADELTEEQVAVFREAFALFDKDGDGIITTQELGTVMRSLGQSPTEAELQGMVSKVDHDGNRTVDFPEFLDMMAKKMKDRDSEEEIREAFRMFDKDGNGFISTAELRHMT
TRLGEKLTKEEVDKMIRAADVDGDGQVNYEEFVRMLVPK*
538 >lcl|XP_001500160.2|Plus128218044..28218988 NW_001867427 olfactory receptor 2D3-like LOC100070453 __SEG__ Chr7 {Equus caballus} MGEENQSFVAEFIFLGLSQDWQTQILLFVLFLSIYLLTVLGNLLIIILIFVDSQLHTPMYFFLRNLSFADLCFSTSIVPQLLVHFMVKKKTISFLGCMTQIIVFLLVGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTQQMCLQLTIGSWVSGALVSLVDTTFTFQLPYGGQNIINHYFCEPPALLKLASADTYSTEMAIFAMGVLILLAPVSLILVSYWN
IISTVIQMQSGEGTLKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTTKEQDKMISVFYTVVTPMLNPIIYSLKNKDVKRALRKLAGRKSFSQRQ*
539 >lcl|XP_001500169.2|Plus1complement(12233526..12234533) NW_001877047 glucose-dependent insulinotropic receptor-like LOC100054460 __SEG__ ChrX {Equus caballus} MESSFLFGVILAGLASLIIAANALVAIAVLLLIHKNDGAGLCFTLNLAVADALLGVAISGLVTDQLSTPAQPTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQP
LRYLQIMNGLVAGACIAGLWLLSYFIGFLPLGVPIFQQTTYHSPCTFFAVFHPLFVLILSCIGFFPALLLFVFFYCDMLKVASMHSQQIRKMEHAGATARTYRPPRTPSD
FKAVRTVAVLIGTFTLSWTPFLITSIVQVACQECRLYTVLEQYLWLLGVSNSLLNPLIYAYWQKEVRQQLYQMALGVKKRLTSFLLLLLARDGAPEGPRESSYHIATISH
AQLDG*
540 >lcl|XP_001500330.2|Plus128915369..28916307 NW_001867427 olfactory receptor 481-like LOC100070611 __SEG__ Chr7 {Equus caballus} METENHTTVTEFIILGLTDNPTLRAIFFVIFLGVYIVTIVGNISIIILIRSSPQLHTPMYLFLSHLAFVDIGYSTSVTPIMLMSFLRERTTIPVAGCIAQLGSDVTFGTT
ECFLLATMAYDRYVAICSPLLYSTQMSPVVCFLLLGASYLGGCMNASSFTGCLMNLSFCGPNKINHFFCDLFPLLKLSCGHVYIAEISPAISSASVLISTLFTIIVSYSY
ILHSILNMRSTEGRKKAFSTCTSHLTAVTLFYGTVLFVYVMPKSSYSADQVKVTSVIYTVVVPMLNPLIYSLRNKEVKEAMRKLMSRTRCFS*
541 >lcl|XP_001500357.2|Plus128950398..28951342 NW_001867427 olfactory receptor 478-like LOC100070635 __SEG__ Chr7 {Equus caballus} MDALGDGNHTSTTGFILLGLTNDPILRIILFMIILCIYLVTISGNLSAIILIRISSQLHHPMYFFLSHLALADIGYSSSVTPNMLVNFLVGRNTISYFGCATQLGSVVFF
GTAEFFLLAAMAYDRFVAICSPLLYSTKMSTEVCVQLLVVAYIGGFLNACSFTICFYSLVFCGPNRVNHFFCDFAPLVELSCSDISIPAVVPSVTAGSVTVATVFVIVIS
YIYILITILKMRSTEGRHKAFSTCTSHLTVVTLFYGTITYIYVVPKSSYSTDQNKVVSVFYMVVIPTLNPLIYSLRNNEIKGALKRELARKIFS*
542 >lcl|XP_001500369.1|Plus141307830..41308738 NW_001867413 probable G-protein coupled receptor 141-like LOC100070650 __SEG__ Chr4 {Equus caballus} MANHSNSSCNPLPTASLTGLYCVVLIGGLVGIISILFLLVKMNTRSVTTTAVINLVVIHSVFLLTVPFRLIYLIENTWGFGLPFCKFVSAMLHIHMYLTFLFYVVILVIR
YLIFFKRKDKVEFYRKLHAVAASTGLWLLVIVIVVPLIFSHYGTSEMYDEEDCFGFHKELNHVYAQVVNYMIVTIVIAIAVILLVFQIFIIVSMVRKLRHSLLSHQEFWA
QLKNLFFIGVIFVCFLPYHFFRIYYLHAVAHSGECINSVASYNEIFLSVTAISCFDLLLFVLGGSHWFKQKIIDLWNCLLCH*
543 >lcl|XP_001500371.2|Plus128972807..28973751 NW_001867427 olfactory receptor 502-like LOC100070651 __SEG__ Chr7 {Equus caballus} MDALGDGNHTEVTGFILLGLTDDPILQVILFMIILCIYLVTISGNLGTIIIIRISSQLHHPMYVFLSHVAFADMGYSSSVTPNMLVNFLLGRNTISYLGCGIQLGSAVFF
GSVECFLLAAMAYDRFVAICSPLLYSTKMSTQVYVQLLIVAYVGGFLNACSFTICFYSLVFCGPNRVNHFFCDFAPLVELSCSDISIPAVVPSFTAGSIIVVTVFVIAVS
YIYILITILKMRSTEGRHKAFFTCTSHLTVVTLYYGTITFIYVMPKSYYSTDENKVVSVFYMVVIPMLNPLIYSLRSNEIKGALKRELARKICS*
544 >lcl|XP_001500388.2|Plus1complement(28992536..28993498) NW_001867427 olfactory receptor 10R2-like LOC100070671 __SEG__ Chr7 {Equus caballus} MGNCTTVSTFLLWGFSSFPELQSLLFVVILFSHMTILTANVSIMMAVKLSHNLHTPMYFFLCGLSFSETCTTMVILPRMLVDLLSDNKTISLPECATQMFFFFGFSNNNC
FTMVVMSYDRYTAIHNPLHYAVRMSQKVCFQLMMASWMVGFLVSLCVVITVFNLSFYDSNIIPHFCDISPVVSLACDYTLYHEMAIFVLSAFVLVGSFILIMISYVFIGS
IILKMPSAKGKYKAFSTCSSHLTVVCIHYGFACFVYLRSKDSDSVLEDMPMAVAYTVLTPLLNPIVYSLRNKDIQVALMKVVDNAIRFISQTVNKRNLNI*
545 >lcl|XP_001500405.2|Plus1complement(29041100..29042044) NW_001867427 olfactory receptor 502-like LOC100070687 __SEG__ Chr7 {Equus caballus} MDSLGEGNHTEVTGFILLGLTDDPILQVILFMIILCIYLVTVSGNFSTIILIRISSQLHHPMYFFLSHLAFADMGLSSSVTPNILVNFLVERNTISYLGCANQLGSVIFF
GTVECFLLAAMAYDRFVAICSPLLYSTKMSTQVYVQLLVVAYVGGFLNACSFTVCFYSLVFCGPNQVNHFFCDFAPLVELSCSDISIPAAVPSFTSGSIIVVTVFVIAVS
YIYILITILKMRSTEGRHKAFSTCTSHLTAVTLYYGTVTFIYVMPKSCYSTNQNKVVSVFYMMVVPMLNPLIYSLRNNEIKGALKRELARKTFS*
546 >lcl|XP_001500412.2|Plus129056800..29057729 NW_001867427 olfactory receptor 491-like LOC100070697 __SEG__ Chr7 {Equus caballus} MVGNHTSVTEFIILGLTKDPTLCAIFFVIFLGIYVVTLAGNISIITLIRSCSQLHTPMYLFLSHLAFVDIGFSTSITPLMLVGFLGHGIALPFAGCEAQLCFGVTFGTAE
CFLLAAMAYDRYVAIYSPLFYSTRMSPRICILFVGASYLGGCVNAWTFTSCLLSLSFCGPNQIDHFFCDFSPLLKLACSDISIIQIIPSISSGSIIVVTVFVIALSYVCI
LITILKMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSGYSTDQNKVVSLFYTVVIPMLNPLIYSLRNRDVKEALRKTIVGIYS*
547 >lcl|XP_001500431.2|Plus1complement(29084357..29085301) NW_001867427 olfactory receptor 502-like LOC100070716 __SEG__ Chr7 {Equus caballus} MDALGDRNHTAVTGFILLGLTDDPILRVILFIIILCIYLVTISGNLNTIILIRISSQLHHPMYFFLSHLAFVDMGYSSSVTPYMLINFLVERNTISYFGCGIQLGSATFF
GTVESFLLAAMAYDRFVAVCNPLLYSTKMSTQVCVQLLIVAYVGGFLNASSFTICFFSLLFCGPNQVNHFFCDFAPLFELSCSDISIPIVFLSFTAGSIVVVTALVIAVS
YIYILITILKMHSTEGRHKAFSTCASHLTAVTLFYGTITFIYVLPKSSYTTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRELARKICS*
548 >lcl|XP_001500451.2|Plus1complement(29123034..29123978) NW_001867427 olfactory receptor 502-like LOC100070740 __SEG__ Chr7 {Equus caballus} MDALGDGNHTAVTGFILLGLTGDPILRVILFIIILCIYLVTIPGNLSTIILIRISSQLHHPMYFFLSYLAFADMGLSSSVTPNMLVNFLVEKNTISYFGCGIQLGSAAFF
GAVECFLLAAMAYDRFMAICSPLLYSTKMSTQICVQWLIVAYVCGSLNASTITISYFTLFFCGPNQVNHFFCDFAPLVELSCSYINISTVVPSYVAGSIIVVTVFVIAVS
YIYILITILKMRSTEGHHKAFSTCASHLTAVTLYYGTTTFIYATPKSCYSTDQNKVVSVFYMVVIPMLNPLIYSLSNNEIKGALKRELARKIFS*
549 >lcl|XP_001500462.3|Plus128396397..28396846 NW_001867401 calmodulin-like protein 5-like LOC100057133 __SEG__ Chr29 {Equus caballus} MAEKLSEEQVAEFKEAFSSVDKNGDGTINTQELGAVMQALGHSLSEAELNELIARVDSDGDGVINFQEFLAEMVKRRKAWGSEQDLQGVFRAFDLDGDGHINVDELKQAI
AKLGDEVSEEALEVMIRQADLDQDGKVSYEEFVRILTQK*
550 >lcl|XP_001500502.1|Plus1complement(29183080..29184018) NW_001867427 olfactory receptor 5P3-like LOC100070780 __SEG__ Chr7 {Equus caballus} MGTGNCTTVAEFILLGLTEDTTVCAILFIVFLGVYVATLMGNVSIITLIRSSPQLHTPMYLFLCHLALVDMGYSSSVTPVMLVSLLREGTSLPVVGCVAQLCSVVTFGTA
ECFLLAAMAYDRYVAICLPLVYSTHMSPRICVLLVGISYLGGCVNAWTFTSCLLSLSFCGPNKVNHFFCDYSPLLKLSCSRDFTSEIIPAISSGSIIVVTVFVIALSYVS
ILFSILKMHSPEGRHKAFSTCTSHLTVVTLFYGTITFIYVMPKSSYSTEQNKVVSVFYTVMIPMLNPLIYSLRNKEVKKTMGKLMTGRHRRS*
551 >lcl|XP_001500507.2|Plus1complement(29193110..29194054) NW_001867427 olfactory receptor 502-like LOC100070786 __SEG__ Chr7 {Equus caballus} MDALGHGNHTQVAGFILLGLTDDPILQIILFMTILFMYLVTTTGNLSTIILIRISSQLHHPMYFFLSHLAFADMGLSSSVTPNMLVNFLVERNTISYFGCGIQLGSVALF
GTIECFLLAAMAYDRFMAICSPLIYSTKMSTEVCIKFLIVAYGGGFLNACTVAISFFTLLFCGANQVNHFFCDLAPLVKLSCSDVSISAVVPSFTSGSIIVLTVFVIAVS
YIYILITILKMRSTEGHHKAFSTCASHLTAVTLYYGTITFVYVTPKSCYSSDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQLARKIFS*
552 >lcl|XP_001500523.2|Plus1complement(29217904..29218848) NW_001867427 olfactory receptor 478-like LOC100070801 __SEG__ Chr7 {Equus caballus} MDALVGGNYTEVTGFILLGLTDDPKLRVILFIVILCIYLVTVSGNLSTIILIRISSQLHHPMYFFLSHLALADMGLSSSVTPNMLVNFLVERNTISYYGCAMQLGSVAFF
GATECFLLAAMAYDRFMAICSPLLYSTKMSTQVCVQLLIVSYIGGLFNAFAFTIGVYSLVFCGPNGVNHFFCDYAPLVELSCLAISVPTVVPSYVAGSIIVVTVFVIAVS
YIYILITILKMRSTEGRHKAFSTCASHFTAVTLYYGTITFIYVLPKSCYTTDQNKVVSVFYMVAIPMLNPLIYSLRNNEINGALKKELARKVFC*
553 >lcl|XP_001500531.1|Plus124013476..24014420 NW_001867427 olfactory receptor 52B4-like LOC100053322 __SEG__ Chr7 {Equus caballus} MTILNHTGVSHTVFHLLGIPGLEDQHMWISIPFFISYVIALLGNSLLICIILMKSSLHEPMYLFLCMLAGADVVLSTCTVPQALAIFWFHAGEISLDRCITQVFFLSSTF
IFESGVLLVMAFDRYIAICYPLRYTTILTYALTGKIGVTIFLRSYGTIFPIVFLLKRLTFCKSNILPNTACKHIVLAHVSCDDIQVNIWYGFFVLMSTLVIDVALIFISY
VLILHAVFHIPSRDARHKALNTCGSHVCVIILFYAPGIFSVLTQRFGHHISPHIHVLLANVYILVPPMLNPIIYGIKTKQIRDHVVHMFFTRQK*
554 >lcl|XP_001500532.2|Plus1complement(29241885..29242829) NW_001867427 olfactory receptor 502-like LOC100070809 __SEG__ Chr7 {Equus caballus} MDALVDGNNTEVTGFILLGLSDHQILRIILFMIILCIYLVTIFGNLSTIILIRLSSQLHYPMYFFLSHLAFTDMGLSSSVTPNMLVNFLVERNTISYLGCAIQLGSVVFF
GTMECFLLAAMAYDRFMAICSPLLYSTKMSTQVCVQLLVVAYVGGFVNDFSFTICVYSLVFCGPNRVNHFFCDFAPLVKLSCSDITVSTIVPSFTAGSIIVVTVFVIAVS
YICILITILKMRSTEGRHKAFSTCASHLTAVTLFYGTITFIYVMPKSCYTTDQNKVISVFYMVVIPMLNPLIYSLRNNEIKGALKRQLARKMFS*
555 >lcl|XP_001500536.2|Plus1complement(17011649..17012710) NW_001867381 chemokine C-C motif receptor-like 2-like isoform 1 LOC100054419 __SEG__ Chr16 {Equus caballus} MANYTSTPEDEYDVLIEDDLNNKIEQCDQYDTKILSAKLVPALYTVVFLLGLLDNLLVVLILVKHKGLKRVENIYFLNLAVSNLCFLLTLPFWAHSATHGGILGDPKCQI
LVALSSVGLYSEAFFNALLTVQRCLVFFDMETLSSVPRGIITSVLAWGIAILVSLPELVFYEPQVESQKYKCFFGKPHFLPADETFWKHFLTLRTNIFGLLFPLFVFIFC
YVRMRKTIRFGKRRYDLYKLVFAVMVVFLLMWGPYNVALCLSTFKDYFCLQDCRHSYNLDKSVHIMKIVATTHCCVNPLLYVLLDKEFRKHLCRLGHLGNAPPQPTERCA
PRTPGEEHDLSAEMQASFRQSQD*
556 >lcl|XP_001500555.2|Plus129283177..29284109 NW_001867427 olfactory receptor 1030-like LOC100070828 __SEG__ Chr7 {Equus caballus} MARGNRSTVTEFILMGLTDRPELQLPLFVVFLLIYLITLVGNLGMILLIKVDSRFHTPMYYFLGHLAFIDLCYSSSIGPKMLQNLLAKRKTISFLGCFAQLYFSSALATT
ECFLLATMAYDRYMAICNPLIYTAIMTQGVCKELVIGVYTYGFLNSVIQTVLTFQLSFCDSVIHHFYCADPPLLAVSCSDTSNKEKQLLMFSAVNLTGSLLTVLVSYICI
LFSIIKIQSSEGKCKAFSTCASHLTMVIIFYGTLFFMYLKQPKAGNSWKYNKVVSVFYSLVIPMLNPLIYSLRNTEVKEILKKMLEGRES*
557 >lcl|XP_001500580.2|Plus1complement(29327199..29328143) NW_001867427 olfactory receptor 10A3-like LOC100070849 __SEG__ Chr7 {Equus caballus} MKRHNQSSVVEFVLLGFSNFPELQEKLFGVFLVIYLVTLMGNAIIIVIISLGQSLHVPMYLFLLNLSVVDVSISAVIIPEMLVVLSTKKTTITFSGCFAQMYFILFFGGT
ECFLLGTMAYDRFAAICFPLSYPMIMNKRVFVKLVTFSWVSGIMVATVQTTWVFSFPFCGPNEINHISCETPAVLELACADTFLFEIYAFTGTILIVTVPFLLILLSYIR
ILFAILKMPSITGRQKAFSTCASHLTSVTLFYGTANMTYLQPKSGYSPDTKKLMSLSYSLLTPLLNPLIYSLRNSVMKRALMKLWRRKVDLPTF*
558 >lcl|XP_001500589.2|Plus1complement(29337746..29338690) NW_001867427 olfactory receptor 10A3-like LOC100070856 __SEG__ Chr7 {Equus caballus} MKRHNQSSVVEFILLGFSNFPELQEQLFGVFLVIYLVTLMGNAIIIVIISLGQSLHIPMYLFLLNLSVVDVSISAVIIPEMLVVLSTEKMSISFVSCFAQMYFLLLFGGT
ECFLLGAMAYDRFAAICLPLSYPVIMNKGVFMKLVMFSWVSGIMVATVQTSWVFSFPFCGPNEINHLFCETPPVLELVCADTFLFEIYAFTGTILIVMVPFLLILLSYIW
ILFAILKMPSTTGRQKAFSTCASHLTSVTLFYGTANMTYLQPKSGYSPDTKKLMSLAYTLLTPLLNPLIYSLRNSVMKRAMMKLWRRKVDLPTF*
559 >lcl|XP_001500617.2|Plus131225179..31226114 NW_001867366 olfactory receptor 4D2-like LOC100070889 __SEG__ Chr11 {Equus caballus} METENLTWVSEFVFLGLSQTQELQLFLFLVFLFVYTTTVMGNVLIMVTVTSDSRLHTPMYFLLRNLAILDLSFSSVTAPKMLVDFLSEEKTISYQGCMTQIFFFHFLGGA
MIFFLSVMAYDRLVAISRPLHYVTIMNMQLCVGLVVTAWMVGFVHSISQLVLMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLMISNSGLLDVIWFFLLLMSYSV
ILVMLRSHSGQARRKAASTCTTHIVVVSMVFIPSIYLYARPFTPFSMDKAVSIGHTVMTPMLNPMIYTLRNQEMQAAVKRLGRRWLVCKRE*
560 >lcl|XP_001500624.2|Plus131238654..31239589 NW_001867366 olfactory receptor 4D2-like LOC100070902 __SEG__ Chr11 {Equus caballus} MEPGNLTWVSEFVFLGLLQSQELQLFLFLVFLFVYTTTVMGNLLIMVTVTSDSQLHTPMYFLLRNLAVIDLCFSSVTVPKMLADFLSEKKAISYQGCMTQIFFLHFLGGA
MVFFLSVMAYDRLVAISRPLHYVTIMNTQLCMGLVLAGWVGGFIHSISQLALMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLMISNSGLLDVIWFFLLLMSYSV
ILVMLRSHSGQARRKAASTCTTHIVVVSMVFIPSIYLYARPFTPFPMDKAVSIGHTVMTPMLNPMIYTLRNQEMKAAVKRLGRHWLVCKRE*
561 >lcl|XP_001500680.2|Plus117299729..17300730 NW_001867381 chemokine XC receptor 1-like LOC100065485 __SEG__ Chr16 {Equus caballus} MEPSGLPESTTPFDYDPESFLCESKTFTFAAFSTTILYFLVFLLSLVGNSLVLWVLVKYESLESLTNVFILNLCLSDLVFSCLLPVWILGYHWGWVLGDFLCKFLNMVFS
ISLYSSIFFLTIMTIHRYLSVVSPLSSLRVHTLRCRVLVTTAVWVASILSSIPDAIFHKVFPSGCDYSGRTWFLASVYQHNVFFLLSVGTILFCNVEILRTLFRSRSKRH
HRTVRLIFTIVAAYFLSWAPYNLILFLQTLLKLEVIQSCEVSQQLDYALLICRNVAFSHCCFNPVLYVFVGVKFRRHLKSLLRHFWLCRQQAPNLPPLPHSPGAFTYEGA
SFY*
562 >lcl|XP_001500783.1|Plus1complement(16222553..16223680) NW_001867387 neuropeptide Y receptor type 4-like LOC100052105 __SEG__ Chr1 {Equus caballus} MNISHFLAFLLPGSSQGQNRSKSKGISYNFSDHCQDSTDLMVFIVTSYSIETVVGVLGNLCLMCVTMRQKEKANVTNLLIANLAFSDFLMCLICQPLTAIYTLMDYWVFG
EVLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSVSQAYLGIVVIWLLACFLSLPFLANSILKSVFHKNHSKALEFLADKVVCTESWPLDHHRIIYTTFLLL
FQYCIPLAFILFCYVRIYQRLRKRRWVFRKGAYSSQAWQMKRINGILVAMVAAFAVFWLPLHVFNSLEDWYHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFK
KEVKALVLTCQQSAPVEKSEHLPLSTVQTEVSKGSLRLSGRSNPM*
563 >lcl|XP_001500859.1|Plus1complement(5182205..5183350) NW_001867405 neuropeptide Y receptor type 2 NPY2R __SEG__ Chr2 {Equus caballus} MGPIGAEADENQTAEEMKVEHYDPGQTTPRGELGPDPKPELIDSTKLIEVQIVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLT
YTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLDSRISKRISFLIIALAWGISALLASPLAIFREYSMIEINPDFEIVACTEKWPGEKSIYGTIYS
LSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDNHVLDLKEYKLIFTLFHIIAMCSTFANPLLYGWMNS
NYRKAFLSAFRCEQRLDAIHSEVSMTFKTMKNLEVKKNNGANDSFTDATNV*
564 >lcl|XP_001500931.1|Plus1complement(34670334..34672790) NW_001867399 leucine-rich repeat and fibronectin type-III domain-containing protein 6 ELFN2 __SEG__ Chr28 {Equus caballus} MLRLGLCAAALLCVCRPGAVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDLRLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQL
GYNKLSNLTEGMLRGMGRLQFLFVQHNLIELVTPAAFSECPSLISIDLSSNRLSRLDGATFASLASLMVCELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPRE
FAGYPLLVPRPYHSLNAITVLQAKCRNGSLPARPASHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHHVTFTSATLVVIIPHPYSKMYVLVQYNN
SYFSDVMTLKNKKEIVTLDKLRAHTEYTFCVTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLRKRRMQEEKQKSVKVKKTILE
LRYGADVDAGSVVHAAQKLGEPPVLPVSRMSSIPSMIGEKLPTSKGLEAGLDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEISTIAKEVDKVNQIINN
CIDALKLDSASFLGGGSGGGDPELAFECQSLPAAAAASSAAAPGALERPSFLSPPYKESSHHPLQRQLSADAAVARKTCSVSSSGSIKSAKVFSLDVPDHPATAGLAKGD
SKYIEKGSPLNSPLDRLPLVPAGGSGGGGGGVHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWER
FRPYKKHAREEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL*
565 >lcl|XP_001500939.2|Plus127025840..27026868 NW_001867396 olfactory receptor 5C1-like LOC100071189 __SEG__ Chr25 {Equus caballus} MTVMTFLSSLSCFASPQSLSSRMTPENFTWARVVPAEFILLGITDRWDLCVTLFLIFLPIYLVGLLGNVGMVLLICMDAPLHTPMYFFLANLSLLDACYASAIGPKMLVD
LLLPHATIPYAACALQMFVFAGLADAECCLLAAMAYDRYVAIGNPLLYTTAMSRRLCLALLGASGLGGAVSAFVHTTFTFHLSFCHSREVNSFFCDIPPLLAISCNDTSL
NELLLFAVCGFIQTATVLVIAVSYGFIAGAVIRMRSAEGRWRAASTCGSHLMAVAMLYGTLIFMYLRPSSSYALDTDKMASLFYTLVIPALNPLIYSLRNKDVKEALRRT
WNRFSCPERGHQ*
566 >lcl|XP_001500962.2|Plus127004948..27005877 NW_001867396 olfactory receptor 1L6-like LOC100071212 __SEG__ Chr25 {Equus caballus} MLRGNKSHVTEFLLLGLTCDPKQQVWLFASFLAMYLVNVAGNSVIIAAIWGDAHLHTPMYFFLSNLSLVDICFTTVIVPRMLVNMLTKRKTILFAHCLTQMYFFVAFGIT
DSFLLAAMAVNRYMAICNPLHYTTTMNPRHCLLLVIASWVVSHLHSLTHTILMARLSFCGPNTIHHFFCDVQPLLTLSCSDTSVNELLAFTEGSFVIMTPFIFIIVSYVY
ITRAVLRVPSGGGRYKVFSTCGSHLIVVALFYGTIISVYIRPSSTYSVTKDRVVTVIYAVVTPMLNPFIYSLRNKDMKHALKKLMRKAE*
567 >lcl|XP_001500970.2|Plus126979321..26980259 NW_001867396 olfactory receptor 1L6-like LOC100071218 __SEG__ Chr25 {Equus caballus} MPRGNQSHITEFLLLGLTSDPKWQVWLFASFLAMYLVNVSGNSVIIAAIQKDTHLHTPMYFFLSNLSFVDICFTNVIVPRMLANMLSKSKKVPFAHCLTQMYFFVTCAIT
DSFLLAAMAMDRYVAICSPLHYTTTMSPRRCLLLVIASWVVSHLHSLTHTVLMARLSFCGPNIIHHFFCDVQPLLTLSCSDTSINELLAFTEGSFVIMTPFVFIIVSYVY
ITRAVLRVPSGRGRYKVFSTCGSHLTVVALYYGTAISVYIRPSSTYSVTKDRVITVIYTVVIPMLNPFIYSLRNRDIKQALRKLTRRKEYNK*
568 >lcl|XP_001501013.3|Plus126887801..26888736 NW_001867396 olfactory receptor 1L6-like LOC100071258 __SEG__ Chr25 {Equus caballus} MEIKNDSSSTSGFMLLGISSNPQLQKPLFAIFLIMYLITLVGNVLIILAIHSDSRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNLLSETKSISYVGCLIQMYFFMAFAN
TDSYLLASMAIDRLVAICNPFHYDTVMNSRHCLLMLLGSCTISHLHSLLRVLLMSQLSFCASHVIKHFFCDTQPVLKLSCSDTSSNQIVVMTETLAVIATPFLCILFSYL
RIIITVLRIPSAAGKWKAFSTCGSHLTVVVLFYGSVIYVYFRPLSMYSVVKDRVATVMYTVVTPMLNPFIYSLRNKDMKMGLRKLRERIYS*
569 >lcl|XP_001501032.3|Plus126846317..26847249 NW_001867396 olfactory receptor 1L1-like LOC100071270 __SEG__ Chr25 {Equus caballus} MERNNLTRPSEFILLGLSSRPEDQKSLFAVVLPIYLITMIGNLLIILAIRYDTRLQTPMYFFLSVLSFVDICYVTVIIPKMLENFLSETKAISYGECLTQMYFFIAFGNT
DSYLLAAMAIDRYVAICNPFHYITIMNHRRCVLLLVLSFCIPHLHSLLHILLTNQLAFCTSNVIHHFFCDDQPVLKLSCSSHFVKEITVMTEGLAVIMTPFSCIIISYLR
ILITVLKIPSAAGKRKAFSTCGSHLTVVTLFYGSISYVYFQPLSNYTVKDQIATIIYTILTPMLNPFIYSLRNKDMKQGLTNLMHRVKCQ*
570 >lcl|XP_001501042.2|Plus1complement(26829119..26830072) NW_001867396 olfactory receptor 1B1-like LOC100071275 __SEG__ Chr25 {Equus caballus} MGCAPNASHSPVFLLLGFSRARVPPALPFLLFLAIYLTTIMGNVTLVLLISRDSRLHSPMYYLLRGLSVIDMGLSTVILPQLLAHLVSNYPAIPAARCFAQFFFFYVFGV
TDTLVIAVMALDRYVAICDPLHYHSVMNRQLCACLLALCWVVSIVHTMLHVGLLLPLYWAGDAEGNVNLPHFFCDHRPLLRASCSDIHSNELAIFLEGGFLMLGPCSLIV
LSYIHIGATILRLPSAAGRRRAVSTCGSHLTMVGFFYGTIIWVYFQPPSQNSQDQDMVAAVMYTTITPLANPFVYSLRNKDVKSAFHGLLGRGRVDS*
571 >lcl|XP_001501053.2|Plus126817927..26818871 NW_001867396 olfactory receptor 1Q1-like LOC100071278 __SEG__ Chr25 {Equus caballus} MDNTNWTSVSHFVLLGISTHPEEQIPLFFLFLFMYAINISGNFAIIILITSTPRFHTPMYIFLSNLALADICFTSTTVPKMLQNIFSPTKAISYMGCLAQTYFFICFAAM
ENFLLAVMAYDRYIAICHPFHYPMILTRMLCSQMVAVCHILSHLHALLHTFLMGQLIFCADNRIPHFFCDLYPLMKISCSSTHLNTLMIHTEGVIVINGALAFIIASYAC
IISAVLRSPSAKGKWKAFSTCASHLIVVAIFYGTLTCVYFQPLSNYSVTSGRMLTVMYTVVTPMLNPFIYSLRNGDVKGTFRKWMCRIWTSSFR*
572 >lcl|XP_001501061.3|Plus126804262..26805194 NW_001867396 olfactory receptor 1N1-like LOC100071283 __SEG__ Chr25 {Equus caballus} MDGRNQTSTYEFLLVGLSEWPKQQLLLFVLFLGMYLVTVVGNLFIILAIGSDVHLHTPMYLFLANLSFSDIGFISTVIPKMLDNIGSGSKLISYGGCLTQLYFFGLFADL
DNFLLAVMALDRYMAISYPLQYPMTMNYQRCVLLVAGSWLVTTFHALVHTLLVTRLSFCGPSIIPHFFCDLVPLLKLACSSTYVNDLMLILVAGTLLIGPFVCILMSYFY
IALAILRIDSPKGKQRAFSNCTSHLSVVSLFYSTAIGVYLCPPSSSSGGKDRFFSVMYTVVTPMLNPFIYSLRNRDMKEALGKLLRRKTL*
573 >lcl|XP_001501113.2|Plus126698220..26699161 NW_001867396 olfactory receptor 1J4-like LOC100071329 __SEG__ Chr25 {Equus caballus} MRRENQSSVSKFLLLGLPIQPEQQGLFFVLFLGMYLTTVLGNLLIILLIRLDSRLHTPMYFFLSHLALTDVSFSSVTVPKMLINMQIQDQSILYAGCVTQMYFFIFFGCV
DNLLLALMAYDRYVAVCHPLHYTTIMKEGLCIFLLAGSWLLSCASALSHTLLLDQLSFCADNTIPHFFCDLAALLKLSCSDTSLNDIFIFTVGGLVIILSFIGILVSYGH
IGATILRFPSIKGICKALSTCGSHLSVVFLFYGTIVVLYFFPSSSNSNDQEIIVSVMYTVVTPMLNPFIYSLRNRDMKSALGRLFRREIFFSM*
574 >lcl|XP_001501121.2|Plus126683576..26684523 NW_001867396 olfactory receptor 1J4-like LOC100071332 __SEG__ Chr25 {Equus caballus} MRREKQTNVSEFFLLGLPIPPGQQDIFFTLFLGMYLITVLGNLLIILLIRLDSRLHTPMYFFLSHLAFTDISFSSVTVPKMLMDIHTNHKSILFTGCICQMYFFILFGCL
DNFLLAVMAYDRYVAICQPLHYTTIMSQELCISLVAGSWFLCCAHALLHTLLLVQLSFCADNIIPHFFCDLPTLLKMSCSNISLNELVIFTEGGMIIILPLSSVLGSYIR
IGTTVLRVPSTKRFCKAFSTCGSHLFVVSLYYGTIAGVYFFSSPSISNDKDIIASVMYMVVTPMLNPFIYSLRNRDMKHAIEILVNRIKVLTHNH*
575 >lcl|XP_001501122.1|Plus124128806..24129750 NW_001867427 olfactory receptor 52K1-like LOC100053418 __SEG__ Chr7 {Equus caballus} MSASNITAIHPAAFLLVGIPGLEHLHVWISIPFCFAYTLALLGNCTLLFIIRADAALHEPMYLFLAMLAAIDLVLSSTTLPKMLAIFWFRDCEINFYACLVQMFFLHSFS
IMESAVLLAMAFDRYVAICKPLHYTTILTRPLIIKIGMVTVTRAVTLMTPLPFLLRRFHYCRGPVIAHCYCEHTAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLASQEARYKAFGTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMVNPLIYGVKTKQIRDHVLSLFQRKKV*
576 >lcl|XP_001501131.2|Plus112622825..12623940 NW_001867428 chemokine-like receptor 1-like LOC100059916 __SEG__ Chr8 {Equus caballus} MENEDYNLSLTYGDDYLDDLEPIVVLEEFSPLEGRVARIFLVVVYSIVCFLGILGNGLVIVIATFKMKKTVNTVWFLNLAVADFLFNVFLPIHIIYAAMDYHWVFGTAMC
KISNFLLIHNMYTSVFLLTIISFDRCISVLLPVWSQNHRSIRLAYTACVVIWILAFFLSSPSLVFRDTAHQHGKISCFNNFSLSAASSSRLPTHHPLNPVGFNRHMVVTI
TRFLCGFLVPGLIITACYFTIVCKLRRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLYLLELHHAAVPGSVFSLGLPLATAIAIANSCMNPILYVFMGQDFKKFKVAVFS
RLVNALSEDTGHSSFHSHRSFTKMSSINERSSVNERETNML*
577 >lcl|XP_001501140.2|Plus1complement(26660789..26661712) NW_001867396 olfactory receptor 1L8-like LOC100071346 __SEG__ Chr25 {Equus caballus} MEKVNQTSSVSEFILLGLSSRPEDQKPLFILFLTIYLVTITGNLLIILAIYSDPQLQTPMYFFLSCLSFTDICFTTTIVPRMLVDFLSKKTISYAGCLTQMYFIYALGNS
DSFLLAVMAFDRYVAICDPFHYVTTVSHRRCVLLVAFSCSFPHFHSFLHTLLLNHLIFCDSNVIHHFLCDIGPLLKLSCSSTFVNEIVIMIEGSVVLVTPFLFIAFSYVL
ILIAVLKIPSAAGKRKAFSTCGSHLTVVTLFYGSIFYVYLQPLSTYAVRDHIATIVYTVLSSMLNPFIYSLRNKDLKRGLRKLMGKK*
578 >lcl|XP_001501145.2|Plus1complement(26644243..26645178) NW_001867396 olfactory receptor 1N1-like LOC100071352 __SEG__ Chr25 {Equus caballus} MENQSSISEFFLRGISESPEQQQLFYGIFLCMYLVTLTGNVLIILAIGSDPHLHMPMYFFLANLSFVDIGLTSSTVTKMLVNVQTQQHTISYAGCLTQMYFFLMFGYLDS
FFLAVMAYDRYVAICHPLHYSIVMSPRVCAMLLALCWVLTHTVALTHTLLMARLSFCVVGEITHFSCDITPVLRLSCSDTHINELMLFALGGTVLIIPFICIVISYIHIV
SAILRVRTPGGGGKAFSTCSSHLCVVCVFYGTLFSAYLCPPSLASEKKDIVAAAMYAVVTPMLNPFIYSLRNKDMKGAIKRLLSRRKIFSS*
579 >lcl|XP_001501150.2|Plus1complement(26632623..26633564) NW_001867396 olfactory receptor 1J1-like LOC100071358 __SEG__ Chr25 {Equus caballus} MRRENQSGVSNFLLLGLSIRPEQQGALFTLFLGMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDVSFSSVTVPKMLVNMHTKHKSIPYAGCISQTYFFIFFAAV
DSFLITSMAYDRYVAICHPMHYTIIMSQSVCVMLVAGSWLISCACALLHTLLLAQLSFCADYTVPHFFCDLAALLKLSCSDTSLNQLVIFTVGLTTIVLPFLGILVSYGH
IGATILQVPSTQGICKALSTCGSHLSVVTLYYGAIIGLYFLPSSNNTNGNNIIASLMYTVVTPMLNPFIYSLRNKDVKGALRKLLSKKTYFSI*
580 >lcl|XP_001501161.2|Plus126624941..26625879 NW_001867396 olfactory receptor 1J2-like LOC100071365 __SEG__ Chr25 {Equus caballus} MRRDNESSVSEFLLLGLPVWTENQGIYYTLFLVMYLTTVLGNLLIILLIRLDSCLHTPMYFFLSHLAFTDISYSSVTAPKMLMNMHTQSQSISHSGCISQVYFFLLFGCL
DSFLLTSMAYDRYVAICHPLHYTTIMSQKLCFLLVTVSWVLSCTNALLHTLLLARLSFCGHNILPHFFCDLSTLLKLSSSDTTVNELIIVTVGAVVITLPFIYILVSYGL
IGATTLKVPSTKGIGKALSTCGSHLSVVSLYYGAIIGLYFFPSYSESNDKDVIVAVFYSLVTPMLNPFIYSLRNRDMKGALGNVLSRGKFSP*
581 >lcl|XP_001501175.2|Plus126611153..26612094 NW_001867396 olfactory receptor 1J4-like LOC100071382 __SEG__ Chr25 {Equus caballus} MRMENQSSVSEFLLLGLPISLEQQGMFFTLFLVIYLTTVLGNLLIILLVKLDSRLHTPMYFFLSHLALTDVSFSSVTVPKMLLNMQTQHLSISYPGCVLQMYFYLLFGCV
DNLLLAVMAYDRYVAICHPLRYTTIMREGLCVLLVGGSWVLSCGSALLHTLLLVQVSFCADNIIPHFFCSLSILLKLSCSNTSLNELVIFTAGGATVIFPFSGILVSYGR
IGASLLRVPSTKRICKALSTCGSHLSVVSLFYGTVMALYFSSSLSKSNVRDMIASLMYTVVTPLLNPFIYSLRNRDIKLALGILFRSSILCAK*
582 >lcl|XP_001501199.2|Plus126590167..26591114 NW_001867396 olfactory receptor 1J2-like LOC100071402 __SEG__ Chr25 {Equus caballus} MRPQNQSRVSKFLFQGLPIQPDQQNMFFALFLSVYLTTVLGNLLIILLIRLDSRLHTPMYFFLSHLAFSDISLSSVTVPKMLMNMQTKQQSILYVECISQMCFFLVFACL
DHFLLAAMAYDRYVAICRPLQYTIVMRHELCVLLVAVSWFFSCAQALLHTFLLVQLSFCAYSSIPHFFCDLTALLKMSCSDVSLNELVIFTEGGMLFILPLSSILGSYIH
IGTTILKVPSTKRLFKAFSTCGSHLFAVSLYYVTLAAVYFFSSSWGSNNKDIIASVMYAVVTPMLNPFIYSLRNRDIKQALEIFVNRLSSLSDNN*
583 >lcl|XP_001501227.2|Plus1complement(26516980..26517951) NW_001867396 olfactory receptor 24-like LOC100071420 __SEG__ Chr25 {Equus caballus} MATRNRTEVTEFVLLGLASWPEMQPIIFGIVLAMYLVAVMGNALLVIVVLLDSKLQTPMYFLLSQLSFIDIFLTTITVPQMLVHMLPVNRTISFNCCIIQLFFFMTVGSM
EGHLLAAMAYDRCAAICDPLRYSAIISHRLCLRITLTSWVVVSLNSLLYSVLVTRLTFCGNEVTHFFCDITPLLKLSCTLPVVNEMLIFTEGVAVVVSPFFFILGSYACI
GVAIVRMHSVAVLHKALSTCSSHVMVVLLLYGSVIRMYLRPSSSYDLGQDRQIAIFYTVVTPMLNPLIYSLRNKEVKGALQRLFRKLCILGNFQPDYQANREW*
584 >lcl|XP_001501248.2|Plus1complement(26492660..26493607) NW_001867396 olfactory receptor 1N2-like LOC100071438 __SEG__ Chr25 {Equus caballus} MDRINQSSVTGFLLLGLSERPEQQPLLFGIFLGMYLVTVVGNLLIILAIGFDPHLHTPMYFFLANLSFADGCFSSTIVPRMLVNIRTHNQTISYGECLAQMYFFMMFGGL
DDFLLGVMAYDRYVAICKPLHYSTLMSPLVCVLLLTASWVLTNLAALLHTLLMARLSFCAGNTIHHFFCDVIPLLQLSCSDTCTNQVALFTVGSIVLTGPLSLITLSYAY
IFSTILRVPSASGRQKSFSTCGSHLTVVFLFYGAAIGVYLCRSPSQSRGQYTIAAVFYTVVTPMLNPFIYSLRNKDMKTALRRLFGIHTFSSQGL*
585 >lcl|XP_001501252.2|Plus1complement(20033348..20034607) NW_001867364 probable G-protein coupled receptor 63 GPR63 __SEG__ Chr10 {Equus caballus} MVFSAVLTASHTGATNTTFVVFENMYMNITAPPPFQHPDISPLLRYSFETLAPTGMNSLTVNSTAVPPTPAVFKSLNLPLQIILSAIMIFILFVSFLGNLVVCLMVYQKA
AMRSAINILLASLAFADMSLTVLNMPFALVTILTTRWIFGKFFCRVSAMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKVLIAVSWATSFCIAFPLAVGNPDL
QIPSRAPQCVFGYTTNPGYQAYVILISLISFFIPFLVILYSFMGILNTLRHNALRIHSYPEGICLSQASKLGLMSLQRPFQMSIDMGFKTRAFTTILILFAVFIVCWAPF
TTYSLVATFSEHFYYKHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKFLPRLPGHTRRRIRPSAVYVCGEHRTVV*
586 >lcl|XP_001501255.2|Plus126482907..26483851 NW_001867396 olfactory receptor 1G1-like LOC100071445 __SEG__ Chr25 {Equus caballus} MKPGNHTFSVSEFLLLGLSEHQGKQPLLFSIFLSMYLVTVVGNVVIVMVIASDPHLHTPMYFFLANFSLTDLCLSSTTVPKMLVNIQAQRHTITYTGCLSQIYFFLWFIG
LDVFLLAVMAYDRLLAICHPLHYTLVMSPRCSILLVIMSLILAHSYSLTHTILLAQLSFCTDNIIHHFFCELLPMLKLSCSNTYANQCVLIYWGGTLTILIPLLIIISYV
RIVAAIVRIPSAIGKWKAFSTCGSHLSAVCLFYVSAIGVYFISSTTDSASKDRIAAVMYAVVTPMLNPFIYSLRNKDIKSALGRFLSRRALQSP*
587 >lcl|XP_001501307.2|Plus126353348..26354286 NW_001867396 olfactory receptor 1J2-like LOC100071488 __SEG__ Chr25 {Equus caballus} MRPENQSCVSEFLLLGLPIQPEQQGLFFALFLCMYLTTVLGNLLIILLIRLDSRLHTPMYFFLSHLAFSDISLSSVTVPKMLMNMQSRQQTIPYSGCISQFYFLTLFGCI
DNFLLAVMAYDRYVAICQPLHYTNVMRQELLISLVVWSWFLSCAHALLHTLLLVQLSFCADNSIPHFFCDLTALLKMSCSDISLNELVMFIEGAMVVTLPLISILGSYIH
IGTTVLKIPSTKRLFKAFSTCGSHLIVVSLYYGTIAVAYFFSSSKDSNDKDMIASVMYIVVTPMLNPFIYSLRNRDIKQALGMFVTRANFFK*
588 >lcl|XP_001501316.1|Plus14118630..4120648 NW_001877047 transcriptional regulator Kaiso ZBTB33 __SEG__ ChrX {Equus caballus} MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFLVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTAQDGNTDTLPPGSSDKNLEIQKSKDEAQDNGATIMPIITESFSLSAEDYETKKIIVTDSDDDDDDVIFCSEILPAKETLPSTNAVAQVQPN
PGAVAISDVAPCVSNNSPPLTNITPTQKLPTSANQATLSQTQGSEKLLVSSAPTHLTPNIILLNQASHTTPPNVSSSLPNHMSPSINLLVQNQPTPNSAVLTGNKANEEE
EEEIIDDDDDTISSSPDSAVSNTSLVPQADIPQNTTFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGED
TYDIVIPVKDDPDEGEARLENETPKTSSSETANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSGTMPVMKDDGIGYKVDAGKEPPVGTTSTPQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY*
589 >lcl|XP_001501328.2|Plus126325693..26326631 NW_001867396 olfactory receptor 1J2-like LOC100071502 __SEG__ Chr25 {Equus caballus} MRPENKSSMSEFLLLGLPIPLEQQGIFFALFLGMYFTTVLGNLLIIWLIGLDSRLHTPMYFFLSHLAFSDIFLSSVTVPKMLKNMQTQQPFIPYVGCISQMCLIIVFGCL
DNFLLAVMAYDRYVAICQPLHYTTVMRQELCVSLVAGSWFFSCAHALLHSLLLVQLSFCADNTIPNFFCDLPALLKISCSDIFLNELVIFTEGAMVVILPFFSILGSYIH
IGMTVLRVPSRRRLFKVFSTCGSHLFVVSLYYGTIAGVYLFSFSQSSNEKDLIASVMYAVVTPMLNPFIYSLRNRDIKHALEIFVNKAKFLK*
590 >lcl|XP_001501332.2|Plus1complement(26300271..26301212) NW_001867396 olfactory receptor 1J1-like LOC100071506 __SEG__ Chr25 {Equus caballus} MRGENQSSVYEFLLLGLPIEPEQEGLFFILFLGMYLITVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDVSFSSVTVPKMLMNMHTKHKSIPYAGCISQTYFFIFFAAL
DSFLITSMAYDRYVAICHPLHYTTIVSQRVCIMLVARPWLIAHACALLHTLLLARLSFCAHHTLPHFFCDLAALLKLSCSDISLNKLAIFTVGLATIVLPFLGILVSYGH
IGATILQVPSAHGICKALSTCGSHLSVVTLYYGAIIGLYFLPSSNNANNNNIIASLMYTVAIPMLNPFIYSLRNKDMKKALRKLLSKKTYSSS*
591 >lcl|XP_001501333.1|Plus1complement(2631346..2632446) NW_001867397 5-hydroxytryptamine receptor 1F-like LOC100054385 __SEG__ Chr26 {Equus caballus} MDFLNSSDQNLTTEEMLYRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCS
ILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITVVWIISIFISMPPLFWRHQGTSREDECIIKHDHIVSTIYSTFGAFYIPLTLILILYYKIYKAAKTLYHKRQASRI
AKEELNGQVLLESGEKSTRLVSTPYTLEKSLSDPSTDLDKIHSTVKSPKSEFKHDKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSN
FLTWLGYLNSLINPLIYTAFNEDFKKAFQKLAQCRC*
592 >lcl|XP_001501344.2|Plus126274321..26275259 NW_001867396 olfactory receptor 1J4-like LOC100071518 __SEG__ Chr25 {Equus caballus} MRPENKSSVSEFLLLGLPFSLEYQGLCFTLFLGMHLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFSDISLSSVVVPKMLMNMQTQQQSISYVGCISQMCFFLVFACL
DNFLLAVMAYDRYVAICQPLHYTTVMSQGLYVSLVAGSWLFCCAHALLHTLLLVRLSFCADNTIPNFYCDLTVLLKMSCSDISLNELVIFTEGGMLFFLPLSSILGSYIR
IGSTVLRVPSIKRFFKVFSTCGSHLFVVSLYYGTLAGVYFFSSSWGSNDKDIIASVMYVVVTPMLNPFIYSLRNRDIKQALEIFINRANFFK*
593 >lcl|XP_001501347.2|Plus126257314..26258252 NW_001867396 olfactory receptor 1J4-like LOC100071522 __SEG__ Chr25 {Equus caballus} MRSENKSSVSEFLLLGLPITLEQQDLFFVLFLCMYLTTVMGNLLIILLIRLDSRLHTPMYFFLSHLAFSDISLSSITVPKMLKNMQTQQQSIPYMGCISQLYFFIVFGCL
DNFLLAVMAYDRYVAICQPLHYTTFMRQELCVSLVAGSWFFCCAHALLHTLLLVQLSFCADNTIPHFFCDLTALLKISCSDISLNELAIFTEGIMLLILPLTGVLGSYIC
IGTTILRDPSTKRLFKAFPTCGSHLLVVSLYYGTLAGVYFFSTSWDSNDKVVIASVVYTAVTPMLNPFIYSLRNRDIKHALEIFVNRAKFFQ*
594 >lcl|XP_001501362.2|Plus126238142..26239101 NW_001867396 olfactory receptor 1J2-like LOC100071531 __SEG__ Chr25 {Equus caballus} MRRDNESSVSEFILLGLPIWTENQGIYYTLFLVMYLITVLGNLLIILLIRLDSCLHTPMYFFLSHLAFTDISFSSVTTPKMLMNMQTQSQSISYAGCISQVCFFLFFGGL
DSFLLTSMAYDRYVAICHPLHYTTIMSQNICFLLVTVSCVLSCTGTLLHTLLLVRLSFCGDNTLPHFFCDLSTLLKLSSSDTTVNKLVILIVGTVVLTLPFICILVSYGH
IGGTILRVPSTKGICKALSTCGSHLSVVSLYYGAIIGLYFFPSSNNSNDKDVIVSLLYTLVTPMLNPFIYSLRNRDMKGALGNILSREKFHHDEHYFSY*
595 >lcl|XP_001501367.1|Plus131117042..31118133 NW_001867402 cannabinoid receptor 2 CNR2 __SEG__ Chr2 {Equus caballus} MERCWVTEAANGSTDGLDFNPMKDYMILSSSQKIAIAVLCTPLGLLSALENLAVLYLILASRRLHRKPSYLFIGSLAGADFLASVVFACNFVNFHVFHGVDSKAVFLLKI
GSVTMTFTASVGSLLLTAIDRYLCLRYPPTYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPSPCSELFPLIPNDYLLGWLLFIAILFSGIIYTYGHVLWKAHQHV
ARLAEHQDQDRQVPRIARMRLDVRLAKTLGVVLTVLVICWFPALALMVYSLTTTLNDQVKKIFAFCSMLCLVNSMVNPIIYALRSGEIRSSAHHRLARWKKRLRGLGLEG
KEEAPKSSVTETEVDVKITQWPDSRGLSCSDRG*
596 >lcl|XP_001501369.2|Plus126224659..26225597 NW_001867396 olfactory receptor 1J2-like LOC100071537 __SEG__ Chr25 {Equus caballus} MRPENQSSVSEFLLLGLLFPPEQQSLFFALFLGMYLTTVLGNLLIILLIRLNSHLHTPMYFFLSHLAFSDISLSSVAVPKILMNMQTQRQSISYMGCISQLYFFIVFGCL
DNFLLAVMAYDRYVAICHPLHYTTMMRQELCISLVAGSWFFSCAHALLNTLLLVQLSFCADNSIPHFFCDLTVLLKLSCSDISLNELVIFTEAAMVVILPLISILGSYIC
IGTTVLRVPSNKRLFKAFSTCGSHLFVVSLYYGTISGVYFFSSSWGSNDKDIIASVMYTVVTPMLNPLIYSLRNRDIKEALEMFVNRANFFK*
597 >lcl|XP_001501381.2|Plus126214303..26215259 NW_001867396 olfactory receptor 1J2-like LOC100071545 __SEG__ Chr25 {Equus caballus} MRPENQSSVSEFLLLGLPIPSEQQGIFFVLFLGVYLTTVLGNLLIILLIRLDSRLHTPMYYFLSHLAFTDVSFSSVTVPKMLMDMHINHKSIPFTGCMSQMYFFILFGCL
DNFLLGVMAYDRYVAVCHPMHYSTIMREELCVSLVVGSWFFCGAHALLHTLLLVQLSFCADNTIPHFFCDLPALLKISCSDISLNELVIFTEGGMLFILPLTSVLGSYIR
IGTTVLRVPSTKRFCKAFYTCGSHLFMVSLYYGTIAGVYFFSSSSISNDKDIIASVIYMIVTPLLNPFIYSLRNRDMKHALEIFVNRVKLFNLQSLNL*
598 >lcl|XP_001501401.2|Plus1complement(26198093..26199052) NW_001867396 olfactory receptor 1J1-like LOC100071560 __SEG__ Chr25 {Equus caballus} MRRENQSSMSKFIILGLPFWPEQQSMFLTLFLGMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDISFSSVTVPKMLMNKHTKYKSIPYAGSITQTYFFIFFAAL
DSFLITSMAYDRYVAICHPLHYTTIMSQSVCVMLVAGSWLITCACALLHTLLLAQLSFCADHTVPHFFCDLDALLKLSCSDTSLNQLLIFIVGIATIVLPFLGILVSYGH
IGATIVRAPSTQGIGKALSTCGSHLSVVTLYYGTIIGLYFLPSSNNTNDNNIIASLMYTVVTPMLNPFIYSLRNKDMKGALKKLLSKKTYSSKQYLPFF*
599 >lcl|XP_001501408.2|Plus126189176..26190114 NW_001867396 olfactory receptor 1J2-like LOC100071565 __SEG__ Chr25 {Equus caballus} MRRDNQSSVSQFLLLGLPIWTEKQGIYYTLFLVMYLTTVLWNLLIILLIRLDSRLHIPMYFFLSHLALTDVSFSSVTAPKMLMNMQTNRQSISYSGCISQVYFFLLFGGL
DSFLLTSMAYDRYVAICQPLHYTTIMSQNLCFLLVTVSWILSCTNALLHTLLLVRLSFYGDNSLPHFFCDLSTLLKLSSSDTTVNELVIVTVGVVVITLPFICILVSYVR
IGATVLKVPSTKGMYKAFSTCGSHLSVVSLYYGAIIGLYFFPSSSNSNEKDVIVSLLYALVTPMLNPFIYSLRNRDMKGALGNILSREKFSP*
600 >lcl|XP_001501413.2|Plus126176043..26176981 NW_001867396 olfactory receptor 1J4-like LOC100071570 __SEG__ Chr25 {Equus caballus} MRRDNQSSVSEFLLLGLPIWTEKQGIYYTLFLIMYLITVLGNLLIILLIRLDSHLHTAMYFFLSHLAFTDVSFSSVTAPKMLMNMQTQSQSISYAGCLSQVCFFLFFGCL
DSFLLTSMAYDRYVAICHPLRYTTIMNQDLCFLLVMVSWVLSCTSALLHTLLLVRLSFCGDNTLPHFFCDLSTLLKLSSSDTTVNELVILIVGAVVITLPFICILVSYGH
IGATIIRVPSTKGICKALSTCGSHISVVSLYYGAIIGLYFFPSSSTSNDKDVIVSLLYTLVTPMLNPFIYSLRNQDMKGALGNILSRGKFSP*
601 >lcl|XP_001501416.1|Plus143394115..43396241 NW_001867413 leucine-rich repeat neuronal protein 3 LRRN3 __SEG__ Chr4 {Equus caballus} MKDMPLQIHVLLGLAITTLVQAVDKKVECPQLCTCEIRPWFTPKSIYMEASTVDCNDLGLLNFPARLPADTQILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNI
NVKKMPQLLSVYLEENKLTELPEKCLSGLSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIA
GINLTEIPDNALVGLENLESISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLAVDNLPDLRKIEATNNPRLSYIHPNAF
FRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFREMMEICLPLIAPESFPSNVDLEAGSYI
SLHCRATAEPQPEIYWITPSGQKLLPNTLTDKFYVHSEGTLDISGITPTEGGLYTCIATNLVGADLKSVMIKVDGSFPQDNNGSLNIKIKDVQANSVLVSWKASSKILKS
SVKWTAFVKTETSYAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQKNRKQCVNVTTKGLDPDRKEYEKRNTTTYMACLGGFLGIIGVICLFSCLSQEMNLDGGHS
YVGNYLQKPSFAFSELYPPLINLWEAGKEKGTALEVKATVIGVPTNMS*
602 >lcl|XP_001501431.2|Plus126135222..26136163 NW_001867396 olfactory receptor 1J2-like LOC100071580 __SEG__ Chr25 {Equus caballus} MRKENQSSVSEFLLLGLPIRPEQQDMFFTLFLGMYLTTVLGNLLIILLIRLDSCLHTPMYFLLSHLAFTDVSLSSITVPKMLMDMHTKYKFISYAGCISQMYFFLFFTNL
DSFLIASMAYDRYVAICHPLHYTTIMKEQMCALLVAISWILSCASSLSHTLPLTQLSFCAANTVSHFFCDLGALLKLSCSDIFLNELVVFTVGVVVITLPFLCILVSYGY
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGAIFGQYLFPTLSNFINKDIIMAFMYMVVTPMLNPFIYSLRNRDMKKALGKLFSRATFFSQ*
603 >lcl|XP_001501433.1|Plus128595154..28596092 NW_001867389 olfactory receptor 10C1-like LOC100057346 __SEG__ Chr20 {Equus caballus} MCTNTSVVTEFILAGFSHLASLQGLLFSLFLTIYLLTVAGNLLIVVLVSADSALRSPMYFFLRILSALEIGYTSVTVPLLLHHLLTGQRHISRSGCALQMFFFLFFGATE
CCLLAAMAYDRYAAICKPLHYPLLLSHRMCLQLAGSAWACGAMVGLGHTSFIFSLPFCGPNAIPHFFCEIQPILQLVCGDTSLNELQIILAAALIILCPFGLILGSYGSI
LATIFRIPSAAGRCKAFSTCSSHLVVVSLFYSTAIFIYIRPKASYDPATDPLLSLFYAVVTPILNPIIYSLRNTDVKAALKRTIQKMKSAEI*
604 >lcl|XP_001501434.1|Plus14533905..4534906 NW_001877044 probable G-protein coupled receptor 174 GPR174 __SEG__ ChrX {Equus caballus} MPANDTCAGPYADNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLV
CISVRRFWFLMYPFRFNDCKQKYDLYVSIAGWLIICLACLLFPLLRTSDETTGNRTKCFVDLPTRNVNLAQSIAMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPVTQ
DLGEKKKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFTTNEFRRRLSRQDLHDSIQLHTKSFVGNHTTSTLTT
ELC*
605 >lcl|XP_001501435.2|Plus1complement(26120974..26121915) NW_001867396 olfactory receptor 1J1-like LOC100071584 __SEG__ Chr25 {Equus caballus} MRRENQSTVSEFLLLGLPIPPVQQGFFFALFLGMYLTTVLGNLLIILLIRLDSHLHTPMYFFLSHLAFTDVSFSSVTVPKMLMNMHTKHKSIPYAGCITQTYFFIFFADL
DSFLITSMAYDRYVAICHPLHYTTIMSQSICVMLVAGSSLIACACALLHTLLLAWLSFCADHTVPHFFCDLAALLKLSCSDTSLNQLLIFTAGLTAIMVPFLCILVSYGH
IGATILRVPSTQCICKALSTCGSHLSVVTLYYGAIIGLYFLPSSNNTNGNNIIASLMYTVVTPMLNPFIYSLRNKDMKGALRKLLNKKIYSPN*
606 >lcl|XP_001501443.2|Plus126105438..26106379 NW_001867396 olfactory receptor 1J2-like LOC100071594 __SEG__ Chr25 {Equus caballus} MRKDNQSSVSQFLLLGLPIWMKNQDIYYTLFLVMYLTTVLGNLLIILLIRVDSHLHTPMYFFLSHLAFSDVSFSSVTVPKMLMNMQTQSQSISYAGCISQVYCVLLFGGL
DSFLLTSMAYDRYVAICHPLHYITIMNQNLCFLLVTVSWVLSCTSALLHTLLLVSLSFCGENTLPHFFCDLSTLLKLSSSDTTANEWVILTEGSVATTLPFICILVSYGH
IGSTILRVPSTKGIYKAFSTCGSHLSVVSLYYGAIIGLYFFPSSNNSNDKDVIVSLLYTLVSPMLNPFIYSLRNRDMKGVLVNILSRGKFSPR*
607 >lcl|XP_001501446.2|Plus126070331..26071272 NW_001867396 olfactory receptor 1J2-like LOC100071600 __SEG__ Chr25 {Equus caballus} MRSENQSSVSEFFLLGLPIRPEEQSVFLALFLGMYLTTVLGNLLIILLLRLDSRLHTPMYFFVSHLALSDVSFSSVTVPKMLMNMQTQQLSISYVGCVSQMYFFILFVCL
DNFLLAVMAYDRYVAVCHPLHYTAVMRKELCVLLVAGYWFFSCAHALLHTVLFSRLSFCADNTIPHFFCDLTVLLKLTCSDTSLNELVIFIEGGVFAFLSFTAILGSYIC
IGVTILRVPSIKRICKALSTCGSHLFVVFLYYGTLAMIYFFPSSNSSKVKDIIASVMYTVVTPMLNPFIYSLRNRDMKLALGVLYRRGIIFAT*
608 >lcl|XP_001501467.3|Plus1complement(15220360..15221307) NW_001867402 putative olfactory receptor 2B3-like LOC100053497 __SEG__ Chr2 {Equus caballus} MQDFLWGNHSSLTEFILLGFSRNAEINVILFNVFLFLYLITLLGNGLIITLIHIDSHLHTPMYFFLSVLSILDMSYVTTTVPQMLVHLVCKKKTISYFGCVAQMYIFLML
GITESWLFAIMAYDRYVAICHPLRYKVIMNSLLCRLMVAFCGFWGISCALIYTVSAMILPYCGPNEINHFFCEVPAVLKLACADTSLNDQVDFILGFILLLVPLSLIIIV
YINIFVAVLRIRSTQGRLKAFSTCASHITVVTMFSIPCMVMYMRPGSEASPEEDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKVTAWGKAPE*
609 >lcl|XP_001501471.1|Plus14119871..4120983 NW_001877044 lysophosphatidic acid receptor 4-like LOC100071749 __SEG__ ChrX {Equus caballus} MGDRRFIDFQFQDLNSSLRPRLGNATANNTCVVDDSFKYNLNGAVYSVVFILGLITNSASLFVFCFRMKMRSETAIFIMNLALSDLLFVCTLPFKIFYNFNRHWPFGDTL
CKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEIVGFVIPLILN
VSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLEKFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINTHIKM
ESLFKTEMPLTTKPSLPAIQEEVSDQTTHNGGELMLESTF*
610 >lcl|XP_001501490.1|Plus131628519..31629649 NW_001867402 5-hydroxytryptamine receptor 1D-like LOC100071630 __SEG__ Chr2 {Equus caballus} MSPPNQSVEGLLQEGSNRSLNATETPEAWDPGTLQALKISLAVGLSTITLATVLSNAFVLTTIFLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTGTWSFGQIL
CDIWLSSDVTCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAHEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYSRI
YVAARNRILNPPSLYGKRFTTAHLIAGSAGSSLCSLNPNFHEGQSHSGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVASLVLPLCRDSC
WIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKIVHFRKAC*
611 >lcl|XP_001501556.1|Plus1complement(45051068..45052180) NW_001867413 probable G-protein coupled receptor 85 isoform 1 GPR85 __SEG__ Chr4 {Equus caballus} MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAF
MLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQF
VAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFA
QAGINPFVCIFSNRELRRCFSTTLLYCRKSRLPREPYCVI*
612 >lcl|XP_001501615.1|Plus1complement(9247778..9248857) NW_001867405 protein mab-21-like 2-like LOC100062495 __SEG__ Chr2 {Equus caballus} MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTG
KQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALESAAKQTWRLAREILTNPKSLDKL*
613 >lcl|XP_001501639.2|Plus1complement(30826245..30827183) NW_001867425 olfactory receptor 6X1-like LOC100071738 __SEG__ Chr7 {Equus caballus} MRNGTAITEFILLGFPGIQGLQIPLFIVIFFIYILTLAGNGLIIAIVWAEPSLQIPMYFFLCNLSFLEIWYTTTVIPKLLETFVVARTAICTPCCLLQVFFHFFLGTTEF
FILTVMSFDRYLAICKPLRYSTIMTSNLCLQLALSSWMVGFSIVFCQMLLLIQLPFCGDNIINHFYCDVGPILKAACADTRILELLGLIVTILVIPGSLMFTMISYIYIL
STILQIPSATGRQKALSTCASHLTVVSLLYGAVLFMYLRPTAHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKRALRKAMACPNTRHPE*
614 >lcl|XP_001501653.2|Plus1complement(30876132..30877079) NW_001867425 olfactory receptor 6M1-like LOC100071748 __SEG__ Chr7 {Equus caballus} MGNWSTVTEFTLTAFPAFLELRILLFVVLLLTYTLTATGNIIILSLIWTDNRLQTPMYFFLSNLSFLDILFTTTIVPKLLACLLEEKKTIPFAGCIIQVYFYFFLGTVEF
ILLAVMSFDRYVAICNPLRYTIIMNSRTCLLLVLGCWLGAFLSVLVPIIVVTRLPYCSKEINHFFCDIAPLLQAACVDTHLIEKMNFLLSALVILSSLAFTTGSYTYIIS
TILHIPSAQGREKAFSTCASHITVVSIAYGSNIFVYVRPNQNYSLNFDKIAAILITVVTPLLNPFIYSLRNEKVKEVLREAMDRIMSLILRKTRR*
615 >lcl|XP_001501661.3|Plus1complement(30918181..30919128) NW_001867425 olfactory receptor 6M1-like LOC100071756 __SEG__ Chr7 {Equus caballus} MNMQNQTTVTEFTLTAFPVLQKLQISLFVVLLFTYMLTLTGNIVIISLIWADNRLQTPMYFFLSNLSFLDILYTTSVTPKLLACLLEEKKTISFAGCITQISFFFFLGTV
EFILLAVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVICPVIVVSRLPFCYKEISHFFCDLAPLLHVACIDTHFIEMISFLLSSFILLSSLVFTTVSYTYI
VSTILSIPSVQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLDFDKVTAVLTIMVTPLLNPFIYSLRNEKVKEVLRDAVNKIVSLLHKRT*
616 >lcl|XP_001501666.2|Plus1complement(30933225..30934166) NW_001867425 olfactory receptor 6M1-like LOC100071761 __SEG__ Chr7 {Equus caballus} MQNQTTVTEFTLTAFPVLQKLQISLFVVLLFTYMLTLTGNIVIISLIWADNRLQTPMYFFLSNLSFLDILYTTSVTPKLLACLLEDRKIISFAGCITQTYFFFFLGTVEF
ILLAVMSFDRYVAICNPLHYTIIMNSRVCLLLVLGCWMGAFLSVLCPTIIVSRLPFCYKEISHFFCDIAPLLHVACIDTYFIEMINFLLSSLVLLSSLVLTTVSYTYIIS
TILSIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLDFDKVTAVLTTMVTPLLNPFIYSFRNEKVKEVLREAVCKSMSLLQRKT*
617 >lcl|XP_001501668.2|Plus1complement(30949363..30950310) NW_001867425 olfactory receptor 6M1-like LOC100071766 __SEG__ Chr7 {Equus caballus} MAIRNQSTVAEFILVSFPVVQELQILLFVILLLVYMLTITGNIVIISLIWTDNHLQTPMYFFLSNLSFLDILFTTTIAPKLLACLLEEKKTISFAGCIIQIYFYFFLGTV
EFILLAVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVLCPTIVVSRLPYCTEEISHFFCDIAPLLQVACIDTHFIEMINFLLSSLVVLSSLVLTIMSYTYI
ISTILRIPSAQGRQKAFSTCASHITVISIAYGSSIFMYVRPNQSYSLDFDKVTAVLTTVVTPLLNPFIYSLRNEKVKKVLRDSLNRIVPPHSKGT*
618 >lcl|XP_001501672.2|Plus1complement(30966367..30967383) NW_001867425 olfactory receptor 8D4-like LOC100071772 __SEG__ Chr7 {Equus caballus} MGNWRQAGILPVWSDSVLSSPQISQRRMGIRNHSRLTEFLLSGLTDQPELQLPLFCLFLGIYIVTMVENLGMISIIGLSSQLHTPMYYFLSSLSFVDFCYSSVITPKMLA
GFLCRDKTISYSGCMTQLFFFCIFVISECYMLAAMAYDRYVAICSPLFYNVIMSPRVCSLLVAAVFSVGVTDAVIHGGCILRLTFCGTNVIKHYFCDIIPLIKLSCSNTY
IDEILIFVIGGFNMVATSLTIIISYAFILSGILHIHSKEGRSKAFSTCSSHLTAVLIFYGSLMSMYLKPASSSSLTQEKVSSVFYTTVIPMLNRLIYSLRNKEVKNALMK
LIRRKISS*
619 >lcl|XP_001501714.2|Plus131086757..31087689 NW_001867425 olfactory receptor 8B3-like LOC100071811 __SEG__ Chr7 {Equus caballus} MASGNDSSVTQFILLGLTQRPELQLPLFFFFLGIYVITLVGNIGLLFLIGLNSHLHTPMYYFLFNLSFIDLCYSSVITPKMLMSFVKESIISYSECMAQLYFFSFFVIDE
CYILTSMAYDRYVAICKPLLYKVIMSHQICLMLMVGAYVMGFVGATAHAVCMMRLTFCDGNIINHYMCDIPPLLQLSCTSTYINELVVFLVVGINVIVPSLTISISYMLI
LSNILQIHSKGGRSKAFSTCSSHIITVSLFFGSSAFMYLKSSPAGSLDQDKLSTVFYTIVEPMMNPFIYSLRNKDVRIALSKTLNKRVLP*
620 >lcl|XP_001501723.2|Plus1complement(31107260..31108300) NW_001867425 olfactory receptor 10S1-like LOC100071816 __SEG__ Chr7 {Equus caballus} MAIYQSVDVSFVAKGISNHSVCERMTMETEDPNQTVVSHFFLEGLMYTAEHPSLFFLLFLLIYSITLTGNLLILITVGSDTHLCSPMYHFLGHLSFLDACLSTVTVPKVM
AGLLTLDGKVISFEGCAVQLYCFHFLASTECFLYTVMAYDRYLAICQPLHYPVVMNRHMYSGLAGITWAIGAVHSAVHTSLTFCLHYCGPHHIAYFFCDIPPVLKLACAD
TTVNELVMLANIGIVAAGCLILIVISYVFIVAAVLRIRTTKGRQRAFSTCTSHLTVVLLYYMPPVCIYLQPRSSGAGAGAPAVFYTIVTPMLNPFIYTLRNKEVKRALQR
LLCKGSQETPEGSPPP*
621 >lcl|XP_001501732.2|Plus131142920..31143855 NW_001867425 olfactory receptor 10G9-like LOC100071827 __SEG__ Chr7 {Equus caballus} MANVSLVTTFILMGLPHASALDTPLFGIFLVIYVLTVVGNLLILLVISVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTFISTGGRTISFRSCVAQLYSFHFLGSTE
CFLYTIMSYDRYLAICYPLRYTSMMSGRTCVLLAASTWLSGSLHSAIQTTLTFRLPYCGPNQIQHYFCDAPPILKLACADTSAIEMVIFVSIGIVASGCFLLIALSYVSI
VCSILKIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSKNAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKVPYSSSK*
622 >lcl|XP_001501749.3|Plus131180112..31181041 NW_001867425 putative olfactory receptor 10D4-like LOC100071851 __SEG__ Chr7 {Equus caballus} MRNHTAVTEFLLMGLSHTKGLENVLFVFFLAFYLLTLLGNLLILLAILISSNLHTPMYFFLGNLAVFDIFFPSVSSPKMMFYLMGQSRTISYQGCASQVFFYHFLGCTEC
FLYTVMAYDRFAAICHPLRYTVIMNHSVCTIMTLGTWMGSCLHASVLTFLIFKSPYCGPNEVGHLFCDIPVVLPLACADTSLAQTVSFTNVGVVSLTCFLLILTYTCIVI
SILKISSSEGRRRAFSTCSAHLTSILLFYGPVVFIYLRPASSPWLDSVVPVLNNIITPSLNPLIYALRNRDVKLALRKALIPGVHSCGA*
623 >lcl|XP_001501759.2|Plus1complement(31280537..31281469) NW_001867425 olfactory receptor 958-like LOC100071862 __SEG__ Chr7 {Equus caballus} MRNHTPVTEFLLMGIPHTKGLENVLFVFFLAFYLLTLLGNLLILLAILTSSNLHTPMYFFLGNLSVFDIFFPSVSSPKMMFYLMGQSQTISYQGCASQLFFYHFLGCAEC
FLYTVMAYDRFAAICHPLRYTVIMNHRLCTIMTLGTWMGSCLHASVLTFLIFKLPYCGPNEVDHFFCDIPVVLPLACADTSLAQTVSFINVGVVTLICFLLILTSYTRII
ISILKMSSSEGRHRAFTTCSAHLTSILLFYGPVIFIYLQPVSSSWLDSVVQVLNNIVTPSLNPLIYTLRNKDVKLTLRKVLIQRVHTCGA*
624 >lcl|XP_001501774.2|Plus1complement(31329754..31330785) NW_001867425 olfactory receptor 10G9-like LOC100071877 __SEG__ Chr7 {Equus caballus} MQLLHREWVLPFYINPECSLYSHRERYQKCGETTNVSLMTTFILMGFPHAPALDTPLFGIFLVIYLLTVVGNLLILLVISMDSHLHTPMYYFLANLSFIDMWFSTVTVPK
MLMTLVSPGGKTISFHSCMAQLYSFHFLGITECFLYTVMSYDRYLAISYPLRYSSMMSGRMCALLATTTWLTGSLHSAVQTILTFRLPYCGPQQIQHYICDAPPILKLAC
ADTSAIEMVIFFNIGVVASSCFLLIVLSYVSIVCSIFKIRTSEGRHRAFQTCTSHCIVVLCFFGPGVFIYLRPGSKNAVDGVVTIFYTVLTPLLNPVVYTLRNKEVKKAL
LKLKDKVTYSQSK*
625 >lcl|XP_001501778.2|Plus1complement(31355524..31356456) NW_001867425 olfactory receptor 958-like LOC100071880 __SEG__ Chr7 {Equus caballus} MRNHTPVTEFLLMGIPHTEGLENVLFVFFLAFYLLTLLGNLLILLAILTSSNLHTPMYFFLGNLSVFDVFFPSVSSPKMMSYLMGQSRTISYQGCASQLFFYHFLGCTEC
FLYTVMAYDRFAAICHPLRYTVIMNHRLCTIMTLGTWMGSCLHASVLTFLIFKLPYCGPNEVDHFFCDIPVVLPLACADTSLAQMVSFTNVGVVSLTCFLLILTSYTRIV
ISILKISSSEGRRRAFSTCSAHLTSILLFYGPVVLIYLRPASSPWLDSVVQVLNNIVTPSLNPLIYTLRNKDVKLALRNALIQGVSTLGA*
626 >lcl|XP_001501784.2|Plus131386164..31387099 NW_001867425 olfactory receptor 10G7-like LOC100071886 __SEG__ Chr7 {Equus caballus} MTNVSLVTTFILMGIPHAPALDTPLFGIFLVIYVLTVVGNLLILLVISVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLVSPGGKAISFHSCMAQLYAFHFLGSTE
CFLYTVMSYDRYLAISYPLRYTSMMSGRRCALLATTTWLTGSVHSAFQTMLTFRLPYCGSNQIQHYFCDAPPILKLACADTSANEIVVFVNIGVVTSGCFFLIVLSYVSI
ICSILKIRTSEGRHRAFQTCASHCVVVLCFFGPGAFIYLRPGSKDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKVKNESVFLRSK*
627 >lcl|XP_001501803.2|Plus187736289..87737227 NW_001867387 olfactory receptor 4F6-like LOC100071901 __SEG__ Chr1 {Equus caballus} MAGRNHSVVSEIVLVGLTSSLEMQLALFLVFSVFYVAGILGNLLIVLTVISDPHLHSPLYFLLANLSFIDMLVSSSTAPKMISDLFKERKVISFQGCIVQTFFVHIMGGT
EMVLLIAMALDRYVAIRRPLHYLNIMNFRTCILLLVASWTIGIIHSLIQLVFVVNLPFCGPNEVDSFYCDLPRLIRLACTDTYRLGLMVTANSGFISLGTFCILIISYIF
ILVTVWQRSSDGLSKALSTLSAHITVVVLFFGPCIFVYSWPFPTVPVDKFLAIFDVIITPFLNPTIYTFRNKEMQVAMRRIFSQVLSFKKLF*
628 >lcl|XP_001501808.1|Plus130407623..30409026 NW_001867396 zinc finger and BTB domain-containing protein 43 ZBTB43 __SEG__ Chr25 {Equus caballus} MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFL
QMWHVVDKCTEVLEGNPTVLCQKLNHSSDHQSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGAS
DSAEFHYTRPMYSKPSIMAHKRWIHVKPERFEQACEGMDVHAPYDEHQVTESINTMQTEHSVQPSGVEEDFHIGEKKVEAEFDGQADESNYDEQVDFYGSSMEEFSGERS
DGNLIGHRQEAALAAGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWR
DSFHRHVTSCTKSYEAAKAEQNTTEAN*
629 >lcl|XP_001501811.2|Plus1complement(31462811..31463755) NW_001867425 olfactory receptor 4D5-like LOC100071910 __SEG__ Chr7 {Equus caballus} MNPANHSQVTGFVLLGLSQVWELRFLFFIVFSVVYLMTVTGNLLIVAIVTSDPRLHTTMYFLLGNLSFLDFCYSSITAPRMLVDLLSGSPIISFGGCLTQLFFFHFIGGI
KIFLLTVMAYDRYVAISQPLRYTLIMNRTVCGLLLAASWVGGFTHSIVQVGLTIQLPFCGPNKLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTA
LLVMLRSHSQEDRSKALSTCASHIAVVTLIFVPCVYIYARPFQTFPMDKLVSVLYTMVTPMLNPAIYTLRNKEVIMAMKKLWRRQKDLLDPLKH*
630 >lcl|XP_001501813.2|Plus1complement(87771457..87772395) NW_001867387 olfactory receptor 4F21-like LOC100071911 __SEG__ Chr1 {Equus caballus} MDRANRSVVSEFVFLGLTNSWEIQLLLFVFSSTFYVASMTGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKRKVISFRGCITQIFFIHVIGSV
EMVLLIAMAFDRYVAICKPLHYLTILSPRMCIFFLVAAWMTGLIHSTIQLAFVVNLPFCGPNVLDSFYCDLPRFLKLACTDTDGLESMVTANSGFISIGSFIILIISYIV
IILTVQKHSSSGSSKALSTLSAHITVVVLFFGPLIFVSTWPSPSIHLDKFLAIFDTVLTPFLNSIIYTFRNKEMKLAIRRVCRRLVNYRKIS*
631 >lcl|XP_001501818.3|Plus1complement(31511374..>31512336) NW_001867425 olfactory receptor 8D4-like LOC100071915 __SEG__ Chr7 {Equus caballus} SSLQISQRRMAIRNHSRVTEFLLSGLTDQPELQLPLFCIFLGIYIVTMVGNLGMISIIGLSSQLHTPMYYFLSSLSALDFCYSSVITPKMLAGFLCRDKAISYSGCMTQL
FFLCIFVISECYTLAAMAYDRYVAICRPLLYNVIMSPRVCSLLVAAVFSVGVTDAVIHGGCILRLTFCGSNIIKHYFCDIIPLIKLSCSSTYIDEILIFVIGGFNMVATS
LTIIISYAFILSSILRIHSKEGRSKAFSTCSSHLTAVLIFYGSLMSMYLKPASSSSLTQEKVSSVFYTTVIPMLNPLIYILRNKEVKNALMKLVRRKTSS*
632 >lcl|XP_001501822.2|Plus187807382..87808320 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100071922 __SEG__ Chr1 {Equus caballus} MDGVNRSVVSEFVFLGLTNSWEIQLLLLVFSSTFYVASMTGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLGVSSVSCPKMMYDLFRKRKVISFSGCITQMFFIHFVGGV
EMVLLISMAFDRYVAICKPLHYLTIMSPRMCIIFLVAAWMTGFIHSMVQLAFVVNLPFCGPNVLDSFFCDLPQFIKLACIDTARLEFMVTANSGFISVGSFFILIISYII
IILTVQKRYSAGSSKALSTLSAHITVVVLFFGPLILVYTWPSPSVHLDKFLAIFYAVLTPFLNPLIYTFRNQEMKVAMRRVCRQLVIYRKIS*
633 >lcl|XP_001501826.2|Plus131569130..31570068 NW_001867425 olfactory receptor 958-like LOC100071925 __SEG__ Chr7 {Equus caballus} MKMRNHTPVTEFLLMGIPHTKGLENVLFVFFLAFYLLTLLGNLLILLAILTSSNLHTPMYFFLGNLSVFDIFFPSVSSPKMMLYLMGQSRTISYQGCASQVFFYHFLGCT
ECFLYTVMAYDRFAAICHPLRYTVIMNHRVCTIMTLGTWMGSCLHASVLTFLIFKLPYCGPNEVDNFFCDIPMVLSLACADTSLAQTVSFTNVGVVSLICFLLILTSYTR
IVISILKISSSEGRCRTFSTCSAHLTSILLFYGPVFLTYLQPASSSWLDSVVPVLNNIVTPSLNPLIYTLRNKDVKLALRKALMQGVHTCGA*
634 >lcl|XP_001501830.2|Plus1complement(31590867..31591802) NW_001867425 putative olfactory receptor 10D4-like LOC100071929 __SEG__ Chr7 {Equus caballus} MRNHTMVTEFILLGIPETEGLETVLFSLFLLLYLCTLLGNVLILTAIILSSQLHTPMYFFLGNLSVFDLGFSSTTVPKMLLYLSGQSQGISLQGCVSQLFFYHFLGCTEG
FLYTVMAYDRFVAICYALRYMVIMNHKVCLILATGTWIGGCVHAITLTSLTFQLSYCGSNEVGYYFCDIPAILPLACGDTSLAQRVGFTNVGLLSLICFFLILVSYARIG
ISISKIRSAEGRQRAFSTCSAHITAILCAYGPVIIIYLQPNPSPLLGATIQIFNNLVTPMLNPLVYSLRNKDVKSALRNAFPKRSLALENK*
635 >lcl|XP_001501838.2|Plus1complement(87835505..87836443) NW_001867387 olfactory receptor 4F6-like LOC100071941 __SEG__ Chr1 {Equus caballus} MDEANLSVVSEFVFVGLSNSWEIQLFLFLFSSVFYVASLMGNLLIVLTVTSDPHLQTPMYFLLANLSIMDLIFCSSTPPKMIYDLLRKHKTISFWGCIVQIFFTHTSGGT
EMVLLITMAFDRYIAICKPLHYLTIMSPRRCIIFLVTSWVIGLIHSVTQLVFVVDLPFCGPNELDSFVCDLPRFVKLACTETYTLEFMVTANSGLISVASFLILIISYIF
ILATVQKKSSGGISKALSTLSAHVTVVVLFFGPLIFFYVWPFPTSHLDKFLAIFNSVITPFLNPVIYTFRNKEMKVAMRKLCTQVINYSKIS*
636 >lcl|XP_001501848.2|Plus1complement(87862986..87863924) NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100071951 __SEG__ Chr1 {Equus caballus} MDGANHSVVSEFVFLGLSNSWGIQLLLFLFSTVFYMASMMGNLLIVFSVRADPNLHSPMYFLLANLSFLDLGVCSIAAPKMIYDLFRKHKAISFTGCITQIFFIHAIGGT
EMVLLIAMAFDRYVAICKPLHYLTIMSPRMCILILAVAWVLGLIHSVAQLAFVVDLPFCGPNILDSFYCDLPQLIKLACTETNRLEFMVTANSGLISVGSFFILIISYIF
ILVTVWKHSSGGLTKALSTLSAHVTVVVLFFGPLIFFYTWPFPSSRLDKFFAIFDAVLTPFLNPVIYTFRNKEMKAAMKKLCHQLVGYRKMS*
637 >lcl|XP_001501864.2|Plus131794364..31795299 NW_001867425 olfactory receptor 149-like LOC100071961 __SEG__ Chr7 {Equus caballus} MRNASVVTEFILLGIPHTEDLEAMLFVLFLSFYIFTLMGNLLILLAIVSSTRLHTPMYFFLCKLSVCDIFFPSVSSPKMLFYLSGSSRAISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLSYTIIMSHRVCGVLAMGTSLFGCIQATFLTTLTFQLPYCGPNEVDYYFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSRIV
YSILQIRSAEGQRHAFSTCSAHLTAILLFYMPVVLIYLRPTPSPWLDATVQVLNNLVTPMLNPLIYSLRNKEVKSSLRKVLHQLALLPDQL*
638 >lcl|XP_001501866.2|Plus1complement(87897619..87898557) NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100071963 __SEG__ Chr1 {Equus caballus} MDGENSSVVSEFVFLGLTNSWEIQLLLFVLSSMFYVASMMGNSLIILTVTSDPHLHSPMYFLLANLSFIDLGVSSVSSPKMIYDLFRKHKVISFRGCITQIFFIHIIGGV
EMVLLIAMAFDRYVAICKPLHYLTIMSPRMCVFFLVAAWMTGLIHSTVQLVFVINLPFCGPNVLDSFYCDLPRFIKLACTDTYQLEFMVTANSGFISVGSFFILIISYII
IILTVQKHSSAGSFKALSTLSAHITVVVLFFGPLIFFYTWPSPSTYLDKFLAFFDAVLTPFLNPLIYTFRNQEMKVAMRRIFRQIVNYRKIS*
639 >lcl|XP_001501873.2|Plus1complement(87915625..87916563) NW_001867387 olfactory receptor 4F21-like LOC100071966 __SEG__ Chr1 {Equus caballus} MDGANHSVVSEFVFLGLTNSWEIQLLLFVLSSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLAVSSVTSPKMIYDLFRKRKLISFRGCITQIFFIHVIGGV
EMVLLIAMAFDRYVAICKPLHYLTIMSPRMCVFFLVAAWMTGLIHSTVQLAFVVNLPFCGPNVLDSFYCDLPQFIKLACTDTYQLENMVTANSGFISVASFFILVISYIV
IILTVQKHSSSGSSKALSTLSAHITVVLLFFGPLIFFYTWPCPSRHVGKFLAIFDAVLTPFLNPVIYTFRNQEMKVAMRRLCRQLVNYRKIS*
640 >lcl|XP_001501878.2|Plus131831829..31832767 NW_001867425 putative olfactory receptor 10D3-like isoform 1 LOC100071971 __SEG__ Chr7 {Equus caballus} MEKKNDSLVTEFILLGIPHTEGLETILFVLFLPFYACTLLGNLSILVAVLSSTCLHTPMYFFLGNLSVFDMSFSSVTCPKMLLYLMGLSPIISYKACVSQLFFFHFLGSI
ECFLYTVMAYDRFTAICYPLRYTVIMNPRICVALAVGTWLLGCIHSSILTLLTFILPYCGPNEVDHFFCDIPALLPLACADTSLAQKVSFTNVGLVSLICFLLILVSYTR
ITISILSIRSTEGRHRAFSTCSAHLIAILCAYGPIITVYLQPTPNPMLETVVQILMNLVGPMLNPLIYTLRNKEVKTALKKILHRTNYVSES*
641 >lcl|XP_001501881.2|Plus1complement(87935700..87936638) NW_001867387 olfactory receptor 4F15-like LOC100071974 __SEG__ Chr1 {Equus caballus} MNGRNHSIVSEFVFLGLTNTWEIQLLLFVLSFLFYFASVMGNLVIVFTVTLDAHLHSPMYFLLTNLSVIDMLFCSIIAPKMIYDIFKKHKAISFCGCITQIFCSHAVGGT
EMVLLIAMAFDRYVAICKPLHYVTIMSPRICLYFLVTSWIIGLIHSLVQLVFVVDLPFCGPNVLDSFYCDLPRLLRLACTNTQELEFMVTVNSGLISVGSFALLVISYVF
ILFTVWKHSSGGSSKALSTLSAHITVVVLFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKEMKVAMRRLCVRLVHAGKIS*
642 >lcl|XP_001501885.2|Plus131883148..31884083 NW_001867425 olfactory receptor 8G2-like LOC100071983 __SEG__ Chr7 {Equus caballus} MDTGNHSTVTEFILTGLTDHAELQLPLFFLFIGIYVVTVLGNLGMITLIGLSSHLHTPMYYFLSSLSFIDLCHSTVITPKMLVNFLTEKNVISYPKCMTQLYFFIIFAIA
ECHMLAAMAYDRYVAICNPLLYNVIMSYHICFWLTVGVYILGILGSTVHTGFMLRLFFCKTNVINHYFCDLFPLLELSCSSIYINELLVLVLSAFNILTPALTILASYIF
ILSSILQIRSTGGRSKAFSTCSSHISAVAVFFGSAAFMYLQPPSVSSMDQGKVSSVFYSIIVPMLNPLIYSLRNKDVKFALKKILDSKKFS*
643 >lcl|XP_001501888.2|Plus131894775..31895749 NW_001867425 olfactory receptor 8G1-like LOC100071988 __SEG__ Chr7 {Equus caballus} MCLSFSPSETSQRKMALGNHSTVTEFILTGLTEEPELQVPLLLLFLGIYVVTVMGNLGMITLIGLSSHLHTPMYYFLSSLSFTDLCHSTIITPKMLVNFVTEKNVISYPQ
CMTQLYFFLVFAISECYMLAAMAYDRYVAICSPLLYNVIMSHQVCFSLILGVYIIGLICAFAHTACMLRVNFCKFYVINHYFCDLLPLLKLSCSSTDVNELLILCVGTFN
IFAPSLTILSSYIFIISSILHIHSTEGRSKAFSTCSSHMLAVLLFFGSAAFMYLQPSSVGSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVNVALKKMLKSRIF*
644 >lcl|XP_001501894.2|Plus187992857..87993795 NW_001867387 olfactory receptor 4F21-like LOC100071996 __SEG__ Chr1 {Equus caballus} MDGDNHSVVSEFVFLGLTNSWEIQLLLFVFSSTFYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHKVISFSGCITQLFFIHVIGSV
EMVLLIAMAIDRYVAICKPLHYLTILSPRMCIFFLVVAWMTGLIHSTVQLALVVNLPFCGPNVLDSFYCDLPWIMKLACTDTDRLESVVTANSGFISVGTFFMLIISYII
IILTVQKHSSAGSSKALSTLSAHIIVVVLFFGPLIFVFIRSSPSLHLDKFLGFFDVVFTPFLNPLIYTFRNQEMKVAVRRVCRQLVNYWKIS*
645 >lcl|XP_001501897.2|Plus131928810..31929742 NW_001867425 olfactory receptor 8G1-like LOC100071999 __SEG__ Chr7 {Equus caballus} MAAGNHSAVTEFILAGLTEQPELQLPLFLLFLGIYVVTVVGNLGMIALIGLSSHLHTPMYYFLSNLSFIDFCQSSVITPKMLVSFVTEKNIISYPECMTQLYFFLIFGVS
ECYMLAAMAYDRYVAVCSPLLYSVIMSHQACFSLILGVYIIGLVCAFAHAGYMFRIHFCNIDVISHYFCDLLPLLNLSCSSTYVNKLLILCVGTLNIFVPSLTILSSYSF
ITASILRIHSTEGRSKAFSTCSSHMLAVLLFFGSAAFTYLKPSSVTFMNQGKVSSVFYTIVVPMLNPLIYCMRNKDVNVALKKMLKRRTL*
646 >lcl|XP_001501902.2|Plus188031624..88032649 NW_001867387 olfactory receptor 4K17-like LOC100072004 __SEG__ Chr1 {Equus caballus} MKKLGNLHSISAFFFLSTGHPRPNHTMESMQQLNQSQVSEFILLGLTNSQDIQFLLFALFSVIYVATVSGNLLIVVTVFYIPNLYTPMYFLLGNLSFVDMILASFITPKV
IVNLVKKQKTISFAGCFTQIFLLHLLGGVEMVLLVSMAYDRYVAICKPLHYMTIMNKKVCVLLVVTSWFLGLLHSGLQIPFVVNLPFCGPNVVDSIFCDLPLVAKLACVH
TYIVQIVIVANSGMISLSCFVILLISYSLILLTVRNHSSTGQSKARATLTAHITVVILFFGPCIFIYIWPFSNHSVDKFLAVFYTIVTPILNPIIYTLRNKEMKTAMKTL
WGAFLSSREDT*
647 >lcl|XP_001501905.3|Plus188043728..88044666 NW_001867387 olfactory receptor 4K3-like LOC100072007 __SEG__ Chr1 {Equus caballus} MDKGNLSVVSEFMLLGLCHSWNMQVLFLMIFFMLYLIIISGNIFITILIITDPQLHSPMYFLLANLSFIDMWLSSVTTPKMLTDFLRENKTISFGGCMCQIFFVHIFGGS
EMGLLVVMAYDRYVAICKPLHYSTIMSLEKCIGLVATSWTIGFVHAMSQMIVIMQLPFCGPRELDSFFCDIPLVIKLACMDSYNLGILMNADSGVLAMTCFVLLLISYTY
ILLIVHQSSKTGASKALSTCAAHITVVVLFFGPCIFIYVWPLSITWVDKFLAVFYSVITPLLNPAIYTLRNKDIKSAMKRFRSYYMHSKGNS*
648 >lcl|XP_001501910.2|Plus131984166..31985161 NW_001867425 olfactory receptor 8G5-like LOC100072010 __SEG__ Chr7 {Equus caballus} MKFFQQLCFPLSSAETLQRKMAAGNHSTVTEFILAGLTEQPELQLPLFLLFLGIYVVTVVGNLGMIALIGLTSHLHNPMYYFLSSLSFIDFCHSTVITPKMLGNFATEKN
IISYPECMTQLYFFLVFAISECYMLAAMAYDRYVAICSPLLYNVIMSHQVCFSLILGVYIIGLICAFAHTGCMLRVHFCKFYVINHYFCDLLSLLKLSCSSTYVNKLLIL
IFSAINILVPSLTILSSYIFIIASILHIRSTEGRSKAFSTCSSHILAVAVFFGSAAFMYLQPSSVSSMDQGKVSSVFYTIVVPMLNPLIYSLRNKDVNVALKKMLERRIF
L*
649 >lcl|XP_001501913.2|Plus132006414..32007349 NW_001867425 olfactory receptor 149-like LOC100072013 __SEG__ Chr7 {Equus caballus} MTNTSAVTEFILLGIPHTENLEAILFVLFLVFYFFTLVGNLLILLAIASSTRLHTPMYFFLCKLSVCDIFFPSVSSPKMLFYLSGSSRAISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYIIIMSHRLCAILAIGTSFFGCIQATFLTTLTFQLPYCGPNEVDYYFCDIPVMLKLACADTSALEIVGFISVGLMPLSCFLLILTSYSCIV
CSILQIQSAEGRRSAFSTCSAHLTAILLSFMPVVLIYLQPTPKPWLNATVQVLNNLVTPMLNPLIYSLRNKEVKCSLRKVLQQVAFLPEKS*
650 >lcl|XP_001501914.2|Plus1complement(88065293..88066231) NW_001867387 olfactory receptor 4F6-like LOC100072015 __SEG__ Chr1 {Equus caballus} MNKTNYSPVTEFVFLGLSASRPVQHLLLAFSTVFYVTNVLGNLSVVFTVVFDPRLHSPMYFLLANLSFIDLCFSTITVPKMICDLYSGHKTISFQGCVIQIFVLHVLGGS
EMVLLITMAVDRYVAICKPLHYLTIMSPQMCILLLSGAWAIGLTHSVAQSAFAVHLPFCGPNEIDSFYCDLPRFIKLACTDIHRMEFMVTANSGFISMGTFFLLIISYIF
MLVTVGKHSSGGLSKALSTLLAHITVVVLFFGPCIFAYMWPFPTVPVDKFLAILDFMITPILNPIIYTLRNKDMKMAMRRLSIQLLSLRKIS*
651 >lcl|XP_001501917.2|Plus132037225..32038181 NW_001867425 olfactory receptor 8A1-like LOC100072016 __SEG__ Chr7 {Equus caballus} MHRGNHSSVTEFILEGLTDQPGLRLPLFFLFLFIYMVSIVGNFSLVFLIRISSQLHTPMYYFLSNLSFIDLCLSSVIIPKMLVNFISEKNFTSLPECMAQLFFFCFFGIG
DSYMLTVMAYDRYVAICNPLLYNVTMSRRVCFLLVMSVYIVGAIGALVHASYIASRSFCGTNIIHHYFCDILPLLNISCSRDYTKELLVMILVGFNVFACALAIFISYAF
ILSSIMCIRSGEGRSKAVSTCSSHLAAVGVFYGSIIFMYFKPSTSDTTQEKVSSVFYTTVIPMLNPLIYSLRNKDVKESLKKLCMVGYFLNMCRKQHF*
652 >lcl|XP_001501918.2|Plus188094882..88095820 NW_001867387 olfactory receptor 4K3-like LOC100072017 __SEG__ Chr1 {Equus caballus} MEEANQSVVSEFIFRGLCNSRELQTFLLMPFSILYMMTVVGNLLVVSLIFTDPHLHSPMYFLLANLSFVDFCLSSVTTPKLTTDFLKENKTISFGGCMSQILCVHIFAGG
EMVLLVSMAYDRYVAICKPLRYFSIMNRQKCILLVLISWIIGFVHAMSQLAMILELPFCGPRIVDSFFCDIPLVIKLACMDTHTLGILINTDSGVLATSCFILLLISYTY
ILVTVRLHSKDGASKALSTCTSHITVVVLFFGPCIFIYLWPLSVTSVDKFLAVFYTVITPLLNPAIYTLRNKEIKNAIKRLVNQNVESRDNF*
653 >lcl|XP_001501920.2|Plus1complement(32058174..32059106) NW_001867425 olfactory receptor 8B3-like LOC100072019 __SEG__ Chr7 {Equus caballus} MARGNGSFITQFILVGLTDQPDLKLPLFFLFLVMYIVTVLGNMGLITIIGLNSYLHTPMYFFLFNLSFIDLFYSSTFTPKMLVNFIFKQNIISYMGCMTQLYFFCFFSIS
ECYVLTSMAYDRYVAIRKPLLYSVVMSPKVCSSLMLGSYFMAFSGATAHTGCMLRLTFCDANTINHYLCDIFPLLQLSCTSTYVNELEVFIVGGINVIVPSVAIFVSYGF
ILSSILHISSTEGRSKAFGTCSSHIIAVSLFFGSAAFMYLKPSSAVSMGEGKISSVFYTNTVPLMNPLIYSLRNKDVKIALRKTLSMRRF*
654 >lcl|XP_001501929.2|Plus188123354..88124289 NW_001867387 olfactory receptor 4F15-like LOC100072025 __SEG__ Chr1 {Equus caballus} MGGLNDSVVTEFVLLALSCSWEKKFFLILICFLLYLGVIVGNVFILFLVIFDSHLHSPMYFLLANLSLIDVGLSSTTVPKIITDLLYEYTLISFKSCMTQICFIHIIGGV
EMVLLIAMAFDRCTAICKPLHYLNIMNPKICILFVITGWVTGVIHAMSQFLFVMNLPFCGPNKVDSFYCDFPKIIKLACTNGAKLEFIVTANSGFMSMGTFILLILSYSF
ILVTVWKRSSGDLSKAFVTLSSHIIVVFLFFTPCMFLYVWPSPPPSLDKNLFIVDFAITPVLNPTIYTLRNKDIKVAIKRLCKKISYSRFC*
655 >lcl|XP_001501934.2|Plus132095313..32096248 NW_001867425 olfactory receptor 8G2-like LOC100072027 __SEG__ Chr7 {Equus caballus} MDPGNHSTVTEFILAGLTDHAELQLPLFLLFLGIYVVTVVGNLGMITLISLSSHLHTPMYYFLSNLSFIDFCHSSVITPKMLLNFVTEKNVISYPDCMTQLYFFIVFIIA
ESHMLAAMAYDRYVAICNPLLYNVIMSCYICFWLTVGVYILGIIGSTIHTGFMLRLFFCKTNVVNHYFCDLFPLLELSCSSIYINELLVIVLSAFNILTPASVILASYIF
ILSSILQIRSKEGRSKAFSTCSSHISGVAVFYGSTAFMYLQPSSVSSMDQGKVSSVFYTIIVPMLNPLIYSLRNKDVKFALKKILDGRICS*
656 >lcl|XP_001501936.2|Plus1complement(88172362..88173300) NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072028 __SEG__ Chr1 {Equus caballus} MDGGNHSIVSEFVFLGLTHSWEMQLLLLVFSSVLYVASLTGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGV
EMVLLIAMAFDRYVAICKPLRYQTIMSPQMCILFLAAAWALGISHSLFQLAFIVNLPFCGPNVLDSFYCDLPRVLRLACTDTYRLQFMVTVNSGFICVGSFFILLISYIF
ILFTVWKHSSGGSSKALSTLSAHITVVLLFFGPTMFVYTWPHPNSQMDKFLAVLDAVLTPFLNPVIYTFRNKEMKAAMKRVCKQLVTYRKIS*
657 >lcl|XP_001501943.1|Plus124329501..24330475 NW_001867427 olfactory receptor 51D1-like LOC100053560 __SEG__ Chr7 {Equus caballus} MQKPQLLVPVMAIPNGTLIHPAYFLLVGIPGLGPNIHFWLAFPLCFMYALATLGNLAIVLIIRVERRLHEPMYLFLAMLSTIDLVLSSVTMPKMASLFLTGIQEIEFNVC
LSQMFLIHALSAMESAVLLAMAFDRFVAICHPLRHASVLTGPTVAKIGLAALTRGFVFFFPLPFILKRLSYCQTHTVTHSFCLHQDIMKLSCTDTTVNVVYGLFVILSVM
GVDSLFIGFSYVLILRAVLELSSRGASLKAFNTCISHLCAVLVFYVPLIGLSVVHRLGGPTSLLHVIMANIYLLLPPVVNPLVYGAKTKEIRSWVLNMFLQDGR*
658 >lcl|XP_001501945.2|Plus1complement(88187966..88188937) NW_001867387 olfactory receptor 11G2-like LOC100072033 __SEG__ Chr1 {Equus caballus} MSSRLMNASGRETTSSVSHFILMGFPSSPEMQLLCFGLFSVAYTLSIMGNAIIVCAVWWDWHLHTPMYIFLGNFSLLEICYVTTTIPNTLVNFLSTSKSISFVSCFTQFY
FFFSFGCDECFFLCIMAFDRYLAICHPLHYPRTMTKQLYTGLVIFGWSCGFILFLTPVVLISQLPYCGPNIINHFVCDPVPLMMLSCSEDTITQITYSTFNDVFMIGTFL
FILCSYALVILAVLRMPSEASKQKAFSTCASHLSVVILFFGSVMVMYVSPGSGHPVKMQKFITLFYSVITPLCNPIIYSLRNKEMKAALRKMFGTEQGVHKHK*
659 >lcl|XP_001501948.2|Plus1complement(32174260..32175192) NW_001867425 olfactory receptor 8B3-like LOC100072035 __SEG__ Chr7 {Equus caballus} MAHGNGSFITQFILVGLTDRPDLQLPLFFLFLIMYMVTVLGNMGLITLIGLNSHLHTPMYFFLFNLSFIDVCYSSVFTPKMLVNFISKKNIISYIGCMTQLYFFCFFIIS
ECYVLTAMAYDRYVAICKPLLYNVAMSPKVCSNLMLGSYFMAFSGAMAHTGCMLRVTFCDANTINHYLCDIFPLLQLSCTSTYINELEVFIVVGINIIVPSVTIFVSYGF
ILSSILHISSTEGRSKAFGTCSSHIIAVSLFFGSAAFMYLKPSSAVSMDEGKISSVFYTNTVPLMNPLIYSLRNKDVKIALRKTLSMRNF*
660 >lcl|XP_001501953.2|Plus188237195..88238142 NW_001867387 olfactory receptor 4Q3-like LOC100072040 __SEG__ Chr1 {Equus caballus} MKKDNGSKVTEFVLLGLSSSWELQLFLFLIFLLFYIAIVLGNLLIVVTVRADAHLLQSPMYYFLGHLSFIDLCLSCVTVPRMLGDFLQQGKIISFSGCLAQIYFLHFLGA
SEMFLLTVMAYDRYVAICNPLHYLIVMNRQLCLQLVFACWCWDFIHSITQVALVIQLPFCGPNELDNFYCDVPQVIKLACMDTFVVEVLMVSNSGLLSLICFLVLLFSYA
VILITLRTCFHHGRSKALSTCASHLIVVSLIFVPCVFVYLRPFCSFSVDKVFSVFYTVITPMLNPLIYTLRNADMKTAMKKLRKKHVASFCHVKG*
661 >lcl|XP_001501958.2|Plus1complement(32197248..32198204) NW_001867425 olfactory receptor 8B3-like LOC100072044 __SEG__ Chr7 {Equus caballus} MASGNRSFMTEFTLLGLTDQPYLQLPLFFLFLVMYIFTALGNLGMMILIGLNSNLHTPMYFFLFNLSFIDFFYSSVFTPKMLVNFISKENIISYMGCMTQLYFLCFFGIS
ECYVLTSMAYDRYVAIRKPLLYSVVMSHKVCSSLMLGSYLMAFSGAMAHTGCMLTLTFCDANTINHYFCDIFPLLQLSCTSTYVNELEVFIVVGINVIVPSVTIFVSYGF
ILSSILHISSTEGRSKAFGTCSSHIIAISIFFGSGAFMYLKPSSAASMNEGKISSVFYTNTVPLMNPLIYSLRNKDVKLALRKTQDKVLIRFSICLCT*
662 >lcl|XP_001501966.3|Plus188266379..88267302 NW_001867387 olfactory receptor 4N2-like LOC100072052 __SEG__ Chr1 {Equus caballus} MESNNSTVVSEFILLGLTQSRDIQLLVFVLVLIFYLIILPGNFLIILTIRLDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSDKKVISYKCCITQLFFLHFLGGG
EALLLVVMAFDRYMAICRPLHYSTVMNPRACYVLLLALWLGGFVHSIIQVALILHLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAV
ILCHVRGSSSEGKSKAMSTCTTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKSSMKRLFNQHTA*
663 >lcl|XP_001501984.2|Plus1<32271957..32272916 NW_001867425 olfactory receptor 8G2-like LOC100072065 __SEG__ Chr7 {Equus caballus} NLESTERIMDHENHSTVTEFILAGLTDHAELQVPLFLLFLGIYVVTVVGNLGMITLISLSSHLHTPMYYFLSSLSFIDFCQSSVITPKMLVNFVTEKNTSSYPECMTQLY
FFIIFAIAECHMLAVMAYDRYVAICNPLLYNVIISYHICFWLTVGVYILSIIGSTIHTSFMLRLLFCKSNVVNHYFCDLFPLLELSCSSIYVNELLVLGLSAFNILIPAL
TILASYIFILSSILHIRSTEGRSKAFSTCSSHISAVAVFFGSLAFMYLQPSSVSSMHQGKVSSVFYTIIVPMLNPLIYSLRNKDVKFALKKILDSRTCS*
664 >lcl|XP_001501990.2|Plus188307695..88308642 NW_001867387 olfactory receptor 4K3-like LOC100072071 __SEG__ Chr1 {Equus caballus} MDQGNNSGVTEFVLHSLSGSQELQLFYFALFTLFYLSIVLGNLLIVLTVVSEPALHSPMYFLLGNLSCIDVCLSTFATPKMIVDFLMDHKTISFEGCMAQIFFLHVFAGG
EMMLLVAMAYDRYVAICRPLHYATIMNVRKCTILVVGSWLIGVLHSVSQLVFTVNLPFCGPNKVDSFFCDLPLVIKLACTDTFTLEVLMLSDSGLMAMSSFVLLLTSYTV
ILVTVRRHSSVGMAKARATLTAHITVVTLFFGPCIFIYAWPFSDLPVDKLLSIFYTVFTPLLNPLIYTLRNKEVTSAMQKLSRQVSSCRSPSSPL*
665 >lcl|XP_001501996.1|Plus118247328..18248278 NW_001867422 olfactory receptor 12-like LOC100067171 __SEG__ Chr6 {Equus caballus} MAPHRDGNVSAVPLQEFVLEGFEGSLGTQALLFAVFLALYLGTVLGNLTMIVVITLDARLHSPMYFFLKNLSFLDLCYSSVIAPNALANFFSSSKVITFQGCAAQLFFFS
LLGTTEAFLLAVMAYDRFMAICSPLRYPITMCPSACFCLVLGSYCGGCLNSIVQTASTFSLPFCSSNHIDHFFCDVTPLLRLACASTAINELLLFGLCGLIIVGTTLLVL
VSYGYITVTILRMQSGAGRHKVFSTCGSHMMAVSLFYGTGFVMYAQPGAVESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEALGRLRPKHTAT*
666 >lcl|XP_001501997.2|Plus1complement(32387508..32388443) NW_001867425 olfactory receptor 145-like LOC100072080 __SEG__ Chr7 {Equus caballus} MDIGNSSLVAEFILVGLTTYSEIQLPLFFLFLGIYIVTVTGNLGLVTLIGLNSHLHAPMYYFLFNLSLIDLCYSSVITPKLLVNFVSKMNTISYAGCMTQLFFYCFFVSA
ECYMLTVMAFDRYVAICKPLQYTVTMSPQVCSLLAVIVYVGAFVGAWAHTGCMLRLTFCDANTINHYMCDILPLLELSCTSTHINELVVLIVVGFDVSVPSLTIIVSYSF
ILSSILRIRSTEGRSKAFSTCSSHIIVVSIFFGSGAFMYLHPSSVLSMDQGKVSTVFYTIVAPMLNPLIYSFRNKEVKVALKKNLSRISFS*
667 >lcl|XP_001502000.3|Plus1complement(32400001..32401089) NW_001867425 olfactory receptor 8B3-like LOC100072086 __SEG__ Chr7 {Equus caballus} MVVVKIESMDPGGVTLRHSQCIHTLVEQDIAGRAELFSNVTLFSCFHRFPQRKMAAGNGSFVTEFILFGLTDQPDLQLPLFVLFLVMYIVTVLGNLGLIILIGLNSHLHT
PMYFFLFNLSFIDLCYSSVFTPKMLINFISKTTISYVGCMTQLYFFCFFAISECYVLTSMAYDRYVAICKPLLYNVVMSPKVCSSLMLGSYLMAFSGAMAHTGCMLRLTF
CDANIINHYLCDVLPVFQLSCTSTYINELVVFIVVGINIIVPSVTIFVSYALILSSILHISTTEGRSKAFRTCSSHIIAVSLFFGSLAFMYLKPPSVMSMDKGKVSSVFY
TNVVPTMNPLIYSLRNKDVKLALRKTLNSRKF*
668 >lcl|XP_001502005.2|Plus1complement(88410335..88411273) NW_001867387 olfactory receptor 4K13-like LOC100072092 __SEG__ Chr1 {Equus caballus} MERSNNSVVSEFILLGLSKSQNLQILFFLGFSVVYAGIVLGNLLILVTVTFDSRLHTPMYFLLINLSCIDMTLASFATPKMIADFLREQKTISWWGCYSQMFFMHLLGGS
EMMLLVAMAIDRYIAICKPLHYMAIMSPRVLTGLLLSSYAVGFVHSSSQMAFMLNLPFCGPNVVDSFFCDLPLVIKLACKDTYILQLLVIADSGLLSLVCFLLLLVSYTV
IMCSVRHRAVSGSSKAFSTLSAHITVVTLFFAPCVFIYVWPFSRYSVDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIKKIRTQSINSKHTL*
669 >lcl|XP_001502015.2|Plus1complement(32457308..32458240) NW_001867425 olfactory receptor 8B3-like LOC100072098 __SEG__ Chr7 {Equus caballus} MAPGNYSFVTEFILLGLTDQPDIQLPLFFLFLVMYMVTVLGNLGLITLIGLNSHLHTSMYFFLFNLSFVDLCYSSVFTPKMMMNFLSKKNYISYSGCMTQLYFFCFFVIS
ECYVLTSMAYDRYVAICNPLLYNIVMSPKVCSSFMLGSYLMAFSGAMTHTGCMLRLTFCDANTINHYLCDILPVFQLSCTSTYINEMVVFVVVGINIIVPSLTVFISYGF
ILSSILHMSSTEGRSKAFSTCSSHIIAVSLFFGSGAVMYLKPSSAGSMDGGKISSVFYTNVVPMMNPLIYSLRNKDVKIALRKTLGRRKL*
670 >lcl|XP_001502027.2|Plus188458254..88459195 NW_001867387 olfactory receptor 4L1-like LOC100072110 __SEG__ Chr1 {Equus caballus} MDLLSNRSSVSEFILLGLSSSQEIQIFFFVIFFLVYVAIVVGNLLIVISVIFDKHLHSPMYFFLANLSFFDLCVSSAATPKVIADFLRKRKTISFWGCMAQMFFMHFFGG
GEMSLLIAMAIDRYAAICKPLHYKTIMSRRVLILFLLFAWAIGFIHTMSQMVFTVGLPFCGPNIVDNIFCDLPLVIKLACTETYTLELLIISESGLLSLICFIILLISYV
VMLLTIWQHSSSASSKAVSTLSAHITVVTLFFGPAIFIYAFPFNSYSVDKFLSVIYSIITPLLNPIIYTLRNQEMKAAIRRLSSQHVHSWLTH*
671 >lcl|XP_001502029.1|Plus1complement(22659416..22660483) NW_001867381 c-C chemokine receptor type 8-like LOC100055409 __SEG__ Chr16 {Equus caballus} MDYTVEPNLTTITDYYYPDAISSPCDGELIQRDSKLLLAIFYCLLFVFGLLGNSLVILVLVACKKLRSITDVYLLNLALSDLLFVFSFPFQTHYQLDQWVFGTVMCKVVS
GFYYIGFFSSMFFITLMSVDRYLAIVHAVYAINVRTPSMGIALSLAVWLTAIIATSPLLIFYQVAAEDGVLQCYSSYNQQTLKWKIFIHFEMNILGLLIPFTILMFCYIS
ILQQLKSCQNHNKTKAIRLVLIVVIASLLFWVPFNVVLFLTSLHNMHILDGCVMSQRLIYATHVTETISFTHCCVNPIIYAFMGEKFKKHLSEIFQKSCSHIFLYLGRQI
TRESWEKPSSLYQHSSRSSSTDYIL*
672 >lcl|XP_001502032.3|Plus188502184..88503203 NW_001867387 olfactory receptor 4F21-like LOC100072112 __SEG__ Chr1 {Equus caballus} MFSTHISQFFPNFYLQNTSASLLNESMDGANYSLVSEFVLIGLSNSWEMRLFLFWFFSVSYMGIILGNLFILFMVIIDSHLHSPMYFLLANLSLFDLGLSSTTVPKVISD
LFTDCNMISFPKCMMQIFFIHVMGGAEMVLLIAMAYDRYTAICKPLHYLTIMSPKMCVSFVVTAWIVGIIHAVSQFGFVLNLPFCGPNKVDSFYCDFPRVMKLACVDTYK
IEFVIIANSGFISMATFLSLIMSYIFILVTVWKHSSGDLSKAFVTLSAHITVVILFFMPCIFLYVWPFPTISLDKYLFIFVFAITPVLNPAIYTLRNNDMRLAVRRLGKW
IVGSSGISS*
673 >lcl|XP_001502037.2|Plus1complement(88543460..88544473) NW_001867387 putative olfactory receptor GPCRLTM7-like LOC100072120 __SEG__ Chr1 {Equus caballus} MNGANHSVVSEFVFLGLSNSWEIQLFLFFFSSLFYMSSLMGNLLIVVTVTSDPYLHSPMYFLLANLSIIDLIFCSIAAPKMICDLFRKQKVISFGGCIAQIFFSHAVGGT
EMVLLITMAFDRYVAICKPLHYQTIMSPQMCILILVVAWTIGFIHSLTQLGFVVNLPFCGPNVLDSFYCDIPQLIKLACTDTYRLEFMVTANSGFISLGAFFLLVLSYVY
ILATLQKNSSGGLSKAFSTLSAHIIVVVLFFDPLIFFYMWPSPSTHLDKFLAIFDAVLTPFLNPVIYTFRNREMQKAIRRVFTQLMGFRKKSLNVFIETKSFQVTINKFS
GPNSQFS*
674 >lcl|XP_001502038.1|Plus1<34800023..34800985 NW_001867377 protein sprouty homolog 4-like LOC100072121 __SEG__ Chr14 {Equus caballus} PPPTPGPLEACFSVQSRISSPMEPPIPQSVPLTPSSVMVQPLLDSRMPHSRLQHPLTILPIDQMKTSHVENDYIDNPGLAPPTGPKRTRGGAPELAPTPARCDQDVTHHW
ISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVAEQASPRAVRIQPKAVHCKPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTC
MCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAAAGDAKASRPDKPF*
675 >lcl|XP_001502051.2|Plus1complement(32608482..32609414) NW_001867425 olfactory receptor 143-like LOC100072132 __SEG__ Chr7 {Equus caballus} MAVKNDSSVTEFILVGLTDQPELQLPLFFLFLVNYMLTVLGNLSLISLICLNSHLHTPMYFFLFNLSFIDICYSFVFTPKMLMSFLSERNIISFTGCMTQLFFFCFFVNS
ECYVLTAMAYDRYVAICKPLLYTVTMSPQNCSLLMSGSFMMGFAGAMVHTGSMIGLTFCDSNIINHYMCDIFPLLQLSCSSTYANELVISVIVGTVVVVSGIIISISYAL
ILFNILHISSTKGLSKAFSTCSSHIIMVGLFYGFGLLTHIKPSSAGSVDQGKFFSVFYTNVVPMLNPVIYSLRNTDVKLALKKTLKRITN*
676 >lcl|XP_001502052.2|Plus188590894..88591805 NW_001867387 olfactory receptor 4K3-like LOC100072136 __SEG__ Chr1 {Equus caballus} MEAVNQSMVSEFTILGLCNSWELQAFLLVMFTFLYLITILGNIFIVLLIVTDLRLHYPMYFLLANLSFIDFFLSSVTTPKMITDFLKENKTISFGGCMCQIFFGHFLGGG
EMVLLVSMAYDRYVAICKPLHYTSIMNRQMCIGLVMTSWIIGFVHSISQLAMIIKLPFCGPRELDSFFCDIPLVIKLACTDTYIQEMLINADSGVLATICFILLLVSYSF
ILFTVCLHSKDGASKALSTCTAHTTVVVLFFGPCIFIYLWPLSITWVDKFLAVFYAVITPLLNPAIYTLRNKEIKNAIKRLQC*
677 >lcl|XP_001502058.2|Plus1complement(88594865..88595803) NW_001867387 olfactory receptor 4F15-like LOC100072141 __SEG__ Chr1 {Equus caballus} MNKTNYSPVTEFVFLGLSTSRPVQHLLLAFSMAFYITIVLGNLFIVFMVIFDPHLHSPMYFLLANLSFIDLSFSTLTVPKMICDLYSGHKTISFQGCVIQIFVLHVLGGS
EMVLLVAMALDRYVAICKPLHYLTVMSPRMCILLLSGAWAIRLIHSVAQLASVVHLSFCGPNEIDSFYCDLPWFIKLACTDTHRMEFMVTANSGFISTGTFFLLIVSYIF
ILVTVWNHSSGGLSKALSTLSAHITVVVLFFGPCIFVYVWPFPTVPVDKFLAILDFMITPILNPIIYTLRNKDMKMAMRRLSIQLLSLRKIS*
678 >lcl|XP_001502060.2|Plus1complement(32637980..32638924) NW_001867425 olfactory receptor 8B3-like LOC100072144 __SEG__ Chr7 {Equus caballus} MASGNDSSVTEFILLGLTQQPELQLPLFFIFLGIYVITLVGNIGLLILIGLNSHLHTPMYYFLFNLSFIDLCHCSVITPKMLMSFVKQNIISYSECMAQLYFFSFFVIDE
CCILTSMAYDRYVAICKPLLYNVTMSHLVCLMLMAGAYVMGFVGAVAHTVCMLRLTFCDGNIINHYMCDIPPLLQLSCSSTYINELVVFIVVGINVIVPSLTISISYILI
LYNILHIRSTEGRSKAFSTCSSHIITVSLFFGSSAFMYLKPSSGSLDRDKVSTVFYTIVGPVMNPFVYSLRNKDVKIALNKTLKKRVFSSMESV*
679 >lcl|XP_001502061.2|Plus188616879..88617814 NW_001867387 olfactory receptor 4F21-like LOC100072146 __SEG__ Chr1 {Equus caballus} MDGINDSVVSEFVLLGLSSSWETKVFLMLLFSLIYLGIILGNVFISFLVIFDSHLHSPMYFLLANLSFIDVGVASTTVPKMITDLLNEYKIISFQGCMTQICFIHIMGGV
EMVLLIAMAFDRYTAICKPLHYLNIMNRKICASLVISGWVTGVIHAMSQFAFIINLPFCGPNKVDSFYCDFPRIIKLACTDGAKFEFIVAANSGFMSMGTFFLLILSYIF
ILVTVWKRSSGDLSKAFVTLSAHITVVVLFFGPCMFLYVWPFPTSSIDKYLFIADFAITPVLNPIIYTLRNKDIKIAIKRLSKRGHYVRFC*
680 >lcl|XP_001502064.2|Plus1complement(32659532..32660461) NW_001867425 olfactory receptor 145-like LOC100072147 __SEG__ Chr7 {Equus caballus} MALGNSSFVTEFILLGLTDQPYLQLPLFFLFLIMYMVTVLGNMGLITLIGPNSHLHTPMYFFLFNLSVIDLCYSTVITPKMLINFISKNVISYMGCMTQLYFFCFFIISE
CYVLTAMAYDRYVAICKPLLYNVTMSPKVCSSLLLSSYLMAFSGATAHTGCMLRLTFCDANTINHYLCDLFPLLQLSCTSTYINELVNFIVVGINIIVPSLTIFVSYGFI
LSSIFRISSVEGRSKAFSTCSSHIITVSLFFGSGAFMYLKPSSAGSMDEGKISSVFYTIVVPTMNPLIYSLRNKDVKIALRKTMSRTKF*
681 >lcl|XP_001502065.2|Plus188631028..88631963 NW_001867387 olfactory receptor 4F15-like LOC100072149 __SEG__ Chr1 {Equus caballus} MDELNNSVVSEFVLLGLSSSWETKVFLMLIFSLIYLGIILGNLFILFLVMFDSHLHSPMYFLLANLSLIDVGLSSTTVPKMIADLPKEYKIISFQGCMTQISFIHIIGGV
EMVLLIAMAFDRYMAICKPLHYLNIMNPKICVLFVITSWVTGVIHAMSQFAFIVNLPFCGPNKVDSFYCDFPRVIKLACTDGAKFEFIVAANSGFMTMGTFFLLILSYIF
ILVTVWKRSSGDLSKASVTLSAHVTVVVLFFTPCMFLYVWPFPTSSIDKYLFIVDFAITPVLNPAIYTLRNHDIKIAIKRLSKRGHYVRFC*
682 >lcl|XP_001502079.2|Plus132717840..32718772 NW_001867425 olfactory receptor 143-like LOC100072161 __SEG__ Chr7 {Equus caballus} MAMENDSSVTEFILVGFTDQPQFQLPFFFLFLLNYMVTVVGNLSLINLICLNPHLHTPMYFFIFNLSFIDLFHSLVITPKMLMSFVLEKNIISFEGCMTQLFFFCFFVHS
ECYVLTAMAYDRFVAICKPLLYTANMCPQICSLLMFGSYVMGFAGAMLHTGDMVRLSFCGSNIINHYMCDIFPLLQLSCSSTYANELVDSIIVSTVVIISSFIIFISYAL
ILSSILQISSAQGLSKAFSTCSSHIITIALFYGSGLFTHLKTSSSGSEDQGKFLSVFYTNVVPMLNPLIYSLRNKDVKLALEKTLKRIAN*
683 >lcl|XP_001502081.2|Plus1complement(88711197..88712135) NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072163 __SEG__ Chr1 {Equus caballus} MDGANHSVVAEFVFLGLTNSWEIQLLLFVFSSTFYMASMMGNSLIMLTVISDSHLHSPMYFLLANLSFIDLAVSSVVSPKMIYDIFRKRKVISFGGCIAQIFFLHAIGGV
EMVLLTAMAFDRYVAICKPLHYLTIMSRKMCILLLVAAWIIGLTHSVIQLFFVIKLPFCGPNVLDSFYCDFPRFIKLACTDTYRLEFMVTANSGFISLGSFFTLIVSYIF
ILISIRKLSSSASSKALSTLSTHVMVVILFFGPCIFVYIWPHPTSHLDKFFAVFDAIFTPFLNSVIYTFRNKEMKVAMRKICHQFIILSRIS*
684 >lcl|XP_001502085.2|Plus1complement(32755720..32756652) NW_001867425 olfactory receptor 145-like LOC100072166 __SEG__ Chr7 {Equus caballus} MVAENSSITEFILAGLTNQPELQIPLFFVFLGFYVVTMVGNLGLITLIGLNSHLHTPMYFFLYNLSFIDFCYSTVITPKMLMSFVSKKNIISYAGCMTQLFFFLFFVISE
SFILSAMAYDRYVAICNPLVYTAAMSPQVCLLLLLGVYVMGFAGAMAHTACMVKLTFCANNLVDHYMCDILPLLERSCTSTYVNELVVFVVVGIDIGVPTVTIFISYALI
LSSILHIRSTEGRSKAFSTCSSHIITVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKAALKKILSKKSFS*
685 >lcl|XP_001502086.2|Plus1complement(88736933..88737871) NW_001867387 olfactory receptor 4F21-like LOC100072168 __SEG__ Chr1 {Equus caballus} MDGVNRSVVSEFVFLGLTNSWEIQLFLFVFSSTFYMASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKRKVISFSGCITQIFFIHVIGGV
EVVLLIAMAFDRYVAICKPLHYLTIMSPKLCIFFLIAAWMTGLTHSVVQLAFVVNLPFCGPNVLDSFYCDLPRFIKLACTDTDQLESMVTANSGFISIGSFFILVISYIV
IILTVQKRYSAGSLKALSTLSAHITVVVLFFGPLIIVYTWPSPSIHLDKFLAIFDAVLTPFLNPLIYTFRNQEMKVAMRRVCRELVNYHKIS*
686 >lcl|XP_001502096.2|Plus1complement(88763282..88764253) NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072172 __SEG__ Chr1 {Equus caballus} MDGGNHSTVSEFLLLGLSSSWEIQILLCLFSTVFYVASVLGNLLIVLTITADHHLHSPMYFLLANLSFIDTGVSSIATPKMIYDLFRKRKVISLKGCITQMFFIHTVGGT
EMVLLIVMAYDRYIAICKPLHYLTIMSLRMCLSLLAVAWAIGLIHSVAQLAFVVNLSFCGPNKMDSFYCDFPRFIKLACTDTYRLEFLVTANSGFISMGTFFILVVSYIF
ILVTVHKHSSGRSSKALSTLSAHITVVVFFFGPCIIVYVWPFPTLPIDKFLAIFDALITPFMNPIIYTFRNKEMKAAMRRLFDKVLSFRKSYFMQNLRNLDSS*
687 >lcl|XP_001502099.2|Plus1complement(88778863..88779801) NW_001867387 olfactory receptor 4F21-like LOC100072176 __SEG__ Chr1 {Equus caballus} MGGGNHSVVSEIVLVGLTSSLEMQLALFLVFSVFYVAGILGNLLIVLTVISDPHLSSPLYFLLANLSFIDMWVSSIAAPKMISDLFKKRKVISFQGCIVQIFFIHVIGGT
EMVLLIAMALDRYVAICRPLHYLTIMNFRTCILLLVAAWTIGIIHSLIQLVFVVNLPFCGPNEVDSFYCDLPRLIRLACTDTYRLGLMVTANSGFISLGTFCILIISYIF
ILVIVWKHSANGLSKALSTLSAHITVVVLFFGPCVFVYSWPFPAVPVDKFLAIFDVIITPFLNPTIYTLRNKEMKMAMKRIFSQMSSFRKVF*
688 >lcl|XP_001502105.2|Plus188813403..88814341 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072179 __SEG__ Chr1 {Equus caballus} MDGANYSVVSEFVLLGLANSWEIQLLLFVFSSTFYVASIMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLGGSSVTSPKMIYDLFRKRKVISFSGCITQMFFIHVIGGV
EMVLLIVMAFDRYVAICKPLRYLTIMSPKTCIFLLVVAWMTGLIHSMVQLAFVVNLTFWGSNVLDSFYCDLPQFIKLACTDTYGLEFMVTANSGFISVGSFFILIISYVV
IILTVRKHYSASSLKALSTLSAHITVVVLFFGPLIFFYTWPSPSTHLDKFLAIFDAVLTPFLNPIIYTFKNQEMKMAMRRLCRQLVNYMKIS*
689 >lcl|XP_001502111.2|Plus1complement(32865297..32866229) NW_001867425 olfactory receptor 8B12-like LOC100072182 __SEG__ Chr7 {Equus caballus} MAAPNSSVTEFILLGLTDQPGLQIPLFFLFSSFYMVTVVGNLGLVTLIGLNSNLHIPMYFFLFNLSLIDFCYSTTIIPKMLKSFVSKQNIIMHAGCMTQLFFLCFFVISE
SFLLSAMAYDRYVAICKPLVYTVTMSLQVCLLLLLGVYVMGFSGALAHTGNIAGLTFCAKNLINHFMCDILPLLELSCNSTYVNELVVFVVVSIGIGMPIVTIFISYALI
FSSILHIHSTEGKSKAFSTCGSHIMVVSLFYGSSAFMYLKPPSILPLEKGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALKKTLGREIFS*
690 >lcl|XP_001502112.2|Plus188843370..88844308 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072184 __SEG__ Chr1 {Equus caballus} MDGTNCSVVSEFVFLGLTNSWGIQLLLFVLSSTFYVASMMGNSLIMLTVISDPHLHSPMYFLLANLSFNDLGVSSVITPKMIYDIFRKRKVISFGGCITQIFFLHAIGGV
EMVLLTAMAFDRYVAICKPLHYLTIMSRKMCILLLVAAWIIGLTHSVIQLFFVIKLPFCGPNVLDSFYCDFPRFLKLACTDTYRLEFMVTANSGFISLGSFFTLIVSYIF
ILISIRKLSSSASSKALSTLSTHVMVVILFFGPCIFAYIWPHPTSHLDKFLAVFDAVLTPFLNSVIYTFRNKEMKVAMRKVCYQFIIYRRIS*
691 >lcl|XP_001502119.2|Plus188856194..88857132 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072192 __SEG__ Chr1 {Equus caballus} MDGGNHSIVSEFVFLGLTQSWEIQLLLLVFSSVLYAASMTGNTIIVFFVTTDPHLHSPMYFLLANLSFVDLGACSTTSPKMIYDLFRKHKVISFGGCIAQIFFIHVVGGV
EMVLLTAMAFDRYVAICKPLHYLTIMSPQMCILFLAAAWAFGIIHSLFQLTFIVNLPFCGPNVLDSFYCDLPRLLRLACMDTYRLQFMVTVNSGFLCVGSLIILLISYIF
ILFTVWKHSSGGSFKALSTLSAHITVVFFFFGPTMFIYTWPHPSSQMDKFLALSDAVLSPFLNPVIYTFRNKEMKAAMKRSFRLLVNFRKIS*
692 >lcl|XP_001502123.2|Plus1complement(88866437..88867375) NW_001867387 olfactory receptor 4K3-like LOC100072195 __SEG__ Chr1 {Equus caballus} MEEANQSVVSEFIFRGLCHSRELQTFLLLPFSILYMMTVVGNLLVVSLIIRDPHLHSPMYFLLANLSFVDFCLSSVTTPKLTTDFLKDNKTISFQGCMSQILCVHFFGGG
EMVLLVTMAYDRYVAICKPLHYSSIMNRQKCILLVSISWIIGFVHAMSQLAMILELPFCGPRMVDSFFCDIPLVIKLACMDTHTLGILINADSGLLATSCFIILLVSYTY
ILVTVCLHSKDGASKALSTCTSHITVVVLFFGPCIFIYLWPLSITWVDKFLAVFYTVITPLLNPAIYTLRNKEIKNAIKRLKNQHIDSRDKF*
693 >lcl|XP_001502128.2|Plus1complement(32939020..32939952) NW_001867425 olfactory receptor 8B12-like LOC100072200 __SEG__ Chr7 {Equus caballus} MAATNSSVTEFILLGLTDQPGLQILLFFLFLGFYTVAMVGNLGLVTLIGLNSSLHTPMYFFLFNLSLIDFCYSTTIIPKMLKSFVSKQNIIMHAGCMTQLFFFCFFVISE
SFLLSAMACDRYVAICKPLVYMVTMSPQVCLLLLLGVYVMGFSGAMAHTGSIASLTFCGKNLVNHFMCDILPLLELSCNSTYVNELVVFIVVSIGIGMPIVTIFISYALI
LSSILHIHSTEGRSKAFSTCGSHIIVVSLFYGSAAFVYLKPPSILPLDQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLARKIFS*
694 >lcl|XP_001502132.2|Plus1complement(35554165..35556624) NW_001867377 protocadherin gamma-A12 PCDHGA12 __SEG__ Chr14 {Equus caballus} MKPARLPQDCKGLVLLGVLLGILWETGCTQIHYSVLEELEKGSRVGDIAKDLGLEPRELEERGVRIVSRGRTQLFALNPRSGSLISAGRIDREELCMGAIKCQLNLEILM
EDKVKIYGVVVEVRDINDNAPYFPESELEIKMSENAAPGMRFPLPHAWDPDIGKNSLQSYELSSNTHFSLDVQSGADGNKYPELVLERALDREKKAVHHLVLTASDGGDP
VRTGTARIRVMVVDVNDNAPAFAQSEYRVSVPENVAVGTELLLVNATDPDEGANAEVTYSFRYVDNKAAQIFKLDCNLGTISTIGELNHEESGFYEMEVQAMDNAGYSAR
AKVLITVLDVNDNAPEVVVTSLSSSILENSPSGTLIALLNVNDQDSGENGQVICFIQGNLPFKLEKSYGNYYSLVTDTLLDRELVPSYNITVTATDRGSPPLATDTHISL
TVADTNDNPPTFSRASYSAYIPENNPRGASIVSVTARDPDYGENAQVTYSLAEDTLQGAPLSSYISINSDTGVLYALCSFDYEQFRDLQLQVMAHDSGDPPLSSNVSLSL
FVLDQNDNVPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYLLLKASEPGLFTVGLHTGELRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVANSIPDVLADLSSLESPINPDDSGLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHTSRLLQASGGGLVGVPTSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIF
PQPNYADTLLSQESCEKSEPLLLSGDSVFSKDNHALVQVSPHQIFFSEL*
695 >lcl|XP_001502137.2|Plus1complement(88928207..88929148) NW_001867387 olfactory receptor 4K3-like LOC100072211 __SEG__ Chr1 {Equus caballus} MDLLNNRSSVSEFILLGLSSSQEIQIFLFAIFFIVYVAIVVGNLIIVISVIFDNHLHSPMYFFLANLSFFDLCLSSVATPKVIEDFLRKRKTISLRGCMAQMFFMHFFGG
GEMSLLIAMAIDRYVAICKPLHYKTIMSRRVLILFLLLSWAIGFIHTTSQMVFTVGLPFCGPNIVDSIFCDLPLVIRLACTETYILELLVIANSGLLSLICFILLLISYV
VMLVTIWQRSSSASSKAVSTLSAHITVVTLFFGPSTFIYAFPFNSYSVDKFLSVFYSIITPLLNPVIYTLRNQEMKAAIKRLNSKPTGSWFTH*
696 >lcl|XP_001502140.2|Plus1complement(33021273..33022223) NW_001867425 olfactory receptor 8B12-like LOC100072213 __SEG__ Chr7 {Equus caballus} MADENSSVTEFILAGLTDQPGLQIPLFFLFLGFYLVTVVGNLGLIILIGLNSRLHTPMYFFLFNLSLIDFCYSTTIIPQMLKSFVSNQNVILHAGCITQFFFFCFFVISE
SFLLSAMAYDRYVAICKPLVYMVTMSPQVCLLLLLGTYVMGFSGALAHTGNLASLTFCADNLVNHFMCDILPLLELSCNSTYVNELVVFIVVSIGTGMPIVTIFISYALI
LSSILHIHSTEGRSKAFSTCGSHVIVVSVFYGSAAFMYLKPPSILPLDQGKVSSLFYTTVVPMLNPLIYSLRNKDVKAALRKTLRRKIFSRERSSI*
697 >lcl|XP_001502151.2|Plus1complement(33056520..33057470) NW_001867425 olfactory receptor 8B12-like LOC100072220 __SEG__ Chr7 {Equus caballus} MAAKNSSVTEFILLGLTDKPGLQIPLFFLFLGFYMVMVVGNLGLIMLIGLNSSLHTPMYFFLFNLSLIDFCYSTTIIPQMLKSFASKQNIILHAECMTQLFFLCFFAVSE
SFILSAMAYDRYVAICKPLVYTVTMSPEVCLHLVLGVYVMGFSGALAHTENVASLTFCANNLVNHFMCDVFPLLEVSCNSTYINELVVFIFVTIVIGMSIVTIFISYGLI
LSSILHIHSTEGRSKAFSTCSSHIIVVCLFFGSGAFMYLKPPSILPLDQGKVSSLFYTIVVPMLNPLIYSLRNKDVKAALRKSLGRKIFSREISSI*
698 >lcl|XP_001502152.2|Plus1complement(88964201..88965139) NW_001867387 olfactory receptor 4L1-like LOC100072221 __SEG__ Chr1 {Equus caballus} MDLKNDSIGTEFILLGFSGPWQLQIFFFVTFSLIYGATVLGNILIMVMVTFSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMITDLLTEHKTISIRGCMAQMFFMHFFGGA
EMTLLIAMAYDRYIAICKPLHYRTIMSHRLLSGFVILSWIIGFIHTMSQMVLTVNLPFCGPSVIDNIFCDLPLVIKLACVETYTLELFVIADSGLLSFICFILLLVSYTV
ILATVQQRSSEGLSKALSTLSAHIIVVALFFGPCIFIYAWPFSSFAGNKILAVFYTVITPLLNPIIYTLRNQKMLSVMRKLWFQRVSSTQNF*
699 >lcl|XP_001502156.2|Plus1complement(33068474..33069406) NW_001867425 olfactory receptor 8B12-like LOC100072225 __SEG__ Chr7 {Equus caballus} MAAENSSVTEFILAGLTDQPGLQIPLFFLFLGFYMVTVVGNLTLITLIGLNSHLHTPMYFFLFNLSLIDFCYSTTITPKMLKSFVSKQNIILHAGCVTQLFFFCFLVISE
SFILSAMAYDRYVAICKPLVYTVTMSPQVCLRLVLGVYVMGFSGALAHTGSIASLTFCADNLVNHFMCDIFPLLELSCNSTYVHILVVFIFVTIDIGMPIVTIFISYGLI
LSSILHIHSTEGRSKAFSTCGSHIIVVSLFFGSGAFVYLKPPSILPLDQGKVFSLFYTIVVPMLNPLIYSLRNKDVKVALRKTLGRKIFS*
700 >lcl|XP_001502158.2|Plus1complement(88975672..88976610) NW_001867387 olfactory receptor 4K3-like LOC100072227 __SEG__ Chr1 {Equus caballus} MEKQNHTMVSQFILLGLTEFPELQIFFFLFFSVIYMAIVLSNLIIIFVVKFDPQLHSPMYFLLANLSFIDMSLASFATPKMICDLISDYKTISYEGCMAQMFFLHLLGGS
EMMLLVAMAIDRYIAICKPLHYNNIMSHRVCIGLALLSWTTGFVHTMSQMVFTVTLPFCGPNVVDSFFCDLPQVIKLACTDTYTLELLVIALSGLLSLLCFTFLFISYSI
ILITVRHHSSSGSSKALSTLSAHITVVVLFFGPCVFIYIWPFSSISIDKILSVFYTIFTPLLNPIIYTFRNKDMKKAIRKIKTMHVSPRSTF*
701 >lcl|XP_001502165.3|Plus133090781..33091755 NW_001867425 olfactory receptor 8A1-like LOC100072232 __SEG__ Chr7 {Equus caballus} MGFFSPILQGPNLRKMAAENHSTVTEFILGGLTNRPELQLPLFLLFLGIYSVTMIGNLGMFTLICLNAQLHTPMYYFLSNLSLVDLCYSSVITPKMLVNFVSEKNIISYA
GCMSQLYFFLVFVIAECYMLTVMAYDRYVAICSPLLYNIIMSHQVCALLVTAVYAIGFIGSAIETGLMLKLSYCELFISHYFCDILPLMKLSCSSTYDIEMVVFFLAGFD
IIVTSLTVLVSYVFILSSILHISTTEGKAKAFSTCSSHVIAVGIFYGSTAFMYLKPSTASSLAQENVASVFYTTIIPMLNPLIYSLRNKEVKAAVQKTLRRKMF*
702 >lcl|XP_001502169.1|Plus1complement(35592043..35594517) NW_001867377 protocadherin gamma-A8-like LOC100072235 __SEG__ Chr14 {Equus caballus} MAAPRDYRGRGELVLLCALLGTLWEIGGGQIHYSVPEESDKGSFVGNVSKDLGLEPRELAERGVRIVSRGRIQLFALNRRTGSLITAGRVDREELCAQSARCLVNINILV
EDGGKLFGIEIEITDINDNNPKFQVENLEVKINEIAAPGTRYPLPKAVDPDVGLNSLQSYQLSPSHHFSLDVQTGDDGTINPELVLERALDREEEAAHHLVLTASDSGDP
RRSSTVHIQVTVLDTNDNAPVFAQPIYRVKVPEDVPQGTRLLTVRASDPDEGANGRVAYKFWKMSETQSPLFELNENTGEISTAKNLDYEECAFYEIEIQAEDVGALLGR
TKVLISVEDVNDNRPEVVVTSLFSPVLENTLPGTVIAFLNVHDRDSGKNGQVVCYTRDNLPFQLEKSIDNYYRLVTWKYLDRENISMYNITVIASDRGTPPLSTETHIAL
HVADTNDNAPTFSHASYSTYIPENNPRGASIFSVTAHDPDNDENARVTYFLMEDTIMGAPLSSYVSINSDSGVLYALRSFDYEQIRDLQLLVIASDGGDPPLSSNVSLSL
SVLDQNDNVPEILYPVLPNDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDVLKQSLVVAVQDHGQPPLSATVTL
TVAMADSIPDVLADLGSIRTPVNSDDSDLTLYLVVAVAAVSCIFLAFVIVLLALRLRRWHRSRLLQASGSGLGGVATSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIF
PQPNYADTLLSQESCEKKDPLLTSIDFQQCTDEAASVQVSSVLCLRFSEELYWV*
703 >lcl|XP_001502172.2|Plus1complement(33134497..33135429) NW_001867425 olfactory receptor 8B12-like LOC100072236 __SEG__ Chr7 {Equus caballus} MAAENSSVTEFILAGLTDQPGLQIPLFFLFLGFYLVTVVGNLGLIMLIGLNSRLHTPMYFFLFNLSLIDFCYSTTITPKMLKNFVSKHNIILHAECMTQLFFFCFFVISE
SFVLSAMAYDRYVAICRPLVYTVTMSPEVCLLLLLGVYVMGFSGALAHTGSIASLTFCANNIVNHFMCDILPLLELSCTSTYVHELVVFVVVAVDIGMPIITIFISYGLI
LCSILHIHSAEGKSKAFSTCSSHIIVVCLFFGSGAFMYLKPPSILPLGQGKVSSLFYTIVVPMLNPLIYSLRNKDVKIALRKALGIKIFL*
704 >lcl|XP_001502186.1|Plus1complement(35612438..35614900) NW_001867377 protocadherin gamma-B3-like LOC100072252 __SEG__ Chr14 {Equus caballus} MGNRLGLKGPAGWRRMPFLLLLSLFSRALSEQIRYTILEELARGSLVGNLAKDLGLGVRDLPAWNLPVSAEKKFFTMSTENGDLLVSDRIDREQICGKKSTCVLELEMVS
EKPLNFFHINVEIQDVNDNPPTFSQNITELEISELAPTGATFALESAQDSDVGVNSLQQYYLSPDPHFSLIQKENPDGSRYPELVVKALLDREEQSCHDLVLTAVDGGQP
ARSCTTQIRVIVADANDNPPVFTQDMYRVSVPENLPVGSSVLRVIATDSDEGVNAEITYAFINIGKAVRQLFKLDSKTGELTTGKRLDFEESESYTIGVEAKDGGRHTAH
CKVQIDILDENDNAPEITLDSESKHIQEDAEPGTVVALIKTRDLDSGFNGEIQCRLNGKFPFKIVQDTKNTYKLVTDGALDREQTPEYNVTITATDRGKPPLSSNRSVIL
NIADVNDNAPVFQQASYVVHVAENNPPGASIAQVRASDPDLGPNGRVSYSIVASDLEPRALSSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANASLRV
LVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATL
LLVFADSLQEALPDLGDHPAPSEPQAELQFYLVVALALISVLFLLAVILAIALRLRRSSSPAAWGCFQPGVCSKTEPEVLPNFSQGTLPYSYNLCAASHSSKTEFKFRNI
KPENAPAQDLLCNETSWFESTINDNPQMTSNSVNLQQVSYFKTLSSLEYE*
705 >lcl|XP_001502193.1|Plus1complement(35622544..35625096) NW_001867377 protocadherin gamma-B2 PCDHGB2 __SEG__ Chr14 {Equus caballus} MRLSAERSGPARWRQVLLPFLLSLFRGVLPDQIRYSIPEELAKNSVVGNLAKDLGLNVRDLPARKLRVSAEKEYFTVNPESGDLLVSDRIDREQICGKKPLCILDFDTVA
ENPLNIFHIAVIVQDINDNTPIFKQRKIDLKIGESTKPGKTFPLDPALDSDAGPNSLQSYYLNDNEHFDLTEKQTPDGYKYPELILKHSLDREEQNFHQLVLTAVDGGDP
PQSGSTEIQIQVTDANDNPPVFSQDMYRVSLQEGVPPGFSVLRVTATDQDEGINAEITYSFHNVDEQVKQLFNLDKRTGKITTKNDFDFEIASSYTLSIEAKDPGDLAAH
CSIQVEILDENDCAPEVIVTSVFTPLPEDSPPGTVIALIKTRDRDSGENGEVYCRILGKAEFLLKSYSKNYYKLVTEGALDREEIPEYNVTIMATDRGKPPLSSSVSITL
HIADVNDNAPVFHQASYVVHVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALSSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANASLRV
LVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTVRALGDRDAARQRLLVAVRDGGQPPLSATATL
LLVFADSLQEALPDLGDHPAPSEPQAELQFYLVVALALISVLFLLAVILAIALRLRRSSSPDAWGCFQPGLSSKSGPGVLSNYSEGTLPYSYNLCVASQSAKTEFNFLHV
TPEMAPPRDLLCEDALGVPSTNHGDAAVPLASDTILKVSFNLIHLFSLWVLMFLKKSSDWGRSPRFFFIVLWFELGSFLL*
706 >lcl|XP_001502200.2|Plus1complement(89053965..89054891) NW_001867387 olfactory receptor 4N2-like LOC100072258 __SEG__ Chr1 {Equus caballus} MEIENSTVVTEFILLGLAQSQNIQFMVFVLILIFYLIILPGNFLIILTIRLDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKAISYRGCITQLFFLHFLGGG
EGLLLAVMAFDRYMAICRPLHYSTVMNPRACYALILALWLGGFVHSIIQVAFILRLPFCGPNQLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLSSYVV
ILCHVRGSASEGKNKAMSTCTTHVIIILLMFGPAIFIYTRPFQALPADKVVSFFHTVIFPLMNPVIYTLRNQEVKSSMRRLLSQHVVC*
707 >lcl|XP_001502214.2|Plus1complement(35650316..35652751) NW_001867377 protocadherin gamma-A1 PCDHGA1 __SEG__ Chr14 {Equus caballus} MAIPVKLLGCGRLVLLFIFLGLLLEAKAGKIRYSVPEETDEGFFVGNITKDLGLQPQELDEPRVRIVSRGRTQLFALNARSGSLTTAGRLDREELCAQSARCLVSFSILV
EDKMKLFPVEVEIIDINDNTPQFQLEEVEFKMNEITTPGTRIPLPFGQDLDVGMNSLQSYQLSSNPHFFLDVQQGADGSQHPEMVLQSPLDREEEAVHYLLLTASDGGNP
VRSGTLRIRVQVVDANDNPPAFTQEQYHVSVPENVPLGTCLLIVKATDPDEGTNGEVTYSFHNIDHKVAQIFQLDSYTGEISNKEPLDFEEYKIYPMEIQAQDGAGLMAR
AKVLVKVLDINDNAPEVTITSVTTAVPENFPPGAVIALISVQDQDSGDNGHTICSIPKNLPFKLEKLFDNYYRLVTERTLDRELTARYNITITATDQGTPTLSTEMHISL
QVMDINDNPPTFPQDSYSAYILENNPRGASIFSMTAHDADSNDNARVTYSLAQDTIQAAPLSSYVSINSDTGVVYALRSFDYEQFRELQLRVMAHDSGDLPLSSNVSLSV
FVLDQNDNAPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTSRALLDRDTLKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPDVLADLGSLEPSARPNDSSLTLYLVVAVTAVSCVFLAFVMVLLVLRLRRWRTSRLLQASGGVLAGVSASHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIF
PQPNYADTLLSQESGEKKDFVSAPQSLLEDKKETFSQVNFL*
708 >lcl|XP_001502217.2|Plus189086959..89087912 NW_001867387 olfactory receptor 11G2-like LOC100072271 __SEG__ Chr1 {Equus caballus} MGLFTAHRPMKIPNNCSTITGFILLGFPCPREGQILLFLLFSVVYLLTLMGNGSIICAVRWDQRLHTPMYTLLANFSFLEICYVTSTVPNMLANFLSDTKVISFSGCFLQ
FYFFFSLGSTECFFLTIMAFDRYLAICLPLHYPTRMTGRLCTNLVASCWALGFLWFLIPIIIVSQMSFCGSRIINHFLCDPGPLLALACKKAPVVELVFSTLNAVPVIIL
FLLIMGSYALVLRAVLKAPSSAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSSVTEQEAGTQKIVTLFYSVVTPLINPVIYSLRNKDMKKALQTFLRI*
709 >lcl|XP_001502239.2|Plus189153328..89154266 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072290 __SEG__ Chr1 {Equus caballus} MDRGNHSIVSEIVFLGLTHSWEIQLLLLVFSSVFYVASMIGNMLILLSVTTDPHLHSPMYFLLANLSIVDLGVCSTTAPKMIHDLFRKRKVISFGGCIVQIFFIHVLGVV
EIVLLIAMAFDRYVAICKPLHYVTIMSPKTCVLFLAAAWAIGTIHSLFQLAFIVNLSFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTINSGFLCVGSFFILIISYIF
ILFTVWKHYSGGSSKVLSTLSAHITVVFFSFGPTMFVYTWPHPNSQMDKFLALSDAVLTPFLNPVIYTFRNKDMQAAMKRFFRPLVIFRKIS*
710 >lcl|XP_001502241.2|Plus1complement(35712668..35715055) NW_001867377 protocadherin beta-15 PCDHB15 __SEG__ Chr14 {Equus caballus} MEAGGDRFPKQRQVLILFLLLGVALAGWESRRYSVTEETERGYFVANLAKDMGLGVRELAARGARVVSEDNEPRLQLDLQTGELILNEKLDREEMCGPTDPCVMHFQVLL
KNPLGVFRAELLVKDINDHSPEFPEREMTLKIPESSPPGTVFPLKKAQDLDVGNNNIQNYDINPNSHFHVSTRDRGDGRKYPELVLDKELDREEQAELRLTLTALDGGSP
PRSGTAQVRILVLDVNDNAPEFAQTLYQVQVPENSPVGALVVKVSARDSDSGTNGEISYFLFYTSQEISTTFELNTLSGEVRLIKKLDFETISSYELDIEASDGGGLSGK
CSVAIEVVDVNDNSPELTISSLTSPIPENSPETEVALFRIRDRDSGDNGRMTCSIQDDLPFLLKPSEENFYTLVTSGALDRESRAEYNITITVTDMGTPRLKTEHSITVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDRDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVL
VLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHV
LLVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGGCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLMGDAGSNEFKFLKPM
FPNNLSQDLGRKSEGSSVFQNSLGI*
711 >lcl|XP_001502267.2|Plus189236948..89237886 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072317 __SEG__ Chr1 {Equus caballus} MDGRNHSVMSEIVFLGLTHSREIQLLLLVFSSVLYVASMTGNMLILLSVTTDPHLHSPMYFLLANLSILDLGVCSTAAPKMIHDLFRKRKVISFGGCIAQIFFIHVLGVV
QIVLLIAMAFDRYVAICKPLHYLTIMSPQMCILFLAAAWAIGTIHSLFQLAFIVNLSFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTINSGFLCVGSFFILIISYIF
ILFTVWKHYSGGSSKGLSTLSAHITVVFFYFGPALFIYTWPHLNSKMDKFLALSNAVLTPFLNPVIYTFRNKDMQAAMKRFFRSLEIFRKIS*
712 >lcl|XP_001502269.2|Plus1complement(35783582..35785966) NW_001867377 protocadherin beta-6 PCDHB6 __SEG__ Chr14 {Equus caballus} MAQTKVHRKKRQVAIFIMLMLLWEAGSESIQYSVLEESETGTFVANLTKDLGLRMGELAARGARVVFKGNRQHLQLDPQTYDLLLNEKLDREELCGFTEPCVLPFQVLLE
NPLQFFQAALQVRDINDHAPEFPAREMLLKISEITMPGKIFPLKMAQDLDAGSNSLQSYIISSNPHFHVLTRNRSDGRKFPELVLDKALDREEQPELRLTLTALDGGSPP
RSGTTKIQILVLDINDNTPEFAQELYEAQIPENNPLGSLVITVSARDLDAGAFGEVSYALFQVDDINQPFEINAITGEIRLRETLDFEEFQSYHVDVEATDGGGLSGKCS
LVIKVLDVNDNAPELTMSSLISPIPENLPDIIVAVFSVSDADSGQNQEVICSIDDNLPFLLRPSVENFYTLITEGALDRESRAEYNITITVTDMGTPRLKTQHNITVLVS
DVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVLVL
DANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHVLL
VDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRAGSGTSEFKFLKPILP
NFPPQDTGREMEENSTVRNSFPFS*
713 >lcl|XP_001502282.1|Plus1complement(23713774..23714154) NW_001867366 histidine triad nucleotide-binding protein 1-like LOC100055878 __SEG__ Chr11 {Equus caballus} MADEITEAQAAWPGGDTIFRKIIHKEIPAKIIFEDDQCLAFRDISPQVPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLKNGYRMVVNEGSDGGQSVYH
VHLHVLGGWQMNWPPG*
714 >lcl|XP_001502292.2|Plus1complement(35830154..35832550) NW_001867377 protocadherin beta-2-like LOC100072332 __SEG__ Chr14 {Equus caballus} MEAKEGKERSLKQRQVLMFFVLLGVAQAGSEPRHYSVAEETESGSFVANLVKDLGLEVDELAARGPRVISKGRKMRLQLDRQTGDLLLNEKLDREELCGPTEPCVLPFQV
LLENPLQFFQAELRIRDINDHSPVFLDKEIILKISESITPGTTFLIESAQDLDVGSNGLQSYTVSPNSHFHLKLQDSADGMILPQLVLDKALDREEQPEFRLTLTAVDGG
TPPRSGTALVRIEVLDINDNAPEFANLLYEVQVPENSPIGSQVAVVSASDLDIGAYGEISYVFSQASEDIRKTFRINAKSGELLLTQKLDFESIQTYTLNVQATDGGGLS
GSCVVFVQVMDLNDNPPELTMSTLISEIAENLQETIIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVDNFYTLVTNTALDRESRAEYNITITVTDLGTPRLKTQHNIT
VLVSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVR
VLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTL
HVLLVDGFSQPYLPLPEAAAEQARADPLTVYLVIALASVSSLFLLSVLLFVAVRLCRRSRAASLGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRGGSGTSEFKFLK
PILPNFLAQGEERVNEANPSFRDTFESN*
715 >lcl|XP_001502300.1|Plus1complement(35862455..35864911) NW_001867377 protocadherin beta-1-like LOC100072337 __SEG__ Chr14 {Equus caballus} MAVVRRKLLQSRQVRCLLLLLCVSVGGAATIRYSVAEEMESGSFVANVAKDLGLEVGKLAARGRVFDSEGSKLHFRLHRKTGDLFVKEKLDRESLCGKADPCVLHFEIVL
VEPLQSFRAEVRVFDINDNAPIFLNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANAYFHLHTRFRSHGPKYAELVLDKPLDREEQAEVNLTITAVDGGSP
PKSGTAHIRVEVLDVNDHVPQFSRLVYRAQVPENSANGSLVAVVTATDLDEGSNKEITYSLAQNTEAILQTFQIDPQTGEVRLRGPLDFEAIETYDIDIQATDGGGLSAH
SKVLVEVVDVNDNPPEVTVSSVSSPLPEDSPLQTVVALFSIRDRDIRVGGKLTCFLREDLPFAVKPTFRNSYSLVTDRGLDREEVSGYNITLVAVDTGPPSLSTETVIEV
LISDINDNPPVFQEDSYILTVRENNSPAVFIGKVHAEDLDLGENAQVTYSLLPPKSGDLSVFAYISINSDNGKLYALRTMDYEAIQDFQFVVKATDGGFLSLSSQVTVRV
IVLDDNDNCPMILYPLQNGSLPCNDLVPRSAEAGYLVTKVVAVDGDSGQNSWLSYHLLKATDPGLFSVQQQNGEIRTLRQVSERDPMMQKLVILVQDHGQPALSTTASLN
ILLVDGFSEPYLQFRDSSKQSARVNPSTKYLVISLAVLSFLFLLSVTVIFVIHIYQKIKCREKFTIQEHFYDDCNFPNNLMQGGANGSLSRPCPYEMCSATGTGNSEFRF
LKRLMPNFPFPHGTGEVKTEAGSSLPPDSDSNRSRGSEGHGRVSGDYM*
716 >lcl|XP_001502322.2|Plus1complement(89370657..89371595) NW_001867387 olfactory receptor 4F6-like LOC100072354 __SEG__ Chr1 {Equus caballus} MDEANRSVVSEFVFVGLSNAWEIQLLLFLFSSVFYVASLMGNLLIVLTVTFNLHLQSPMYFLLANLSIMDLIFCSSTAPKMIYDLLRKHKTISFGGCVVQIFFIHTVGGA
EMVLLVTMAFDRYIAICKPLHYLTIISPRRCLLFLITSWIIGLVHSMTQLAFVVDLPFCGPNELDSFFCDLPRFIKLAGIQTFILEFMVTANSGLLSVATFLILIISYIF
ILVTVQKKSSGSISKALSTLSAHVTVVVLFFGPLIFFYVWPFPTSHLDKFLAIFDSVITPFLNPVIYTFRNKEIQVAMRRLCTKVVNYSKMS*
717 >lcl|XP_001502329.1|Plus127242790..27243839 NW_001867396 probable G-protein coupled receptor 21 GPR21 __SEG__ Chr25 {Equus caballus} MNSTLDGNQSSRPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLNHHTTSYFIQTMAYADLLVGVSCLVPSLSLLHYPLPVEESLTCQVFGFVVS
VLKSVSMASLACISIDRYIAITKPLTYNTVVTPWRLRLCIFLIWLYSTLVFLPSFFDWGKPGYHGDVFHWCAESWHTDPYFTLFIVMMLYAPAALIVCFTYFNIFRICQQ
HTKEISERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGRSNRFASFLTTWLAISNSFCNCVIYSLSNSVFQRGLKRLSGAMCTSCASQT
IAKDPYTVRNKGPLNGCHV*
718 >lcl|XP_001502336.2|Plus189399520..89400458 NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100072368 __SEG__ Chr1 {Equus caballus} MDGTNRSVVSEFVLLGLTNSWEIQLLLFVFSFTIYVASMMGNSLIMLTVTSDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKRKVISFSGCIIQIFFIHVVGGV
EVVLLIAMAFDRYVAICKPLHYLIIMRPRLCILFLVAAWMTGLIHSMVQLAFVVNLPFCGPNVLDSFYCDLPRFIKLACTDTDQLETMVTANSGLISVGSFFILIISYLL
IILTVQKSYSAGSSKALSTLSAHITVVVLFFGPLILVYTWPSPSVHLDKFLAIFDAILIPFLNPLIYTFRNQEMKVAMRRVCRQLVNYRKIS*
719 >lcl|XP_001502347.2|Plus189454090..89455031 NW_001867387 olfactory receptor 11H6-like LOC100072386 __SEG__ Chr1 {Equus caballus} MTSEARNISHVVSEFILLGFPCRWEIQIFLFSIFFMTYILTLLGNMAIVCAVRWDRRLHTPMYILLANFSFLEICYVNSDVPNMLANFLSQTKTISFTRCLLQLYFFFSL
GTTECLFLSIMAYDRFLAICCPLHYPVVMTAKFCSTLVIFCWVYGFLWFLIPVILVTQLPFCGPNVIDDFLCDLGPLLALASACIPIPGTVLICGTMSSLLIFATFFYII
GSYTLVLRAVMQVPSVAGRKKAFSTCTSHLAVVFLFYGSVMITYVKPGSGQVEGMQKFTTLFYSVLTPFFNPMIYSLRNKEMKDALKKVLGGS*
720 >lcl|XP_001502352.2|Plus1complement(89467663..89468601) NW_001867387 olfactory receptor 11G2-like LOC100072392 __SEG__ Chr1 {Equus caballus} MSGVNAVTEFILLSFPCSREVQVFFFMLFSVSYILTLMGNGAIVCAVKLDHRLHTPMYILLANFSFLEICYINTTVPNMLSNFLSETKTISFTACFLQFYFFCSMGTTET
FFLPLMSFDRCLAICQPLHYPTIMSRHLCMNLVALCWVTGFLCYLVPIYLITQLPFCGPNTIDHFVCDPGPLLSLSCVAAPGIELSYSILSTLIIFITFFFILGSYTLVL
RAVLRVPSAAGRHKAFSTCSSHLVVVSLFYGTLTVMYISPASGNPAGIQKIVTLFYSSVTPLVNPLIYSLRNKDIKAALRKIQVCTKISQSE*
721 >lcl|XP_001502365.2|Plus189501661..89502587 NW_001867387 olfactory receptor 11G2-like LOC100072402 __SEG__ Chr1 {Equus caballus} MTISKNSSIIIGFILLGFPCSREGQILLFVLFSIVYLLTLMGNGSIICAVCWDQRLHTPMYILLANFSFLEICYVTSTVPNMLANFLSDTKVISFSGCLLQFYFFFSLGC
TECFFLAIMSFDRYLAICRPLRYPTIMTGRLCSNLVASFWVLGFLWFLIPIVIVSHMSFCGSRIIDHFLCDPGPLLALACKKPPLVELLFSTLSAVPIIILFLCIMGFYA
LVLRAVLKVPSAAGRRKAFSTCGSHLAVVSLFYGSVLVMYGSPTTEQEAGTQKIVTLFYSVVTPLLNPVIYSLRNKDMKKALQKFVRI*
722 >lcl|XP_001502431.2|Plus1complement(89636570..89637505) NW_001867387 olfactory receptor 4K1-like LOC100072447 __SEG__ Chr1 {Equus caballus} MAHTNESVVSEFVLLGLSNSRELQLFFFALFSIVYVTSVLGNIMIIVIISSDSHLNSPMYFLLSNLSFIDICQSNFATPKMLVDFFIEHKTISFDGCMAQIFLLHSFVGS
EMMLLVAMAYDRFIAICKPLHYSTIMNRRLCINFVLISWAVGILHSVSHLAFTVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYAI
ILITVRRRSSSGSVKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTVCTPLLNPIIYSLRNEDVKSAMQKLRNRHVNSWKI*
723 >lcl|XP_001502433.2|Plus1complement(56511019..56511948) NW_001867385 olfactory receptor 5H1-like LOC100072448 __SEG__ Chr19 {Equus caballus} MDTKNATLLTEFILTGLLYQPEWHIPLFLVFLLIYFITIVGNLILIALICSDPQLHIPMYLFLGSLAFVDAWISSTVTPKMLVNFFAKSKMISLSECMIQFFSLGISATT
ECFLLASMAYDRCVAICKPLLYPVIMTNRLCIQLLVSSFVGGLLHALIHVGFLFRLTFCHYNIIHHFYCDIMPLFKISCTDPSINVLMLFIFSGSIQVFTILTVLFSYTL
ILFTILKRKSVQGIRKAFSTCGAHLLSVSLYYGPLLFMYVRPGSAQRDDQDMVDSLFYTVIIPLLNPIIYSLRNRKVIDSLAKMLKRNV*
724 >lcl|XP_001502440.2|Plus1complement(89682157..89683110) NW_001867387 olfactory receptor 4K2-like LOC100072457 __SEG__ Chr1 {Equus caballus} MDVANVSTVSEFVLLGLSNSWEFRMFSFIVFSMFYVATMVGNSLIVITVIANSHLHSPMYFLLTNLSIIDMSLASFATPKMITDYLTGHRTISFDGCITQIFFLHLFTGT
EIILLMAMSFDRYIAICKPLRYTSIISPRVCAALVVASWVVGVMHSMSQVIFALALPFCGPNEVDSFFCDLPVVFQLACVDTYVLGLFMISTSGIIALSCFILLFSSYVV
VLVSIKHHASRGSSKALSTCTAHFIVVFMFFGPCIFIYMWPLSSFLVDKILSVFYTIFTPILNPVIYTLRNQEVKTAMRKLKKRILNSNKATPSHYL*
725 >lcl|XP_001502447.2|Plus189705433..89706380 NW_001867387 olfactory receptor 4K3-like LOC100072464 __SEG__ Chr1 {Equus caballus} MAWNNQSVVTEFILQGLSSSWELQSFYFLFFSIVYAATVLGNLLIMLTIVSEPHLHSPMYFLLGNLSFIDMSLASFATPKMIADFLTERKAISFEGCITQIFFLHLLGGA
EIVLLISMSFDRYMAICKPLHYLTFMSQRMCFGLVTLSWIVGIFHAMSQLAFTVNLPFCGPNEVDSFFCDLPLVIKLACIDTYILGVFMISTSGMIALVCFILLVISYTV
ILVTVRQHSSGGSSKALSTCSAHFTVVTLFFGPCIFIYVWPFTNFPIDKVLSVFYTILTPLLNPVIYTLRNKDVKDSMRKLSSHIFKSRKTDHAP*
726 >lcl|XP_001502452.2|Plus1complement(89715950..89716897) NW_001867387 olfactory receptor 4K2-like LOC100072469 __SEG__ Chr1 {Equus caballus} MEGFNNSRVSKFMLLGLTDSPELQIFFFVMFSIFYLMTMLGNCLILLTVLSTLHLHSPMYFLLSNLSFIDMCLSSFATPKMIMDIFAQHKTISFEGCISQIFFLHLFTGT
EIVLLISMSFDRYIAICKPLHYSTIMSQKVCVGLVVISWTVGFLHTISQLAFILYLPFCGPNVVDSFFCDLPLVIRLACIDVYVLGIFMISTSGVIALISFLLLLTSYII
VLVTIKDHPSTGSSKAFSTCTAHFIVVLMFFGPCIFIYVWPFTNFEVDKVLSVFYTIFTPFLNPLIYTLRNQEVKTALKKKLSNQYLNLGKTTPS*
727 >lcl|XP_001502455.2|Plus1complement(56612853..56613782) NW_001867385 olfactory receptor 5H1-like LOC100072470 __SEG__ Chr19 {Equus caballus} MDTKNATFLTKFVLAGLSFQQEWHIHLFLVFLVIYLITIVGNLGLIVLICNDPHLHTPMYLFLGSLAFMDAWISSTVTPKILVNFFAKSKVMSISECVIQLFSFAFSATT
ECFLLAAMAYDRYLAICKPLLYPVIMTNRLCNKLLVLSFLGGLLHSLIHVGFLFRLTFCNYNIIHHFYCDIKPLFRISCIDPSINVLMVFISSGSIQVFTIMTVLVSYTL
VLFTILKRKSVQGIRKAFSTCGAHLFSVSLYYGPLLFMYVRPGSAQADDQDMADSLFYTVIIPLLNPIIYSLRNKKVIDSVAKMLKRNV*
728 >lcl|XP_001502457.2|Plus1complement(89728020..89728943) NW_001867387 olfactory receptor 4N2-like LOC100072473 __SEG__ Chr1 {Equus caballus} MESENSTVVTEFILLGLTQSRDMQLLVFVLVLIFYLIILPGNFLIILTIRLDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EGLLLVVMAFDRYMAICRPLHYSTVMNPRACYVLLLALWLGGFVHSIIQVALILRLPFCGPNQLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAV
ILCRVRGSSSEGKSKAMSTCTTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASVRRLFNQHIA*
729 >lcl|XP_001502465.2|Plus1complement(89750438..89751379) NW_001867387 olfactory receptor 4M1-like LOC100072477 __SEG__ Chr1 {Equus caballus} MEPANYTRVTEFVLTGLAQTREVQLVLFVIFLSFYLFILPGNILIICAIRLDPHLTSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGAS
EMFLLTVMAFDRYAAICRPLHYGTIMNRCLCCILVALAWMGGFIHSIIQVALIVRLPFCGPNELDSYFCDITQVVRIACANTFPEELVMIFSSGLISVVCFIALLMSYAF
LLAMLKKHSGSSESTGRAMSTCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKTAMRKLVNRYILCKEK*
730 >lcl|XP_001502467.2|Plus1complement(89771260..89772198) NW_001867387 olfactory receptor 4S2-like LOC100072479 __SEG__ Chr1 {Equus caballus} MQVVNNVTEFTFLGLSQDPRMQLIFFALFLLFYIVIIAGNLFILLTVFSDPRLHTPMYFFLSNLSFVDIAYSSATAPKMIEDFVSEKKTISYWGCVTQMFTFHFFGCAEI
FVLTVMAFDRYAAICQPLRYTTIMSANACIVLASLSWLGALGHSFFQTLLTFQLPFCNARVIDHYFCDVHPVLKLACADTTLVNMLVIANSGLISLGCFLILLASYTVIL
FSLRKRSAKSRHKALSTCGSHLTVVTFFFVPCIFIYLRPSTTFPLDKAVSVFYTTITPMLNPLIYTLRNEGVKNAMKRLWSRKFSLKEKLKG*
731 >lcl|XP_001502488.1|Plus189821360..89824131 NW_001867387 toll-like receptor 11-like LOC100072493 __SEG__ Chr1 {Equus caballus} MERPLLSFTLLSPLLLGLMSLGRMSWAWTAPDCTIADSSLLPNISYYIPFCSLAPGLHLFASCSNVKDLAQTLTAVPRDIEALCLQGTVPFLPADAFGHFTTLQLLRLQL
GTISITSGTFQGLNQLQHLSFEHHAPCCLSLFLPPDALEHLRLLNTLSFHGYCLNYSQNIQLPISLRHLTVRHSCLIELRELQGLFPNLVPGSSPTTSPSPWTSFLEELD
LSANLQLSQVGNRALDGLQLRSLRLDGTPLSALDLLGSGLLHLDSLSLEGTRTERLPGNVTRYFELVALDLGRNQIQNLEDEDLLSCQSLEFLSLHANGLQLLPSRFLND
LPQLQRLNLSMNKLGPTLVLPEGLVSSNLRVLDLSHNELCVLPYRAFSSLPQLQELRLSGNNISNLSSESLEGLRWLKTLDLSWNQIKTLKPGWLSSLPALTSLNLLGTH
LEHISGKQLQGPQKLSHLQLGSLEMLEIYPPWPPALLSLEVRADVYIQFGVPSGEPFLFLENLTLQTSNMLLQLDNNTIHFPSLRHLTLRGCSPYILSGHQSHRFFPQLP
LLEHLHFWSDHEGADDLHLFGMPSLRVLELGDLDFLCQPTSVKLEKLLKELPQLQVLVLSNLNLGNLSASSFRGLGPLRLLLLNSEWALGLDSSLQELIPQMPQYVYFSD
ITFTCQCESSWVGPWATQAPNTFVYGLEKSICMANASDYSKTPLLSFLSGHCSHDPEFQSFLTSFTLVFLLIFLSLLGCPKWPWLHYLQTLFHAWWWKLGGWRPRNQFHY
DVFISYCEQDRAWVLKELVPALEKPLPVGEGLRLCLPERDFGVGQDRMDAMVASMESSRATLCVLSCQALGSPWCNLELRLATYHLMAKPGTARLLLLFLEPIDRRQLHS
YHRLARWLQKEDYFDVSQGRIEWDAFSEKLRKRLRKAGQERED*
732 >lcl|XP_001502502.2|Plus1complement(56706494..56707414) NW_001867385 olfactory receptor 5AC1-like LOC100072501 __SEG__ Chr19 {Equus caballus} MDANKTLVTEFVLTGLTERPGLQVPLFLVFLLTYLTTMVGNLGLAALIWKDPRLHSPMYLLLGSLAFADARSSSSMTPRTLRTFLSKNHVISLVGCITQFYTLASSASTE
CFLLVVMAYDRYVAICNPLLYPAVMSNIFCIQLLVVSYIIGFLHPMMHVGLLFRLTFCKSNVIHYFYCEILQLLKISCTDPRVNMLLIFIFSVFIQSFTFLTIIVSYMRV
LFAILKKKSAKGRSKAFSTCSAHLLSVSLFYGTLFLMYVRPGSGPAEDQDKMYSLFYTVIIPLTNPFIYSLRNKEVIGALRRIISK*
733 >lcl|XP_001502509.2|Plus1complement(56720845..56721786) NW_001867385 olfactory receptor 5K4-like LOC100072505 __SEG__ Chr19 {Equus caballus} MIENNHSLTTEFILTGFTDHPELKTLLFVVFLAIYLLTMVGNLGLVALIFKEQRLHTPMYVFLGNLALMDSCCSCAVTPKMLENFFSEDRMISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICSPLQYHTMMSRKLCIQMTTGAFIAGNLHSLIHVGFLLRLTFCRSNQIDHFFCDILPLYRLSCTDPFINELMIYIFSMPIQIFTIATVLISYIC
ILLTVFKMKSKEGKGKAFSTCASHFLSVSMFYVCLLMYFRPFEEGNKDIPVAIFYTIVIPLLNPFIYSLRNKEVINVLKKIMWNHNILKHHPL*
734 >lcl|XP_001502521.2|Plus1complement(89877196..89878170) NW_001867387 olfactory receptor 11G2-like LOC100072514 __SEG__ Chr1 {Equus caballus} MRTLETTNISGFVSEFILLGFPCDRDIQILLFVLFSFIYLLTLMGNASVIYAVWSSQKLHTPMYILLANFSFLEICYVSSDVPKMLTNIISQTKSISYTGCLLQFYFFFS
MCAAEGLFLSVMSFDRFLAICRPLQYPTVMTYRLCARLMVFCWAGGFLWLLTPLTLISQVPFCGPNTIDHFLCDLAPLLALSCAPVPGITLICGIISSLIIFLTFLYILG
TYFCVLSVGLQMPSGSGRHKAFSTCASHLAVVSLFYGSVMVMYVSPGSGDYPGIQKFVTLFYALATPFFNPLIYNFRNKDMKEELRKILNVLLWKISKGFKSQI*
735 >lcl|XP_001502534.2|Plus1complement(56771290..56772213) NW_001867385 olfactory receptor 5AC1-like LOC100072522 __SEG__ Chr19 {Equus caballus} MMDANKTLVTEFVLTGLTERPGLQVPLFLVFLLTYLTTMVGNLGLAALIWKDPRLHSPMYLFLGSLAFADACSSSSVTPRMLTTFLSKNHMISLVGCITQFYTLASSAST
ECFLLVVMAYDRYVAICNPLLYPAVMSNTFCIQLLVVSCIIGFLHPMMHVGLLFRLTFCKSNVIHYFYCEILQLFKISCTDPRVNMLLIFIFSVFIQSFTFLTIIVSYMR
VLFAILKKKSAKGRSKAFSTCSAHLLSVSLFYGTLFLMYVRPGSGPAEDQDKMYSLFYTVIIPLPNPFIYSLRNKEVIGALRRIISK*
736 >lcl|XP_001502538.2|Plus1complement(56786390..56787313) NW_001867385 olfactory receptor 5AC1-like LOC100072526 __SEG__ Chr19 {Equus caballus} MSEENKTLVTEFVLTGLTERPGLQVPLFLVFLLTYLTTMVGNLGLAALIWKDARLHSPMYLLLGSLAFADACSSSSVTPRMLIHFLSKNHVIPLLDCWAQFYFFGSIATT
ECFLLVVMAYDRSVAICNPLLYPAVMSRRLCTWLISVSYVIGFLHSAIHVGLLFRLTFCKSNVIHYFYCEILQLFRISCTDPTVNTLLVLIFSAFIQVFTFMTIMVSYSC
VLFDILKQKSAKGRSKAFSTCSAHLLSVSLFYGTLFLTYVRPGSGPAEDHDKMFSLFYTIIIPLLNPFIYCLRNKEVISALRKIMKK*
737 >lcl|XP_001502539.1|Plus1complement(37920035..37921072) NW_001867399 protein Tob2-like LOC100055713 __SEG__ Chr28 {Equus caballus} MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPDKPLKGSGFRCVHIGEIVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVK
VLYLDDSEGCVAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPSQQQPRM
ARSPTNSLLKHKSLSLSVHSLNFITASPAPQSQLSPNAKEFVYNGAGSPSLFFDGADGQGSGTPAPFGGSGAGTCNSSSFDVAQVFGGGTNSLFLEKTPFVEGLSYNLNT
MQYPSQPFQPVVLAN*
738 >lcl|XP_001502559.2|Plus190003692..90004636 NW_001867387 olfactory receptor 11G2-like LOC100072541 __SEG__ Chr1 {Equus caballus} MNVSGVNTVTEFILLSFPCSREVQVLLFVLFSVSYILTLMGNGAIVCAVKLDRRLHTPMYILLANFSFLEICYINTTVPNMLRNFLSETKTISFTACFLQFYFFFSMGIT
ETFLLPLMAFDRYLAICQPLYYPTIMSSHLCTNLVVLCWVMGFLCYPVPIYFITQLPLCGPNTIDHFVCDPGPLLALSCIPAPGIELSCSILSSLIIFITFFFILWSYIL
VLRAVLHAPSAAGRRKAFSTCGSHLAVVSLFYGTIMIMYISPTSGNPAGIQKIVTLLYSSVTPLVNPLIYSLRNKDMKAALRKIQVCTKISQSK*
739 >lcl|XP_001502567.3|Plus1complement(45308837..45309778) NW_001867366 olfactory receptor 1D2-like LOC100072547 __SEG__ Chr11 {Equus caballus} MDGSNQSGVSEFLLLGLSESPEEQHVLFWMFLSMYLVTVVGNVLIILAIGFDSRLHTPMYFFLANLSFTDLFFVTNTIPKMLVNIQSQNKAISYARCLTQLYFLVSLVAL
DNLILATMAYDRYVAICRPLHYTTAMSSRLCILLLALCWVFSVLYGLIHTLLMTRVTFCGSRKIHYIFCEMYVLLRLACSNTQVNHTVLIATGSFIFLTPLGFMIMSYVW
IVRAILQIPSASSKYKAFSTCASHLAVVSLFYGTLCMVYLQPLHTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHRALGRLLLGKVFQRLT*
740 >lcl|XP_001502579.2|Plus1complement(90037068..90038012) NW_001867387 olfactory receptor 11H6-like LOC100072555 __SEG__ Chr1 {Equus caballus} MNMSGVNTVTEFILLSFPCSREVQVLLFMLFSVSYILTLVGNGAIVCVVRLDHRIHTPMYILLANFSFLEICYINTTVPNMLKNFLSETKTISFTACFLQFYFFFSMGTT
ETFLLPLMAFDRYLAICRPLHYPTIMSIPLCMNLVALCWVTGFLCYPVPIYFITQLPFCGPNTIDHFVCDPGPLLALSCIPAPGIELSCSILSSLIIFITFFFILGSYTL
VLRAVLHVPSAAGRRKAFSTCGSHLAVVSLFYGTLMVMYISPTSGNPAGIQKIVTLLYSSVTPLVNPLIYSLRNTDMKAALRKIQMCTKISQSE*
741 >lcl|XP_001502583.2|Plus190054149..90055126 NW_001867387 olfactory receptor 11H4-like LOC100072560 __SEG__ Chr1 {Equus caballus} MSFFLVDLRPMNNRSATHIVTEFVLLGFPGCWEIQIFLFSLFLVAYILTLLGNGAIICAVRWDPRLHTPMYFLLGNFAFLEIWYVSSTVPNMLANILSKTKAISFSGCFL
QFYFFFSLGTTECLFLAIMAYDRYLAICRPLHYPTIMTGKLCGKLVSICWLIGFLGYPIPIFFISQLPFCGPNIIDHFLCDMDPLMALSCAPAPIIEFIFYTQSSLVLFF
TITYILLSYTMLLRAVFQIPSAASQKKALSTCGSHLAVVSLFYGTVMVMYVSPTYGIPTCMQKIFTLVYSVMTPLFNPLIYSLRNKDMKLALRNVLLGRRISQIS*
742 >lcl|XP_001502585.2|Plus1complement(45361455..45362387) NW_001867366 olfactory receptor 2M2-like LOC100072562 __SEG__ Chr11 {Equus caballus} MELWNHTSLSDFLLLGPFSHSPYDFFLFSLVLLASTVALASNILFLLLIQADRRLHTSMYFFLSQLSIMDLTMTATVVPKMAANFLSGRKFISRGSCAAQVFLVVMAGGA
ECFLLAVMAYDRYVAICHPLRYPVLMNWKACSLLALASWMGGVADSVIDVSVVFSFPYCGSLQVDHFFCEVPALLRLSCADTSLFEDLVYACCVVMLLLPLGVIVASYAW
VLAAVIRMPSTEGKHKALTTCSSHLGVVGLYYGGAVLSYLQRASARTPAGDRTTSIFYTIVTPMLNPLIYSLRNRDVARALRKVLGRWRV*
743 >lcl|XP_001502592.2|Plus1complement(45408258..45409208) NW_001867366 olfactory receptor 2T8-like LOC100072566 __SEG__ Chr11 {Equus caballus} MVWVGNQTLISHFIFLGLFTHSPLHIFLFSITMIMFLMALSGNGLMILLINVSPHLHTPMYFFLSWLSLMDLMLISTIVPRMAVDFLMGHGSISFTGCGLQILFFLTLTG
GECFLLAFMAYDRYVAISNPLRYSVVMSRRVCWLMVSGSWLFGLVDGLIQAVFTLSFPYCGSQEIDHFFCDVPAVLKLACADTSLYETMIYVCCILMLLLPFSVISASYL
KILVAVLCMRSAEGRQKAFATCSSHMAVVSLFYGAAMITYMRPQTYHSSKQDKVVSVFYTMITPMLNPLIYSLRNKEVARALKQLLRRCLCSRGQG*
744 >lcl|XP_001502602.2|Plus1complement(45451659..45452588) NW_001867366 olfactory receptor 1A1-like LOC100072573 __SEG__ Chr11 {Equus caballus} MREENQSSTLDFILLGVTGQQEQEYFFFILFLFVYPITLIGNLVIILAIRSDIFLHTPMYFFLANLSFVDIFFSSVTIPKMLANHLMGTKAISFGGCLTQMYFMIALGNT
DSYILAAMAYDRAVAISRPLHYTTIMSPRSCVLLVVGSWVVGNANAFPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFNVKMMYLGVGVFSVPLLCIIISYVRV
FSTVLRVPSTKGVHKAFSTCGSHLTIVSLYYGTVMGMYFRPLTSYSLKDAVITVMYMALTPMLNPFIYSLRNRDMKAALGKLFNKRISS*
745 >lcl|XP_001502616.2|Plus1complement(45510547..45511476) NW_001867366 olfactory receptor 1A1-like LOC100072583 __SEG__ Chr11 {Equus caballus} MKEDNQSSNMDFILLGVSGHQEQEDFFFILFLLIYPITLIGNLVIILAIHSDIRLHNPMYFFLANLSFVDIFFSSVTLPKMLANHILGTKVISFGGCLTQMYFMIALGNT
DSYILAAMAYDRAVAISRPLHYTTIMNPWCCALLVVGSWVVGNANALPQTLLTAKLSFCGHQEVANFYCDMAFLLKLSCTDIYFNLKMMYVGVGVFSMPLLCIIISYVRV
FSTVLRVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDALITVMYMAVTPMLNPFIYSLRNRDMKAALGKLFHRGISS*
746 >lcl|XP_001502631.2|Plus145553731..45554723 NW_001867366 olfactory receptor 3A2-like LOC100072593 __SEG__ Chr11 {Equus caballus} MDLHLPSWDISLQGLMDPESGNNKTAVAEFILLGLVQSEKLQSVVFVLFLFVYLVTVGGNLSILTATLVEPKLHTPMYFFLGNLSVLDVGCITVTVPSMLGRLLSHKRTV
SYGACLTQLFFFHLLAGMDCFLLTAMAYDRFLAICRPLTYSTRMNQAVQWILVAVSWACAFINALTHTIALTTLKFCGPNEVNHFYCDLPQLFQLSCSSTQLNELLLFAA
CFIMAGVAMVLIITSYIHVAAVVLQIHSVEGRKKAFSTCGSHLTVVCLFYGTGIFNYMRLGSVEASDKDKGVGVFNTVINPMLNPLIYSLRNPDVQGALWRVLVGRESLT
*
747 >lcl|XP_001502638.2|Plus1complement(45599428..45600381) NW_001867366 olfactory receptor 1P1-like LOC100072598 __SEG__ Chr11 {Equus caballus} MAAENQTSIFEFLLWGLSEQPEQQHILFHLFLWMYVVTVAGNLLIVLAIGTDARLHTPMYFFLASLSCADILFTSTTVPKALVNIQTQSKLISYAGCLAQLYFFLTFGDM
DIFLLATMAYDRYVAICHPLHYTMVMSFRCCILLVTACWTLTNLVAMTHTFLIFQLSFCSKKIIPDFFCDLGPLMKVSCSDTRVNEFVLLLLGGAVILIPFMLILVSYIR
IVSAILRVPSAQGRCKAFSTCGSHLTVVSLFFGTVIRAYLCPSSSSSSSAEEDTAAAVMYTVVTPLLNPFIYSLRNKDMKDALGRLLRGKVSFSQGQ*
748 >lcl|XP_001502647.1|Plus14459529..4460572 NW_001877044 putative P2Y purinoceptor 10-like LOC100072605 __SEG__ ChrX {Equus caballus} MGSNSTNSTRTKCTDLHMPFQYSLYATTYILIFIPGLLANSAALWILCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYINHHWPFQRALCLLCFYLKYLNMYASIC
FLTCISLQRCFFLLRPFRARDWKRRYDVGISAAIWVIVGTACLPLPILRSVGLANNTESCFADLGLQHISMASSIGLVTVAELGGFVLPVVIITYCTWKTRKSLQEFQDP
PQNTKERKKALWMVLMCAVVFIVCFTPYHLNFPFFMMVKQRVFSNCSFIKSTLYFHIISLCLANLNCCLDPVVYYFMTSEFRGRFSEHGGLVFQSCVKCKDNALEIHHRK
EDLQTISLELLDDSKIM*
749 >lcl|XP_001502650.2|Plus145638369..45639298 NW_001867366 olfactory receptor 1A1-like LOC100072608 __SEG__ Chr11 {Equus caballus} MGEDNQSSNMDFILLGVSGQQDQEDFFFILFLFIYPITLIGNLLIILAIRSDIHLHNPMYFLLANLSLVDIFFSSVTLPKMLANHLLGTKAISFGGCLTQMCFMLALGNT
DSYILAAMAYDRAVAISRPLHYTTIMSPRSCILLVVGSWVVGNANAFPHTLLTASLSFCGNQRVANFYCDIASLLKLSCSDIYFNVKMMHLGAGVFSVPLLCIVISYVRV
FSTVLRVPSTKNVLKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVITVMYIAVTPMLNPFIYSLRNRDMKAALGKLFSKRICS*
750 >lcl|XP_001502654.1|Plus1complement(57508188..57510146) NW_001867413 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr4 {Equus caballus} MKLLWQVTVHHTWNAVLLPIVYLTAQVWILCAAITAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
STAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLR
KRHQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
751 >lcl|XP_001502666.2|Plus145654072..45655001 NW_001867366 olfactory receptor 1A1-like LOC100072616 __SEG__ Chr11 {Equus caballus} MREENKSSTLDFILLGVTGQQEQEDFFFILFLFVYPIALIGNLLTILAIHSDIRLHNHMYCFLANLSFVDIFFSSVTLPKMLTNHLLGTEAVSFGVCLRQMHLIIALDNT
DNYILAAMADDHAVAISRPIHYTTIMSPRSCVLLVVGSWVVGNANAFPHTLLTAGLSFCGSQKVTNFYCYIASLLKLSCSNIHFNVKMIYLGIGVFSVPLLCIVLSYVHV
FSTVLQVPSTKGVLKAFSTCGSHLTVVSLYYGTIMGMYFRPLTSYSLKDAVITVMYMAMTPMLNTFIYSFRSRDMKSALGKLFSKRISS*
752 >lcl|XP_001502675.2|Plus145668998..45669927 NW_001867366 olfactory receptor 1A1-like LOC100072621 __SEG__ Chr11 {Equus caballus} MREDNQSSDMDFILLGVTGQQEQEDFFFILFLFIYPITLIGNLLIILAIHSDIRLHNPMYFLLANLSLVDIFFSSVTLPKMLTSHLLDTKAISFEGCLTQMYFMIGMANI
DSYILAAMAYDRAVAISRPLHYTTIMSPLFCVLLVVGSWVVGNANALPHTLLTAQLSFCGNQRVANFYCDMASLFKLSCSDISFNVKMMYLGFGVFSLPLLCIIISYVRV
FSTVLRVPSTKGVFKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVITVMYIAVTPMLNPFVYSLRNRDMKAALGKLFSKRISS*
753 >lcl|XP_001502681.2|Plus1complement(45684086..>45685057) NW_001867366 olfactory receptor 3A2-like LOC100072626 __SEG__ Chr11 {Equus caballus} CDISLQGLMDLEARRNRTAVTEFILLGLVETEKLQSVVFVLFLIAYLVTVGGNLSILAAILVEPKLHTPMYFFLGNLSALDVGCITVTVPAMLSRLLSQKRRISYEACLT
QLFFFHLLAGMDCFLLTAMAYDRFLAICQPLTYSTHMSQAVQLILVAVSWAFAFTNALTHTIALTTLNFCGPNEVNHFYCDLPQLFQLSCSSTQLNELLLFAVGFIMAGA
PVVLIITSYIHVAAAVLQIHSVEGKKKAFSTCGSHLTVVCLFFGTGIFNYMRLGSEEASDKDKGVGVFNTVINPMLNPLIYSLRNPDVQGALWRVLVGKRSLT*
754 >lcl|XP_001502688.2|Plus1complement(45705483..>45706454) NW_001867366 olfactory receptor 3A1-like LOC100072631 __SEG__ Chr11 {Equus caballus} WDVSLQGPMEPESRANGTAITEFILLGLVETPGLRPVIFVLFFFAYLVTVGGNISILAAILVESKLHTPMYFFLGNLSALDIGCITVTVPSMLGRLLSHKHTVSYGACLT
QLFFFHQLAGVDCFLLTAMAYDRFLAICQPLTYSTRMSQTVQRILVVVSWACAFTNALTHTVAISTLTFCGPNMINHFYCDLPQLFQLSCSSTQLNELLLFGLGILMAGV
PVILIVTSYIHVAVAVLQIRSPEGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVEASDKDKGIGILNTVISPMLNPLIYSLRNPDVQGALWRVLTGKRALA*
755 >lcl|XP_001502699.2|Plus145733288..45734235 NW_001867366 olfactory receptor 139-like LOC100072638 __SEG__ Chr11 {Equus caballus} MEPGSWGNRTTVTEFVLLGLTENIRLQPILFAVFLCAYVVTVGGNFSILAAILVEPKLHTPMYYFLGNLSLLDIGCITVTVPPMLACLLAHHCRVPYAACISQLFFFHLL
AGVDCHLLTAMAYDRYLAICQPLTYSTRMSHVVQGALVGICCTVSFINALTHTVAVSVLDFCGPNVVNHFYCDLPPLFQLSCSSIHLNGQLLFVGATFMGVIPMILISTS
YAHVAAAVLRIRSAEGRKKAFSTCGSHLTVVCIFYGTGFFSYMRLGSVSASDKDKGIGILNTILSPMLNPVIYSLRNPDVQGALKRVLTGKRPPE*
756 >lcl|XP_001502703.2|Plus1complement(90577581..90578576) NW_001867387 olfactory receptor 6S1-like LOC100072642 __SEG__ Chr1 {Equus caballus} MASAGNQSSGVTEFILAGFPNLNSTKAELFSVFLLVYLLTLTGNVLIVGVVGGDTRLQTPMYFFLGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLG
ASQFLLLAVMSVDCYLAICHPLHYPLLMNGAVCFWVALACWMGGLLPVLGPTVAVALLPFCEQDAVVQHFFCDSGPLLRLACTNTKKLEETDFVLASLVIVSSLMITAVS
YGHIVLAVLHIPSASGRQKAFSTCTSHLIVVTLFYGSAIFLYVRPSQSGSVDTNWAVTVVTTFVTPLLNPFIYALRNERVKEALKDMFRKVVAGFLGDLLLAKSFNKKTV
R*
757 >lcl|XP_001502708.2|Plus1complement(45796563..45797507) NW_001867366 olfactory receptor-like protein DTMT-like LOC100072648 __SEG__ Chr11 {Equus caballus} MTGRNQTVISEFLLLGLPIESEQQNLFYALFLAMYLTTVLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQFSSILYAGCLTQMYFFLFFGDL
EIFLLVAMAYDRYVAICFPLRYSTIMSPELCLSLVVLSWVLSMFHALLHTLLTARLCFCTDNVIPHFFCDMSALLKLSCSDTRVNELVIFFIGGIIVVTPFLLIILSYAQ
IVFSILKFPSGGSIWKAFSTCGSHLSVVSLFYGTIIGLYLCPSANNSLVKEITMAMMYTVVTPMLNPFIYSLRNKDMKGALGRVFCKKKILFSL*
758 >lcl|XP_001502711.1|Plus127033670..27034620 NW_001867396 olfactory receptor 1K1-like LOC100067499 __SEG__ Chr25 {Equus caballus} MDAANKSSEGAPFILLGLTTNPGQQQPLFVLFLVLYMVGILGNGLIVAAIRASPALHAPMYFLLAHLSFADLCFTSVTVPKMLANLLAHDCSISLAGCLTQMYFFFALGV
TDSCLLAAMAYDCYVAIRHPLHYAMRMSWAMCTALVGTAWVVSHTHSLLHILLMARLSFCASHQVPHFFCDHQPLLRLSCSDTRHIQLLIFTEGAAVVVTPFLLILASYG
AIAAAVLRLPSASGRLRAVSTCGSHLAVVGLAYGTVIAVYFQPTSQYKAKGGRVATVMYNVVTPMLNPVSYSLRNRDVQGALQALFTGRQISAGDS*
759 >lcl|XP_001502714.1|Plus1complement(45810033..45810977) NW_001867366 olfactory receptor-like protein DTMT-like LOC100072652 __SEG__ Chr11 {Equus caballus} MTGRNQTVISEFLLLGLPIESEQQDMFYALFLAMYLTTVLGNLLIIILIRLDSYLHTPMYSFLSNLSFSDICFSSVTIPKLLQNMQSQDLSISYAGCLTQMYFFLFFANL
DSFLLVTMAYDRYVAICFPLHYSTIMSTKLCLSLVVLSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDVSALLKLSCSDTRVNELVIFFIGGIIVIIPFLLIILSYAR
IVFSVLKFPSGGGICKAFSTCGSHLSVVSLLYGTVIGLYFCPSANNSPVKEIAMAVMYSVVTPMLNPFIYSLRNRDMKGALGRVFCRNKILFSL*
760 >lcl|XP_001502720.2|Plus1complement(45826165..45827115) NW_001867366 olfactory receptor-like protein DTMT-like LOC100072658 __SEG__ Chr11 {Equus caballus} MTGRNQTVISEFLLLGLPIESEQQNLFYALFLAMYLTTALGNLLIIILICLDSHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQDMSISYAGCLTQMYFFLFFGDL
ESFLLVAMAYDRYVAICFPLRYSTIMTPKLCLSLVVLSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLSCSDTQVNELVIFIMGGLILVTPFLLIILSYAR
IVSSIFKVPSVRGIRKAFSTCGSHLSVVSLFYGTIIGLYLCPSSSNSPVKEIAMAVMYTVVTPMLNPFIYSLRNRDMKGALGRVFFKKNILVCLWW*
761 >lcl|XP_001502724.2|Plus1complement(45846898..45847842) NW_001867366 olfactory receptor-like protein DTMT-like LOC100072662 __SEG__ Chr11 {Equus caballus} MTGRNQTVVSDFLLLGLQIEPEQQNLFYALFLVMYVTTILGNLLIIFLIRLDSHLHTPMYLFLSNLSFSDICFSSVTIPKLLQNMQSQEPSIPYAGCLTQMYFFLFFADL
ESFLLVAMAYDRYVAICFPLHYSTIMSPKLCLSLVVLSWVLTTFHAMLHTLLMARLCFCGDNMIPHFFCDMSALLKLSCSDTRVNELVIFIMGGFILVIPFLLIILSYAQ
IVSSILKVPSARGISKAFSTCGSHISVVSLFYGTVIGLYLCPSGSNSTVKEIAMAMMYTVVTPMLNPFIYSLRNRDMKRALGRVFCRKKILFSL*
762 >lcl|XP_001502817.2|Plus1complement(91353686..91354627) NW_001867387 olfactory receptor 10G3-like LOC100072736 __SEG__ Chr1 {Equus caballus} MERVNSTLLTEFILTGILYPLRLRTFLFVFFLLIYILTQLGNLLIVITVWVDPQLHARPMYIYLGVLSIIDMGISTIIVPRLIMNFILGIKPISFGGCVAQLYFYHFLGS
TQCFLYTLMAYDRYLAICQPLRYPVLMNAKLSTLLVAGAWVAGSIHGALQATLTFRLPYCGPNQVDYFFCDIPAVLRLACADTTVNELVTFVDIGVVVASCFSLILLSYI
QIIQAILRIRRADGRHRAFSTCGAHVTVVTVYYVPCAFIYLRPETNSPLDGAAALFPTAITPFLNPLIYTLRNQEVKLALKRMIGVLGTKSKV*
763 >lcl|XP_001502838.2|Plus1complement(91433406..91434353) NW_001867387 olfactory receptor 4E1-like LOC100072752 __SEG__ Chr1 {Equus caballus} MEEASLCNQTTLLTYFRLGGLSVNQKVQIAGFAMFLIFYVFTLIGNILIVITVIYDHRLHTPMYFFLSNLSFIDVCHSTVTVPKMLIDTWSEEKLISFDICVTQMFFLHL
FACTEIFLLTVMAYDRYVAICKPLQYMTVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDNFFCDVPQVIKLACTDTHIIEILIISNSGLISVVCFVVLVV
SYAVILVSLRQQISEGRRKALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKIVSVFFTAVTPLLNPIIYTLRNEDMKNALNKLMGRMEGKEKQ*
764 >lcl|XP_001502965.1|Plus1complement(31279695..31280654) NW_001867405 protein sprouty homolog 1-like isoform 2 LOC100063739 __SEG__ Chr2 {Equus caballus} MDPPNQHGSGSSLAVIQQPALDSRQRLDYEREIQPAAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPINVNNNYEHRPTSHLGHAGLSSNARGPI
LSRSTSTGSAASSGSNSSASSEQGLLGRSPPTRPVPSHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGT
CMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRGCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS*
765 >lcl|XP_001503004.1|Plus150060617..50061681 NW_001867389 membrane progestin receptor beta PAQR8 __SEG__ Chr20 {Equus caballus} MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVLETDVPQLFREPYIRTGYRPTGHEWRYYFLSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASPHAL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYIGVSVYQYGSALVHFFYSSDQAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLA
FILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAVLLDYQGRQEIFLQRHSALSIYMACLSFFFL
AACSAATAALLRHKVKARLTKKDS*
766 >lcl|XP_001503071.2|Plus111906205..11907158 NW_001867414 olfactory receptor-like protein OLF3-like isoform 1 LOC100050999 __SEG__ Chr4 {Equus caballus} MGTDNKSCVGEFILLGLSSDCDTQVFLFLLFLTTYLVTVLGNFLIVLLIRLDSRLHTPMYFFLINLSLVDVSYATSIVPQLLAHLLVEHKVIPYVSCAVQLFFSLSLGGI
EFVLLAVMAYDRYVAVCDPLRYSVIMRGGLCTRLAITSWVSGSINSLMHTTITFQLPMCTDKFIDHISCEILAVVRLASVDTSSNEVAIMVSSIVLLMTPLCLVLLSYIK
IIFTILKIQSILGRKKAFQTCASHLTVVVLCYGMTIFTYIQPHSSPSVLQEKLISLFYAISMPMLNPMIYSFRNKEVKGAWEKLLGQLSGLTSKLAS*
767 >lcl|XP_001503208.1|Plus1complement(25258421..25259458) NW_001867366 protein Tob1 TOB1 __SEG__ Chr11 {Equus caballus} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGSQQQPQQQQPSQPPPPPPPPQQQQQQQKTSALSPNAKEFIFPNMQGQGSGTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLN
NMQYSNQQFQPVMAN*
768 >lcl|XP_001503323.1|Plus1complement(24637166..24638134) NW_001867427 olfactory receptor 51S1-like LOC100053665 __SEG__ Chr7 {Equus caballus} MSTFRTQATPNGSTSMAPTFLLVGMPGLSAVPSWWTIPLITVYFLSVSGNGTILWIIALEPNLHRPMYFFLFLLSVSDVGLASTLMPTLLGLALADAHAVPASACLLQMF
FVHVFSVMESSVLLAMAVDRALAICRPLHYPTLLTNGDINKIGLAIASQCLGLHLPLPFLLAHMPYCHPQVLTHSYCLHPDMARLACPGAWGAVYSFFVVLSAMGLDPLI
IFFSYGLIGRVLQSLGSSEDRWKACQTCAAHLSAVLLFYVPMILLALIDRLRVPIPQPAHTLLSYVHFLLPPLVNPILYSVKMKEIRERIIKRLYSRKVGCA*
769 >lcl|XP_001503389.2|Plus111108597..11109532 NW_001867368 olfactory receptor 1013-like LOC100050399 __SEG__ Chr12 {Equus caballus} MEKSNLTVTEFILVGFTPDPIMQLVLFVVFLGVYFLTVVGNTTLIVLICNDSRLHTPMYFFIGNLSFLDLWYSSVYIPKILMTCISGDKTISFAGCAAQFFFSAGLAYSE
CYVLAAMAYDRYVAISNPLLYAQVMSRRLCICLVIYSYTGGFVNAIILTSNTFTMNFCGDNIIDDFFCDVPPLVKLSSDEKESYQAVLYFLLASNVILPTALILASYLFI
MAAILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPSSSYTLERDKMVSTFYTVVFPMLNPMIYSLRNKHVKEALKKLFRLTQFEF*
770 >lcl|XP_001503397.1|Plus150459687..50460733 NW_001867364 trace amine-associated receptor 9-like LOC100073109 __SEG__ Chr10 {Equus caballus} MADTFSQAAAVELCYENVNGSCVKTPYSPGPRAVLYAVLGVGALLAVLGNLLVIIAILHFKQLHTPTNFLIASLACADFLVGVTVMPFSAVRSVESCWYFGESYCTFHTC
FDTSFCFASLFHLCCISVDRYIAVTEPLTYPARFTVSVSGICIILSWFCSLTYSFSVFYTGANGEGIEELVAALTCVGGCQAPLNQNWVLLCFLLFFTPTVAMVLIYGKI
FLVAKHQARKIESAASQAQSSSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYIIDAMIDAYMNFITPPYVYEILVWCVYYNSAMNPLIYAFFYPWFRKAVKLIVTGKV
LRSDSSTINLFSEEADID*
771 >lcl|XP_001503399.1|Plus150473704..50474735 NW_001867364 trace amine-associated receptor 6-like LOC100073110 __SEG__ Chr10 {Equus caballus} MSRGPSTPAVVQLCYEGVNGSCIKTPCLPGARVLLYSAFGLGAVLAVFGNLLVVTAILHFKQLHSPTNFLLASLACADFLVGVTVMPFSMVRSVESCWYFGARFCALHSC
CDVAFCYSSLFHLCCISIDRYIAVTDPLVYPAKFTVSVSGMCVSISWILPLVYSGAVFYTGVSNDGMEELVSALNCIGGCQIVVNQDWVLIDFLLFFILTVVMIILYSKI
FLVAKQQAIKIEHTGGKAESSSESYKARVAKRERKAAKTLGVTVVAFLISWLPYTIDTLVDAFMGFVTPAYIYEICCWGAYYNSAVNPLIYALFYPWFRKAIKVIVSGEV
LKDSSSTISLFSE*
772 >lcl|XP_001503407.1|Plus150495656..50496720 NW_001867364 trace amine-associated receptor 7a-like LOC100073113 __SEG__ Chr10 {Equus caballus} MTASPGIRTETPEQGVASPAAAQLCYENLNGSCIRTPYSPGPRLALYAVFGFGAVLAVFGNLLVMISILHFKQLHSPANFLLASLACADFLVGVTVMPFSMVRSVESCWY
FGRTYCTLHSCFEGSFCYASIYHLCFISLDRYIAVTDPLVYPTRFTASVSGMCIAFSWLLSVIFSSSLLGTGANEAGLEELVSALTCVGGCQIAVNQNWVLVNFLLFLIP
TLVMIMLYSKIFLIAKQQARKIESLSNKTSGSSDSYRDRVAKRERKAAKTLGFAVTAFLISWLPYFIDSVIDAFLGFITPTYMYEILVWVAYYNSAMNPLIYAFFYPWFR
KAIKLIVTGKVLRENSSTINVFSE*
773 >lcl|XP_001503412.1|Plus150510635..50511672 NW_001867364 trace amine-associated receptor 6-like LOC100073114 __SEG__ Chr10 {Equus caballus} MSDHWSPPAAEQLCYENVTGSCVKTPYSPGPRVLLYGVFGLGAVLAVLGNLLVMISILHFKQLHSPTNFLIASLACADFLVGVAVMPFSMVRSVESCWYFGRSFCTFHTC
CDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTASVSGMCVSISWILPLVYSGAVFYTGAYDDGLEELSSAVNCVGGCQTVVNQNWVLIDFLSFFIPTLVMIILYSNI
FLVARQQAKKIESTGGKTESLSDSYKSRVAKRERKAAKTLGVTVVAFTISWLPYSIDSLIDAFMGFITPAYIYEICCWGAYYNSAVNPLIYALFYPWFRKAIKVIVSGQV
FQDSSASMNLFSDQR*
774 >lcl|XP_001503427.1|Plus1complement(50571032..50572045) NW_001867364 trace amine-associated receptor 5-like LOC100073122 __SEG__ Chr10 {Equus caballus} MSTVLDRGAEGHPAAFCYQGNGSCPRRVHPLGIQLVIYLACAAGMLITVLGNLFVVLAVAYFKALHTPTNLLLLSLALADLLLGLLVLPFSIIRSVESCWFFGDFLCRLH
TYLDTLFCLTSIFHLCFISIDRHCAICEPLLYPSKFTVRVALRYILAGWGVPAAYTALFLYTDVVERGLSQWLEEMPCVGSCQLLFNKFWGWLNFPVFFFPCLIMISLYV
KIFMVATRQVQQINILSRSLAGALKRERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLNFITPPLVFDVFIWFAYFNSACNPIIYVFSYRWFRKALKLFLSREIFTPRTP
TTDLYQE*
775 >lcl|XP_001503433.1|Plus1complement(50626096..50627115) NW_001867364 trace amine-associated receptor 1-like LOC100073124 __SEG__ Chr10 {Equus caballus} MMSFCHSIINISCVKSSWSNDVRASLYSLMVLIILTTLVGNLIVIISISHFKQLHTPTNWLIHSMATVDFLLACLVMPYSMVRSVEHCWYFGEVFCKIHTSTDIMLSSAS
ILHLSFISIDRYYAVCDPLRYKARIGVLVIFMMISISWSIPALFAFGMIFLELNFKGVEELYYKHVHCMGHCAVFFSKTSGVLAFMISFYIPGFIMLCVYYRIYFIAKGH
ARSINDANKNPQIGLEEKNGISRSKEGKAAKTLGIVMGVFLICWCPFFVCTVMDPFLNYAIPHSLNDALIWFGYLNSTFNPMIYAFFYPWFRRALKMILFGKIFQKDSSR
CKLFLESNP*
776 >lcl|XP_001503523.2|Plus131205145..31206080 NW_001867366 olfactory receptor 4D1-like isoform 4 LOC100056800 __SEG__ Chr11 {Equus caballus} MEPQNITWVSEFVLSGFSQTQEFQKFLFLVFLIVYVTTVVGNLLILIAVTFDSQLHMPMYFLLRNLAVIDLCYSTVTAPKMLVDFLHETKTISYQGCMAQIFFFHFLGGG
TVFFLSVMAYDRYIAISRPLHYVTIMNTQLCVGLVLAAWGGGFVHSIVQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLELLMISNSGMLVLIWFFLLLISYTV
ILVMLRSHSGQARRKASSTCTTHIIVVSMIFVPCVYIYTRPFTPFPMDKAVSISYTVITPMLNPMIYTLRNQEMQAAMKRLGKRLVICSKE*
777 >lcl|XP_001503526.2|Plus128474644..28475570 NW_001867389 olfactory receptor 12D2-like LOC100052031 __SEG__ Chr20 {Equus caballus} MLNQTSVTEFLLLGVTDIQELWPLLFVVFLAIYFVNVAGNGTILMIVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLGNFLSTHKAISFLGCISQLHFFHFLGSTES
MLLAVMAFDRFVAICKPLHYTVIMNHQLCTQMAITIWIIGFFHALLHSVMTSHLNFCGSNHVHHFFCDVKPLLDLACGKIEFNQWLLNTVTGMIAMGSFFLTLLSYFYII
THLFCKTHSCSTLHKALSTCASHFMVVILFFAPVVFTYIRPASGSSMDQDRIIAIMYSVVTPVLNPLVYSLRNKDVKRALSRMIRRRL*
778 >lcl|XP_001503578.1|Plus124822769..24823710 NW_001867427 olfactory receptor 51G2-like LOC100053865 __SEG__ Chr7 {Equus caballus} MSVFNSSALYPRFLLTGLSGLESRYGLISLPIFLIYGTSVAGNITILFIIRTEPSLHQPMYYFLSMLALTDLGLSMTTLPTMFSVFWFHAQEISFNACLVQMYFIHVFSI
IESAVLLAMAFDRFVAIREPLSYAAILTNGVIIGIGLAIAGRALTLVFPASFLLKRLQYHPVNILSYSFCLHQDLIKTTVSSRWVSSIYGLMVVICSMGLDSVLLLLSYI
LILGTVLRIASKTERVKALNTCISHICAVLTFYTPMIGLSMIRRYGQNASPIVHVLMANVYLLVPPLMNPIVYSVKTKQIRDRILKKFKRQKV*
779 >lcl|XP_001503592.1|Plus124848258..24849193 NW_001867427 olfactory receptor 52J3-like LOC100053913 __SEG__ Chr7 {Equus caballus} MKYQNRSSFHPATFFLIGIPGLEEVHVWISLPFCSAYLVALLGNATILLVIKTEQTLREPMFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEINFGACVAQMFLIHTFT
GMEAEVLLAMAFDRYVAICAPLHYTTILTSRVLMGISTCILFRPVLLTLPMIYLIYRLPFCQVRIIAHSYCEHMGIAKLSCGNIRINAIYGLFVISFFVLNLVLIGISYI
YILRAVFHLPSQDAQLKALSTCGSHVGVICVFYIPSVFSFLTHRFGHNIPRYIHILVANLYLVIPPLLNPIIYGVRTKQIRERVLHVFTNK*
780 >lcl|XP_001503615.1|Plus1complement(56380318..56381400) NW_001867385 G-protein coupled receptor 15-like LOC100072420 __SEG__ Chr19 {Equus caballus} MDPEATSAYLDYFYATSQNPEIEEARSPVPYTSIFLPIFYTAVFLAGVLGNLVLMSALHFKRGSRRLIDIFIINLAASDFIFLITLPLWVDKEASSGLWRTGSFLCKASS
YMITVNMHCSVFLLTCMSVDRYLAIVCPAISRKFRRRDCAYGVCASVWFISCLLGLPTLLSRELTMIGDKPYCAEKRATSIKWAWSLVALIFTFFAPLVSIVTCYCCIAR
KLCAHYQQSGKHNKKLRKSIKIILIVVAAFVFSWLPFNTFKLLSIVSGLQQELYISQDFLKHGMDVSGPLAFANSCVNPFIYYVFDGYIRRAIVRCLCPCLKNYDFGSST
ETSDSHLTKVLSNFVHAEDFARRRKRSVSL*
781 >lcl|XP_001503715.1|Plus187447065..87448663 NW_001867387 muscarinic acetylcholine receptor M5 CHRM5 __SEG__ Chr1 {Equus caballus} MEGESYHNATTVNGTLVKHQPLERHGLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALD
YVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPPDECQIQFLSEPTITFGTAIAAFYIPVSVMTIIYCRIYRET
EKRTKDLADLQGSDSTAEADKRKPAHKALLRSCFSCPRPTLAQRERNQASWSSSHRSTSTTGKPSQATGPSTEWAKAEQLTTCSSYPSSEDEDKPTTDPVFQAVYKSQPK
ENPREEFSAEETKETFVKAQTEKNDYDTQKYFLSPAAVHRPKSQKCVAYKFRLVVKADGTQETNNGCHKVKIMPCSFPVSKGPSTKGLDPNLSHQMTKRKRMVLVKERKA
AQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCQWKKKKVEEKLYWQGNSKLP*
782 >lcl|XP_001503773.1|Plus111650495..11651592 NW_001867364 5-hydroxytryptamine receptor 1E-like LOC100065574 __SEG__ Chr10 {Equus caballus} MNITNCTTEASVAVRPKTVTEKMLISMTLVIITSLTMLLNSAVIMAICTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWKLGYFVCEVWLSVDMTCCTCSI
LHLCVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISVFISMPPLFWRSHRRLSLPLSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSR
HLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKIHTSIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSGVADFLT
WLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT*
783 >lcl|XP_001503784.2|Plus128369547..28370476 NW_001867389 olfactory receptor 1N1-like isoform 1 LOC100052091 __SEG__ Chr20 {Equus caballus} MNCSKNPDFVLSGLSRDPEKWQLLFGLFLALYLLSLLGNLLLLLPIGADIRLQTPMYFFLSQLSLVDLCFTSTTAPKMLEDLWTSNASISFSGCLTQLYFFAVFADMDNL
LLTAMAIDRYAAICHPLHYPLLMTPCRCGLLVVGSWGVAHSVSLVHALLLSQQSFYINQEIPHFFCDFGPLFQLSCSDAHLSEEVMMALTGILGISPLLCIISSYVHIFH
AVARVPSAQGKKKALATCSSHLSMVILFYSTVFATYLKPTSTSHPPGELVAAVVYTLVTPTLNPFIYSLRNKDVNSSLKRVLGIESLWN*
784 >lcl|XP_001503794.2|Plus112000680..12001612 NW_001867414 olfactory receptor 13-like isoform 1 LOC100051071 __SEG__ Chr4 {Equus caballus} MGENQTMVAEFILLGFPLSPRIQMLLFGLFSLFYAFTLLGNGVILGLISLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLNPAKSISFAGCMTQTFLFLSFAHTE
CLLLVVMSYDRYVAICHPLRYAAIMSWRVCITLAVTSWILGVLLALVHLVLLLPLPFCGPQKVNHFFCEIIAVLKLACADTHTNEIMVLAGAVSVLVGPFSSIVISYIHI
LRAILNIQSGEGRQKAFSTCSSHLCVVGLFYGTAIIMYVGPRYGNPQEQKKYLPLFHSLFNPMLNSLIYSLRNKEVKAALKRLLEKERTS*
785 >lcl|XP_001503845.1|Plus1complement(28966506..28967756) NW_001867377 beta-2 adrenergic receptor ADRB2 __SEG__ Chr14 {Equus caballus} MGQPGNGSVFLLTPNGSHAPDQDVTQERDEAWVVGMAIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWT
SIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKEAINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYS
RVFQVAKRQLQKIDKSEGRFHAQNLSQLEQDGRSGLRRTSKFCLKEHKALKTLGIIMGIFTLCWLPFFIVNIVHVIQDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDF
RIAFQELLCLRRSSLKAYGNGYSNNSDGRSDCTGEQSGNQLGKERDRELLCEDPPGTEDFVNCQGTVPSDSVDSQGRKCSTNDSVL*
786 >lcl|XP_001503935.2|Plus131258894..31260156 NW_001867377 probable G-protein coupled receptor 151 GPR151 __SEG__ Chr14 {Equus caballus} MLAAAFADSNSSTMNVSSAHLHFAGGYLPSDSKDWRTIVPALLVAVCLVGFVGNLCVMGTLLHRAWKGKPSMIHSLILNLSLADLSLLLFSVPVRATAYSKGVWDLGWFV
CKSSDWFIHTCMAAKSLTIVAVAKVCFMYASDPAKQVSIHNCTIWSVLVAIWAVASLLPLPEWFFSTTRHYAGVEMCLMDVPAVAKEFMSMFGKLYPLLVFCFPLLFASF
YFWRAYGQCQKRGTKTQNLRNQMRSRQLTVMLLSIAIISAILWLPEWVAWLWIWHVKAGGPAPPQGFIALSQVLMFSISSANPLIFLVMSEEFKEGFKGLWKWMITKKHP
TASESQEIPTGNSEVLPDNVPSLESPTSTRDKEETGSPSCSKEKSDKAEIPILPDVEQFWHERDTVPCVQDNDPMPWEHEGQETGGDCDK*
787 >lcl|XP_001504021.1|Plus125482816..25483760 NW_001867427 olfactory receptor 51I1-like LOC100054010 __SEG__ Chr7 {Equus caballus} MSESNTTKFQPSLFILTGLRKLVGAHLWLGPLLCLMYITTIVGNCTVLYLVKTEHSLQEPQYLFLSMLAGADIVLSVSTLFSVLKVFILGLYHIAFDDCLIQLFFIHTFS
STGSGILLAMAFDRFVAISHPLQYTTILTNSRVTKMGLAALLRGVALMTPLPILLKRLPFCKGQTLSYSYCLHPNVMKLACGQVKINIFYGLVLVIFSFGFDFLLIAISY
ALIFQAVIGIASREGQRKALNTCLSHIFIVLIYYGPLLAITVMHRISHRSSPLAHAVLGNMYLFMPPMLNPIVYSLKTKQIRSSLRKSFKKQRR*
788 >lcl|XP_001504036.2|Plus1complement(35513363..35515978) NW_001867377 LOW QUALITY PROTEIN: protocadherin gamma-C4 PCDHGC4 __SEG__ Chr14 {Equus caballus} MLRKVRSWIEICRGATLLFLCCHLGYVFGQIRYPVPEESQEGTFVGNVAQDFLLDTESLSARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSASCIVPLEFVT
EGPLEMYRAEVEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNP
PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMLLIQLNASDPDLGPSGNVTFSFSGHTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDVRARDGGSPAM
EQHCSLRVDLLDVNDNAPHITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFALKSAFRNQFSLVTAGPLDREARSSYDIMVTASDAGNPPLSTQRT
IFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVT
VRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAVPIPADLPPQKLVIVVKDSGSPPLSTSVT
LLVSLEEDTHPVVPDLRESSAPREGESRLTLYLAVSLVAICFVSFGSFVALLSKCLRGAACGVTCLPAGTCACLTRSRRREGLPPSNGILRIQLGSDDPIKFVDVGGHSH
GCTPLASAPTRSDSFMMVKSPSAPMAGEPVRPSCPPSDLLYGLEVRPLQAQPMPEGYSDPGIWLGHVPESTSLSVRACSDVTIFVSGNYVVDAVL*KCFVN*
789 >lcl|XP_001504045.1|Plus127805469..27806497 NW_001867402 platelet-activating factor receptor-like LOC100056682 __SEG__ Chr2 {Equus caballus} MESNNSSRVDSEFRYTLFPIVYSIIFVLGVIANSYVLWVFGHLYSSKQLNEIKIFMVNLTVADLLFLLTLPLWVVYYYNQGNWIFPKFLCNLTGCCFFINTYCSVAFLGV
ITYNRFQAVAKPIKTAQASTRKRGISLSLVIWLAIVAAASYFLFMDSTNIVPNKAGSGNITRCFEHYEKGSVPVLIIHIFLVFSFFLVFLIILVCNLVIIRKLLMQPEHL
QRNAEVKRRALWMVCTVLAVFIICFVPHHMVQLPWTLAELGFQNNKFHQAINDAHQVTLCLLSTNCVLDPIIYCFLTKSFRKHLTQKLYSLRSSRKCPLATTETGIEGVM
PLNQIPVNSLKN*
790 >lcl|XP_001504066.1|Plus131370935..31372035 NW_001867364 G-protein coupled receptor 6-like LOC100072266 __SEG__ Chr10 {Equus caballus} MNASASSLNESQVVAVAAEGAATAVTAATAAGARDAGEWGPPAAALALGGGGAANGSLELSSQLPAGPPGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTP
MFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLIVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAAC
SVVRPLTRSHVALLSAAFFAVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINP
IIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV*
791 >lcl|XP_001504074.1|Plus1complement(35618192..35620636) NW_001867377 protocadherin gamma-A5 PCDHGA5 __SEG__ Chr14 {Equus caballus} MAEPLRGWVCRELLPLFVLLGTLWGAGAGQIRYSVPEELDKGSFVGNIAKDLGLEPRQLAEHGVRIVSRGRTKLFALNPGSGSLVTADRIDREELCAQSARCLVSFNILV
ENKMKIYEVQVEIIDINDNFPRFRDEEVKVKVNENAARGTRLVLPFARDADVGVNSLQSYQLSSNMHFSLDEKNGTDGQKYPELVLERPLDREKVAVHDLLLTALDGGDP
ILSGTTHIRIMVLDANDNAPLFTQSEYRVSVPENIPVGTRLLTLTATDPDEGINGKLTYSFRNEEDKISETFQLDSNLGEISTVQSLDYEEFRFYVMEVVAQDGGALLAS
AKVLVTVQDVNDNVPEVILTSLTSSVPEDCLPGTVIALFSVHDGDSGENGEIACSIPRNLPFKLEKSVGNYYHLLTTRALDREGISDYNITVTVIDRGNPPLSTENHISL
KVADINDNPPIFPQTRYSTYIPENNPRGISIFSVTAHDPDSGSNAQVTYSLAKDTFQEMPLSSYVSINSDTGVLYALGSFDYEQVGDLQLWVIASDSGDPPLSSNVSLSI
FVLDQNDNVPEILYPSLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAIADNIPDVLADLGSLEPSANPDNSSLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHRSRLLQASGGGLVGVPASHFLGVDGVRAFLQTYSHEVSLTADSRKSHLIF
PQPNYADMLISEESCEKSEPLLIPEKINANEEELGIVQVSFLFQ*
792 >lcl|XP_001504079.1|Plus1complement(28397066..28398058) NW_001867402 G-protein coupled receptor 3 GPR3 __SEG__ Chr2 {Equus caballus} MLWGASSPLAWLSAGPGNVNVSSVGSAEGTTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGNLAVADLLAGLGLVLHFAAVFCIGSEEMSL
VLVGVLAMAFTASVGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCRDARATCGVVYPFSKNHLVVLAVAFFMVFGIMLQLYAQICRIV
CRHAQQIALQRHLLPATHYVATRKGIATLAVVLGAFAACWLPFAVYCLLGDAHSLPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCGCSSSKILFRSRSPSDV
*
793 >lcl|XP_001504103.3|Plus1complement(92739545..92740513) NW_001867377 olfactory receptor 1019-like LOC100073309 __SEG__ Chr14 {Equus caballus} MQPPHLNKASRTVGMSNQTRVTQFILRGFSDVPELRSVFILFFSFVYLFGLLGNFSIITAVIRECQLHCPMYYFLKNLSFLDICYTSVTIPKALATSLTGSGVISYLECV
AQLYMFITLCTTECFLLTAMAYDRCLAIYRPLLYGAIMSEKLCSVLVVTAWGSGAIYSAFHTLNTFSLPFCGPNLIEHFFCDIPPVMRLACTDYRLSEEVGFAVSSCIVM
SSFALTALSYVWIISTIARIPSVDGRWKSFSTCSSHLTTVVLFYGTGSLVYLRPASQYSPTQGHLASVFYSILTPTLNPVIYCLRNKDMKVALQKLYCRRKH*
794 >lcl|XP_001504105.3|Plus192760026..92760961 NW_001867377 olfactory receptor 1020-like LOC100073310 __SEG__ Chr14 {Equus caballus} MGNQSTVARFILKSFSDDPTVNAVCTGCLLVTYAFGVLANIAVITVITKDGHLHTPMYFFLKSLSFLDVCYTSVTMPKAIVNAILGSQEISFLECAVQLYSFFTLAATEC
FLLTTMAYDRCMAIYRPLVYGVTMSRKLCWELVSTAWICGALYSIFHAINTFSLPFCGPNVIDHFFCDIPPVMRLSCVDYHTNEEVSFIYTSCIILGACVLTLLSYLRII
STIAKIQQVQGRWKAFSTCSSHLTTVLLFYGTGSSLYLRPTSDYSPIQARLAAVFYSIITPTLNPLIYCLRNKEMKVALEKVFLQLQRRKV*
795 >lcl|XP_001504110.3|Plus1complement(13508371..13509306) NW_001867424 olfactory receptor 6C2-like LOC100050632 __SEG__ Chr6 {Equus caballus} MKNCTVTTFILLGLTEDPELQVLIFIFLFLTYLLSITGNLTIIALTFVDPQLKTPMYYFLQNFSFLEMSFTTACIPRYLYNIATGDNIITYNACIMQVFFTDLFAITEFF
LLAAMSYDRYVAICSPLQYVTIMSSRVCRRLVFCCWLAGLLTIAPPLSLGLNLKFCDSNVVDHFLCDAFPLLKISCSDTRLMGKTVLICAVLTLILTLMCVFLSYAYIIK
TILGFPSAQQRKKAFSTCSSHMVVVSITYGTCMFIYMNPTAEKQVTVNKVLSLLVSSISPMLNPFIYTLRNKQVKKAFNNSIKRIASFLKK*
796 >lcl|XP_001504111.3|Plus1complement(92773240..92774211) NW_001867377 olfactory receptor 2G2-like LOC100073312 __SEG__ Chr14 {Equus caballus} MAMERSTNDSSLTGFILLGFSDYPQLQEPLFAVILILYLLTIVGNTTIILVSHVEPKLHTPMYFFLSHLSFLDLCFTSSVIPQLLVNLWDPMKAITYGGCVVQLYVSLAL
GSTECVLLAVMSYHRYVAICRPLQYTALMHPCLCIALATLAWLSGVATTLIQSTFTLQLPFCGHHQVDHFFCEVPVLIKLACVDTTFNEAELFVASVLFLIVPVSFILVS
YGYIAQAVLKIKSTTGRRKAFGTCSSHLMVVTIFYGTIIFMYLQPAKSRCKDQGKFVSLCYTVVTPMLNPLIYTLRNKEVKAALRKILCALVRRDYQQIFRSY*
797 >lcl|XP_001504114.1|Plus1complement(35727351..35729747) NW_001867377 protocadherin beta-14-like LOC100061546 __SEG__ Chr14 {Equus caballus} MAIRGALALRKRQVLILFVLLGLSQAGPESVRYSVAEETEIGSFVGNLARDLGLGVEELSSREARVVSDDNKKHLHLDLPTGDLLLNEKLDREELCSSTEPCVLHFQVVL
ENPLQFFRAELHVKDINDHSPTFLDKEILIQISESTTIGTTFLMESAQDLDIGRNSLQNYTVSPNSHFYIKIRDSSDGKIYPELVLDRELDHEHEPELRLTLTALDGGSP
PRSGKTLVLIKVLDVNDNAPEFPQRLYEVQVLEDTPIGSWIITISAKDLDAGNYGKISYTFLHASEDIRKTFEINPASGDVHLRSSLDFEVTQSYTINIQATDGGGLSEE
CTLLIKVIDINDNPPEVTMSSITKIIPENASETLVALFSVRDKDSGDNGRMVCSIQDDLPFSLKPTFKNFFTLVSEKALDREMRAEYNITITVADMGSPRLKTQHTITVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDRDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVL
VLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYRLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHV
LLVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGGCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRGGTGTNEFKFLKPI
IPNLPVHDTGGNTGENENFRNSFGFNIQ*
798 >lcl|XP_001504115.2|Plus192828044..92829003 NW_001867377 olfactory receptor 2C3-like LOC100073315 __SEG__ Chr14 {Equus caballus} MEIANASSPEVFILLGFSSRPSLETILFVLVLGFYVVSLLGNGTIILVSCVDVHLHTPMYFFLANLSFLDIGFTTSIVPQLLVNLWGPQKTISYGGCVVQFYISHWLGAT
ECVLLAVMSYDRYAAICRPLHYTVTMHPRLCLSLAFISWLGGLTTSMVGSTLTMLLPLCGNNHIDHFFCEMPLIMQLACVDTSLNEVEMYVASFIFVVLPLGLILVSYGH
ITRAVLKIRSAEGRRKAFNTCSSHVAVVALFYGSIIFMYLQPAKSNSHERGKFLALFYTVVTPMLNPLIYTLRNRDVKKALRHLVLEKSCGFVGTRGHI*
799 >lcl|XP_001504120.2|Plus1complement(92936648..92937595) NW_001867377 putative olfactory receptor 2W6-like LOC100073319 __SEG__ Chr14 {Equus caballus} MGRDNDSYQQAFILVGFSDRPRLEIILFAFILVFYILALLGNTAIILLSIVDTRLHTPMYFFLGNLSFLDLCFTTSIVPQLLWNLWGPEKTITYHGCVAQLYIYMVLGST
ECVLLAAMSYDRYVAVCRPLHYTVVMHPHLCLKLVAVAWCCGFLNSFVMCPQTMQLSRCGRRRVDHFLCEMPALIAMSCEDTMLVEAFAFALGVALLLLPLSLILFSYGV
IAATVLRIKSAAGRKKALSTCSSHLTVVSLFYGTIIYMYLQPANSYSQDQGKFLTLFYTIGAPSANPLIYTLRNKDVKGAMKKLVGGRKGLGKPE*
800 >lcl|XP_001504124.2|Plus192968679..92969635 NW_001867377 olfactory receptor 2B11-like LOC100073320 __SEG__ Chr14 {Equus caballus} MRSDNQSFLGDPPKDFILLGVSDRPWLELPLFVVLLVSYVLAMLGNIAIILVSRLDPQLHSPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSKKTISYGGCTVQYAIFHW
LGCTECIILAAMALDRYVAICEPLRYAVIMHRTLCLQPVLVAWLSGFCNSLVQVVLTVQLPFCGRQSLNNFFCEVPAMIKLSCADTAVNDATLAVLVAFFVLVPLALILL
SYGFIAHAVLKMRSSKGRRKAFGTCSSHLLVVCFFYLPAIYMYLQPPSGYSQEQGKFISLFYSIITPTLNPFIYTLRNRDVKGALRRLLSRIWRPCRR*
801 >lcl|XP_001504126.2|Plus1complement(35748982..35751369) NW_001867377 protocadherin beta-16 PCDHB16 __SEG__ Chr14 {Equus caballus} MEIGWTCNRRQRQVLVFFVLLSMSRARAELGPYSVVEETERGSFVANLGKDLGLGLTEMSTRGARIISQGNKEHLQLKVQTGDLLINEKLDREELCGPTEPCVLHFQVLM
EKPLEIFQAELRVKDINDHSPMFTEREMILKIPENSPLGIAFPLSNALDLDVGSNNVENYKISPNSHFQVLTRNRSDGRKYPELVLDKELDREEEPEILLTLTAMDGGSP
PRYGTAQVRIEVVDSNDNAPEFGQPFYRVHIPENSPVGSLVVTVSASDLDSGVYGKISYTLFQPSEDISKTLEVNSVTGEIRLRKQVDFETVQSYEVDIKATDGGGLSGK
CTLLLQVVDMNDNPPEVTISALTSPIPENTPEIVVAVFSVSDPDSGDNGKTISSIQDDLPFLLKPSVKNFYTLVTEGSLDRESRAEYNITITVTDMGSPRLKTQHSITVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVL
VLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYRLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHV
LLVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGGCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRAGSGTSEFKFLKPI
IPNLSSQSRGKEVEENPSFRNSFGI*
802 >lcl|XP_001504128.1|Plus1complement(35759788..35762175) NW_001867377 protocadherin beta-7 PCDHB7 __SEG__ Chr14 {Equus caballus} MEARMEPAVQKRQVLFLCIFLGVSWAGAEPLRYFVTEETERGTFLANLANDLGLGVGELSARGSRIVSDENIRFLLLNPLTGDLLLNEKLDREELCGPTEPCVLPFQLLL
EKPFQIFRAELWVRDINDHSPGFLDREILLEILESTTPGAAFLLESAQDSDVGINNLRNYTISPNAYFHINVHDGGEGNIYPELVLDRVLDREEVPELSLTLTALDGGSP
PRSGTALVRILVLDINDNVPEFVQSLYKVQVPENSPVGSLVVAVSARDLDTGSNGEINYAFFYATERILKTFEINSTSGGLHLKAELNYEAMQTYTLTIQAKDGGGLSGK
CTVVVHVTDINDNPPELIMSSLTSPIAENSPETVVAVFRIRDRDSGNNAKMVCSIQDDLPFVLKPSVENFYTLVTESPLDRESQAEYNITITVTDMGSPRLKTQHNITVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDRDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVL
VLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYRLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHV
LLVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRAGSGTSEFKFLKPI
IPSLQSQNTGREVEENPSFGNDLGF*
803 >lcl|XP_001504133.2|Plus111504520..11505467 NW_001867368 olfactory receptor 8H1-like LOC100050556 __SEG__ Chr12 {Equus caballus} MNRRNNTNLPDFILIGLTDSEETQLVLFMLFLLIYLITVLGNVGMILIIHLNVQLHTPMYFFLSHLSFLDLSYSTVITPKTLEGLMTSTKCISYMSCFTQMYFFVFLGAT
ECFLLSSMAYDRYVAICNPLRYPVVMSTRLCCSLTFGSYLIGFTDSFTNVFCMSRLHFCNSNVIHHFFCDTSPILALSCTDTHDIEIMIFIVAGSTLMMSLITISVSYVS
ILSTILKITSASGKQKAFSTCASHLLGVAVFYGTMIFTYLRPSKSYSLGKDQVASVFYTIVVPMLNPLIYSLRNKEVKNALSRAMQKREGSRQLK*
804 >lcl|XP_001504135.1|Plus1complement(35808705..35811092) NW_001867377 protocadherin beta-4 PCDHB4 __SEG__ Chr14 {Equus caballus} METLERIQPNRQVMAFILMVFLSQSRSEPIRYSVLEETESGSFVAHLTRDLGLGIGELAARSARVVCDDDKQRLQLDRQTGDLLLREKLDREELCGPIEPCVLHFQVFLE
TPMQFFEGELSIQDINDHSPVFPNGEILLKILENSQPGTIFPLKLAQDLDVGSNGLQKYTISSNSHFHVLTRNHSEGKKYPDLVQDKALDREEQPEFSLTLMALDGGTPP
RSGTAMVRILIMDVNDNAPEFVHTTYEVQVLENSPVDSPILTVLARDVDAGNFGSVSYGLFQASDEIKQTFSIDEVTGEIRLTKILDFEQIKSYHVEIEATDGGGLSGKG
TVVIEVVDVNDNAPELTMSSLTSSIPENAPETVVSIFRIRDRDSGDNGKMICSIPDNLPFILKPTFKNFYTLVTESPLDRESQAEYNITITVTDMGSPRLKTQHNITVLV
SDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVLV
LDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHVL
LVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGRCSVPEGPFPGHLVDVSGTGTLSQNYQYEVCLTGDPGTGEFKFLKPIF
PNLLVQDAEREIKENSNCRNSFVFS*
805 >lcl|XP_001504165.1|Plus129553662..29554705 NW_001867402 membrane progestin receptor alpha-like LOC100071257 __SEG__ Chr2 {Equus caballus} MATLVAQKLSHLLPSLRQVHQEPQSSVQPDTVFTVDRAEVPPLFWKPYIYVGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFAGTVDFWGDPHALPLF
IIIFTSFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQYGSALVHFHYAIEPAWHARVHSIFLPMAAFLAWLSCTGSCYSKYTQKPGLLGRTFQEVPSALAYALDI
SPVVHRILVSDPATDDPALLYHKCQVLFFLLAAAFFSAFEPERWFPGSCHVFGQGHQVFHVFLVLCTLAQLEAVALDYEARRPIYEPLHTRWPHNFSGLFLLTMGSSFLT
AFLLSQLVRRKLDRKTQ*
806 >lcl|XP_001504199.3|Plus1complement(25709226..25710176) NW_001867427 olfactory receptor 52A5-like LOC100054056 __SEG__ Chr7 {Equus caballus} MLIFNGSIFMPSVLTLIGIPGLESVQCWIGIPFSVMYLIAVIGNSLILVIIKYENSLHQPMYIFLAMLGATDMALSTCILPKMLGIFWFHLPEISFDACLLQMWFIHLFQ
GIESGVLLAMALDRYVAICDPLRHATIFSQQLLTYMGVGVTLRAAILTAPCLVLIKCRLKLYRTTTISHSYCEHMAIVKLATEDIRINKIYGLFVAFTILGFDITFITLS
YVQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSQIPPYVHILLSNLYLLVPTFLNPIVYGVKTKQIRAHVLKMFFSKKTP*
807 >lcl|XP_001504262.2|Plus1complement(25894312..25895256) NW_001867427 olfactory receptor 51Q1-like LOC100054250 __SEG__ Chr7 {Equus caballus} MLLVTNSTQVPFYFILMGIPGFEVFHTWISIPFCCLYAVSLMGNTTILAVIRSEPSLREPMYLFLSMLALTDLGLTLTTLPTVMGIFWCSASEISFEACFAQFFFLHGFS
FMESSVLLAMSFDRYVAICRPLHYVSILTNRVVSRIGIAIICRCVVAVLPPLFLLKQLPFCGSNHLSHSYCLHQDMIRLVCADTTINNWYGFVLALLIITLDPLLIVFSY
ALILRSVLRVGSQVERLRALNNCLSHILAVLVLFVPMVGLSMTHRFAKHAPPIVHVLMANIYVLAPPVINPIIYSVKTKQIRRRIFLLFSHRPL*
808 >lcl|XP_001504269.2|Plus112096983..12097915 NW_001867414 olfactory receptor 2A14-like isoform 1 LOC100051145 __SEG__ Chr4 {Equus caballus} MTDNQTWITEVTLLGFQVDPALELVLFGLFSLFYTLTLLGNGVILGLICLDPRLHTPMYFFLSHLAIIDMSYASNNVPKMLANLVSQKRTISFVPCIMQTFLYLAFANTE
CLILLVMSYDRFTAICHPLRYTVIMSWKVCLVLVTISWAFSFILALVHLILILRLPFCVRHEINHFFCEILSVLKLACADTRLNQVVIFASCVFILVGPLCLVVVSYTRI
LFAVLKIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSHHPEEQQKILSLFYSLFNPMLNPLIYSLRNTEVKGALRRALCKERPV*
809 >lcl|XP_001504309.2|Plus1complement(31239178..31240113) NW_001867425 olfactory receptor 10G9-like LOC100063713 __SEG__ Chr7 {Equus caballus} MTNMSLVTRFILMGLPHAPALDIPLFGIFLAIYMFTVMGNFLILLVITLDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLVSPGGKAISFPSCVAQLYSFHFLGSTE
CFLYTVMSYDRYLAISYPLRYSSMMNGRMCAFLTISTWLSGSLHSAVQTTLTFHLLYCGPNQIQHYFCDAPPILKLACADTSANEMVIFVNIGVVASGCFLLIALSYVSI
VCSILKIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPSSKDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKVAYSQSK*
810 >lcl|XP_001504333.1|Plus1complement(2529491..2531524) NW_001867396 zinc finger and BTB domain-containing protein 5 ZBTB5 __SEG__ Chr25 {Equus caballus} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNSSQSGEEQPAPMSSSMRGNLDQRTAFPMRRLHKRKQSAEERARQRLRPTMDESAIADVTPE
NGPSGVHSREEFFSPDSLKIVDNPKADGMTDNQEDSAIMFDQSFGAQEDAQVPSQSDNAAGNMAQLSMASRATQVETSFEQEAATEKSGFQCENPEGGLGEKEHMRVVVK
SEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRGGDIHILEVTNNLEHKSTFSISNFLNKSRGSNFSANQNNDDNIPNTTSDCRL
EGEAPYLLSPEAGPAVGPSSAPGAHVENPFSEPAESHFVRPMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPKMPVVTSVRS
SQIPENPASSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL*
811 >lcl|XP_001504344.2|Plus125996283..25997275 NW_001867427 olfactory receptor 51M1-like LOC100054300 __SEG__ Chr7 {Equus caballus} MLAQYPPSLQLMTLPNITQFSPMLYLTGFPGLEAIEHWIFILFFLMYLVAISGNCFILIIVKTNSRLHTPMYYLLSFLALTDLGLSMSTLPTTMGIFWFNSHSIYFEACQ
IQMFCIHSFSFMESSVLLVMSFDRFVAICHPLRYSVIITGQRVVRAGLVVILRGPVALVPIVLLLKAFPYCGPRVLSHSFCLHQEVIHLACADTTFNNLYGLALVVFTVM
LDLVLIAMSYGVILYTVARLTSQEERLRVFQTCTSHLCAVLVFFVPMMGLSLVHRFGKDAPPAVHLLMANIYLFVPPMLNPIIYSIKTKDIRHAISKLLGLRKANAKSWG
*
812 >lcl|XP_001504378.1|Plus150442193..50443206 NW_001867364 trace amine-associated receptor 5-like LOC100073108 __SEG__ Chr10 {Equus caballus} MSAVLDRGAEGHPAAFCYQGNGSCPRRVHPLGIQLVIYLACAAGMLITVLGNLFVVLAVAYFKALHTPTNLLLLSLALADLLLGLLVLPFSIIRSVESCWFFGDFLCRLH
TYLDTLFCLASVFHLCFISIDRHCAICEPLLYPSKFTVRVALRYILAGWGVPAAYTALFLYTDVVERGLSQWLEEMPCVGSCQLLFNKFWGWLNFPVFFFPCLIMISLYG
KIFLVATRQAQKISTLSRSLAGAANHERKAAKTLGIAVGIYLLCWLPFTFDTMVDSLLNFITPPLVFDIFSWFAYFNSACNPIIYVFSYWWFRKALKLFLSREIFSPRTP
TTDLYQE*
813 >lcl|XP_001504383.1|Plus126024230..26025183 NW_001867427 olfactory receptor 51J1-like LOC100054348 __SEG__ Chr7 {Equus caballus} MKHSNSSLEFLPTMFILVGIPDLEAEHIWISIPFCLMYIIIFLGNGTILHVIRTDAALHQPMYLFLAMLALAEVGVSASTLPTVLGIFLFGTNEISFDACLLQMFSIHSF
SIMESAVLLAMSVDRFVAIYSPLRYTAILTLPRILGTGVIIGLKSIMLMAPLPMLLRRLPFCGHNALSHSYCLHPNLIHLPCEDISINNIYGLFIVTSTFGLDSLLIVIS
YGCILHTVLHIATGQGRKKALNTCGSHICAVLTYYVPMIGLSLVHRFGHHVSPLLHAMMASAYLFFSPLVNPIVYSIKTKEIRHGIARILSEKRTRV*
814 >lcl|XP_001504384.1|Plus1complement(50540640..50541671) NW_001867364 trace amine-associated receptor 8a-like LOC100073120 __SEG__ Chr10 {Equus caballus} MSHSPSPPGMVQLCYEGVNGSCIKTPYSPGARVLLYAAFGLGAVLAVFGNLLVVTAVLHFKQLHSPANFLLASLACADFLVGVTVMPFSMVRSVESCWYFGARFCALHSC
CDVAFCYSSLFHLCCISIDRYIAVTDPLVYPAKFTVSVSGMCVSISWILPLVYSGAVFYTGVSNDGMEELVSALNCIGGCQIVVNQDWVLIDFLLFFIPTVVMIILYSKI
FLVAKQQAIKIEHTGGKAESSSESYKARVAKRERKAAKTLGVTVVAFLISWLPYTIDTLVDAFMGFVTPAYIYEICCWGAYYNSAVNPLIYALFYPWFRKAIRVIVSGEV
LKDSSSTISLFSE*
815 >lcl|XP_001504387.1|Plus1complement(50580986..50582029) NW_001867364 trace amine-associated receptor 4 TAAR4 __SEG__ Chr10 {Equus caballus} MNSPDIGNTQEVQFCFALVNNSCPRNVRSVLSVCAMYVVMIGAIVMTMLGNLVVIISIAHFKQLHSPTNFLILSMATTDFLLSCVVMPFSMIRSIESCWYFGDLFCKVHS
CCDIMLCTTSIFHLCFISVDRYYAVCDPLHYVTKITIPVIEVFLFISWSIPIFFALGLVFSELNIIGAEDFVAAIDCTGLCVLIFNKLWGVLASFIAFFLPGTVMMGIYI
YIFTVAQKHAKQIGTGPLMKQVRSESKMKAASKKESKATKTLGIVVGVFVLCWLPFFVLTITDPFINFTTPEDLYNVFLWLGYFNSTFNPIIYGMFYPWFRRALRVIVSG
RVFCPDSSTLSLFPAHA*
816 >lcl|XP_001504390.1|Plus1complement(50594263..50595294) NW_001867364 trace amine-associated receptor 3-like LOC100067625 __SEG__ Chr10 {Equus caballus} MDLTYIPEDLSSCPKFGNKSCPPTNRTFHVRVIMYSVMTGAMVITIFGNLVLMISISYFKQLHSPTNFLILSMATSDFLLGFVIMPYSMVRSVESCWYFGDGFCKFHASF
DMMLSLTSIFHLCSIAIDRFHAVCYPLHYTTTMTSSTIKRLLAFCWSAPALFSFGLVLSEANVSGMQSYEILVACFNFCALTFNKFWGTILFTTCFFTPGSVMVGIYGKI
FIVSKRHARLMSNMSENTKWEVKKNLSKRKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPMIVLDILVWLGYFNSTCNPLIHGFFYPWFRKALKYIVSGKIFS
SHSETANLFPEAH*
817 >lcl|XP_001504394.1|Plus1complement(34031945..34032781) NW_001867402 UBX domain-containing protein 10-like LOC100058492 __SEG__ Chr2 {Equus caballus} MATEAPVNITPPECGTVISTAADSFVWQPDMHVIRPKSAKGRTRPSLHKSQGAEVGSQRTPPCLPPAIPYELPSSQKPGACAPKSPNQGAPEEVPELPQQVSFGGSSSLN
KYPVLPSINRKTLEERAVETVAEKAGSLQLSGIQALYREESCTRKMSTEDSRARARSPERKFIVQTKRQSPSGPGDLEEPSDQEPRLLLAVRSPSGRRFVRHFRPTDNLQ
TVVAVAEHKNKASYRHCSVETMEVPRRRFSDLTKSLQECRIPHKSVLGISQEDGEGWP*
818 >lcl|XP_001504418.1|Plus1complement(26053427..26054377) NW_001867427 olfactory receptor 51L1-like LOC100054394 __SEG__ Chr7 {Equus caballus} MGAENNESLDLLSVFLTGIPGLEAQHGWLSILFFTMYTVDIVGNSLIMAAVQADPALHEPMYLFLSMLSVTEVGVSVSTLPTVMGILWFDARQIDFDGCLSQMFFIHTFS
CMESGVLLAMSYDRFVAIYNPLRYIAILTPPRIISTGLGISLKSVTLMAPLPILLRQLHYCHINVLSYSYCLHSDLIQLPCADTKLNSILGLAIVLATFGLDSLLIMVSY
ILILHTVLGIASREGQQKALNTCVSHICAVLVYYVPMIGVSVMHRAAKHASPLVHTLMSSIYLFVPPVLNPIIYSIKTKPIQQGIATLFSCKRQLL*
819 >lcl|XP_001504490.2|Plus1complement(1233677..1234636) NW_001867396 putative olfactory receptor ENSP00000348552-like LOC100067408 __SEG__ Chr25 {Equus caballus} MESANQTASVTEFILLGLSAHPKLEKTFFVLILSMYLVSLLGNGVLILVTVSVSHLHTPMYFFLGNLSFLDICYTTSSVPLILNSFLTPGKTISFSACAMQMFLSFAMGA
TECVLLGMMALDRYVAICNPLRYPVVMSKAAYVPMAASSWAAGSAASMVQTSLAMKLPFCGNNVINHFTCEILAVLRLACADISINVISMGVTNVIFLAIPVLFIFVSYV
FIIATILQIPSAEGRKKAFSTCSAHLTIVVVFYGTILFMYGKPKSKDPLGADEQDLSDKLISLFYGVVTPMLNPIIYSLRNKDVKAAVRNLVSQKRFTQ*
820 >lcl|XP_001504566.1|Plus126767287..26768234 NW_001867427 olfactory receptor 56A3-like LOC100054762 __SEG__ Chr7 {Equus caballus} MTAHQNATISIEVSDFLLNCFVRSPNWQLWLSLPLSLLFLLAMGANGILLITIQLEASLHEPMYYLLSLLSLLDMVLCLTVIPKVLTIFWFDFKSISFYACFLQMYIMNC
FLAMESCTFMVMAYDRYIAICHPLRYSSIITDQFIAKAAIFILARNVLFTVPIPILSAQLSYCGRNVIENCICANMSVSRLSCDDNTINRLYQFAAGWTLLGSDLILIFL
SYTLILRAVLRLKAEGAVAKALSTCGSHFILILFFSTILLVFILTHVAKKKVSPYVPVLLNVLHHVIPAAINPIVYGVRTQEIKQGIQRLLKKGW*
821 >lcl|XP_001504615.1|Plus1complement(6262123..6265053) NW_001867385 SLIT and NTRK-like family, member 3 isoform 1 SLITRK3 __SEG__ Chr19 {Equus caballus} MMTSSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLG
NNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDH
IGRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHLTASSVEYKSS
NKQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHL
GNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLE
HLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPEMLHVPPAGASPAQPGESHLAGGPTSASPYEFSPPGGPVPLSVLILS
LLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSVQEAG
SAERGGPGTQPPGMGEVLLGSEQFSETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTGNHHHPHPHHPAVGGVSGVAAGSGGDLAGFRHHEKNGGVVLFPPGGGCGGG
SMLLDRDRPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTYRF*
822 >lcl|XP_001504617.2|Plus1complement(45383094..45384044) NW_001867366 olfactory receptor 2V1-like LOC100060387 __SEG__ Chr11 {Equus caballus} MVWVGNQTLISHFIFLGLFTHSPLHIFLFSITMIMFLMALSGNGLMILLINVSPHLHTPMYFFLSWLSLMDLMLISTIVPRMAVDFLMGHGSICFTGCGLQILFFVTLLG
DECFLLAFMAYDRYVAISNPLRYSVVMSRRVCWLMVSGSWLFGLVDGLIQAVFTLSFPYCGSQEIDHFFCDVPAVLKLACADTSLYETMIYVCCILMLLLPFSVISASYL
KILVAVLRMRSAEGRQKAFATCSSHMAVVSLFYGAAMITYMRPQTYHSSKQDKVVSVFYTMITPMLNPLIYSLRNKEVARALKKLLWRCLCSREQD*
823 >lcl|XP_001504620.1|Plus1complement(12410183..12411367) NW_001867424 G-protein coupled receptor 84 GPR84 __SEG__ Chr6 {Equus caballus} MWNNSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTCFNLLIANLTVADLLYCTLLQPFSVDTYLHLYWRTGTTFCRVFGLLLFASNSVSILT
LCLIALGRYLLIAHPKLFPKVFSAKGTVLALVGTWVVGVASFAPLWPIYILVPVVCTCSFDRKRGRPYTTILMGIYFVLGLSSIGIFYCLIHRQVKRAAQALDQYKLRQA
SIRSNHVAGTDYPIPGRFQELDSGLASGGPSERISSEPVSAATTLEGDSSEVGDQSTSKVAKQKAEKSSPRAPAKARPTKGAQRAQDSPSDFGKVTQMCFAVFLCFALSY
IPFLVLNILDANTQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSLLKRGPQSFRRFH*
824 >lcl|XP_001504662.2|Plus127629818..27630741 NW_001867427 olfactory receptor 2D3-like LOC100070120 __SEG__ Chr7 {Equus caballus} MGEGNQTSVAEFILLGLSQDPKIQILLFCLFLIIYLLSIFGNLLIITLIQTDSRLHHPMYFFLKNLSFADLCFSTSIVPQMLVHFLVKKKTISFAGCSLQIVVFLLAGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTQRACVQLAIMSWISGVFVSSVDSAFTLFLPFQGQNVINHYFCEPPALLKLASADTYSAEMALFSMGVIILLAPLSLILVSYWH
IISAVTQMQSGEGRLKVFSTCGSHLTVVVLYYGSGIFAYMRPNSKAMNEKDKVISVFYSVMTSMLNPIIYSLRNKDVKGALRKLAGR*
825 >lcl|XP_001504665.2|Plus13420506..3421444 NW_001867427 olfactory receptor 7D4-like LOC100055518 __SEG__ Chr7 {Equus caballus} MEAGNQTAISKFTLLGLSDDMDLQPLLFGLFLYVYLMCVIGNLLIILAIISDSHLHNPMYFFLSNLSFTDICFSSTTIPKMLVNIQTKSKVITYEGCLTQMYFFMIFAGL
DNLLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLLLLSWLICLTYSLLQSLMVLRVSFCKETEIPHFFCELTQILKLACSDTLVNHIVLYFVTGLLGVIPLTGILFSYSR
IISSIMGIPSTGGKYKAFSTCGSHLSVVSLFYGAGLGVYLTSGTAHPSRKGSIASVMYTVVTPMLNPFIYSLRNRDMNGSLSRLFSRGVYSQ*
826 >lcl|XP_001504682.2|Plus1complement(88205306..88206292) NW_001867387 olfactory receptor 11H1-like isoform 2 LOC100058174 __SEG__ Chr1 {Equus caballus} MIICLLTLQVTDPMNVSEPDSSFAFVREFLLLGFSCEWKILILLFSLFTTTYALTITGNGAIVCALWCDRRLHIPMYIFLGNFSFLEIWYVSSTVPKMLVNFLSDEKTIS
FAGCFLQFYFFFSLGTSECFLLAVMAFDRYLAICRPLHYPNIMTGHLCTKLVIICWVCGCLWFLIPIVLISQMSFCGPNIIDHVVCDPGPLFALLCVSAPRIQLLCYTLS
SLVIFGNFLFILGSYTLVLLAVLRMPSATGRHKAFSTCGSHLAVVSLFYGSLMVMYVSPGLGHSAGIQKVATLFYAMVTPFFNPLIYSLRNKEIKAALRKLLGSFNTI*
827 >lcl|XP_001504697.2|Plus1complement(31603134..31604066) NW_001867425 olfactory receptor 148-like LOC100063748 __SEG__ Chr7 {Equus caballus} MRNHTELNEFILLGIPQAEGLETVLFVIFSFIYLFTMIGNLLIFTAIVSSSALHTPMYFFLGLLSIFDVLFPSVTCPKMLFYLSGQSQAISYKGCAAQLFFHHFLGSTEG
CLYSVMAYDRFVAICHPLRYMLIMRPGVCVGLVMAAWLVGCLQATILTSFTFQLTYCGPNRVDYFFCDIPAVLPLACADTSLAQKVGSANVGFLALMLWFSVCVSYTRIG
IAILRIRSAKGRQKAFSTCSAHLTAILCAYGPVIIIYLQPTPNPLLGAVVQILNNVVSPMLNSLIYSLRNKEVKRSLKRVLYNVIFTALE*
828 >lcl|XP_001504716.1|Plus1complement(88195682..>88196803) NW_001867377 proteinase-activated receptor 2-like LOC100073277 __SEG__ Chr14 {Equus caballus} SCTGTNRLSKGRSLIGKAESPAHVTGKGVTVEPGFSVDEFSVSVLTGKLTTVCLPLVYTIVFVIGLPSNGMALWVFLFRTRKRHPAVVYMANLALADLLSVIWFPLKIAY
HIHGNNWIYGESLCKVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMVHPRKKANIAIGVSLGIWLLILLVTIPLYVVKQTVYIPALNITTCHDVLPKEVLVGDMFNYFL
SLAIGVFLFPAFLTASAYVLMIRTLRSSTVDENSGKKKQRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKNWSQSHVYALYIAALCLSTLNSCIDPFVYYFVSQDFRNH
AKNALLCRSVRTVKQMQVSLTSKKFSRKSSSYSSSSTSVKTSY*
829 >lcl|XP_001504727.2|Plus131711470..31712396 NW_001867425 olfactory receptor 10G9-like LOC100063780 __SEG__ Chr7 {Equus caballus} MRNVSLLTTFILMGLPHAPLLDSPLFGIFLVIYVLTVVGNLLILLVIMVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLASPGGKAISFHSCVAQLYSFHFLGSTE
CFLYTVMSYDRYLAISYPLRYSSMMSGRTCALLAASTWLSGSLHSAVQTMLTFHLPYCGPNQIQHYLCDAPPILKLACADTSAIEMVIFVNIGVVASACFLLIVLSYVSI
VCSILKIHTSEGRHRAFQTCASHCIVVLCFFLPCVFIYLRPGSKDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLNLKHKVAYS*
830 >lcl|XP_001504756.2|Plus1complement(4372032..4372970) NW_001867369 olfactory receptor 5AN1-like isoform 1 LOC100066693 __SEG__ Chr12 {Equus caballus} MTQGRNITAITHFLLLGFSDFPRIRAVLFVVFLLIYITTLTWNLSLIILIRLDSHLHTPMYFFLSNLSIIDICYVTSTAPKMLSNFFQEQQTITLVGCAVQYFIFSTMGL
SESCLMTAMAYDRYAAICNPLLYSSIMSPTLCVQMVLGSYMAGLSASISQLCALLQLQFCGPNVINHFFCDMPQLLVLSCTDTFFVQLMTAVLTMIFGIINVSIIMISYG
YIVISIMKITSAKGRSKAFSTCASHLTAVTLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKKRKYC*
831 >lcl|XP_001504758.2|Plus1<31874848..31875789 NW_001867425 olfactory receptor 8G5-like LOC100071977 __SEG__ Chr7 {Equus caballus} RKMTEGNHSTVTEFILAGLTEQPELQLPLLLLFLGIYVVTVVGNLGMITLIGLTSHLHTPMYYFLSSLSFIDLCHSTVITPKMLMNFVTERNIISYPACMTQLYFFLVFV
ISECHMLAVMAYDRYVAICNPLLYNVTMSNQVCSWMVVGVYIMGLSGATAHTGCMLRVLFCKADVINHYFCDIFPLLELSCSSTYINEVVVLCFSAFNILTPTLTIFGSY
VFIIAGILHIHTTEGRSKAFSTCSSHISAVAVFFGSVAFMYLKPSSVNSMDQAKVSSVFYTIIIPMLNPLIYSLRNKDVKVALNKILEKRTYL*
832 >lcl|XP_001504765.2|Plus1complement(14493252..14494181) NW_001867424 olfactory receptor 6C4-like LOC100051089 __SEG__ Chr6 {Equus caballus} MKNWTTFAEFILQGLTDQPELQAVIFIFLFLAYLLSVLGNLTIIILTLVDPHLKTPMYFFLRNFSFLEISFTSIFIPRFLMSLTTGNKAISFAGCMTQYFFAIFLGGTEF
YLLASMSYDRYVAICKPLHYLTMMSSRVCIQLVFCSWLGGVLAILPPFILMSQIDFCASNVLNQYYCDYRPLLELACSDTSLLELIVIFLAVLTLVVTLVLVTLSYIYIV
RTILRIPSAQQRTKAFATCSSHLIVITFSYGSCIFLYINPSPKKGGNFDKEISLLMTSVSPLLNPFIYTLRNQQVKQAFKSTVKKIVKI*
833 >lcl|XP_001504793.3|Plus1complement(3951953..3952969) NW_001867427 olfactory receptor 7G1-like LOC100055685 __SEG__ Chr7 {Equus caballus} MLLLLIRGPFVLLSFHPIFSIRFINNMETTNHTNAPEFFLLGLTDDPELQPLIFYLFLSIYLVTILGNLIIILAVITDSHLHTPMYFFLSNLSFTDICISTTIIPKILLN
IQEQNKSIAYIACLTQTCFVLVFAGFENCLLAAMAYDRYVAICHPLRYTVIMNPHLCGLLILLSLFLSILDALLHSLMVLQLSFCKDLEIPHFFCELAQVLKLACSDTLI
NNILTYFMASILGGIPLSGIIFSYTKIVSTILRMPSAGGKCKAFSTCGSHLSVVSLFYGTGFGVYISSSVTDSRRKLAVASMMYIVLPQMVNPFIYSLRNRDVKRALKKL
TRRKLSLR*
834 >lcl|XP_001504813.2|Plus129017077..29018006 NW_001867427 olfactory receptor 491-like LOC100055427 __SEG__ Chr7 {Equus caballus} MVRNRTSVTEFIILGLTKDPTLCVIFFVIFLGIYAATLVGNISIITLIRSCSQLHSPMYLFLSHLAFVDIGYSTSVTPLMLVGFLGHEMALPVTICEAQLYSVVTFGTAE
CFLLAAMAYDRYVAICSPLFYSTHMSPRICILFVGTSYLGGCVNAWTFTSCLLRLSFCGPNQIDHFFCDFSPLLKLSCSDISIIQIIPSISSGSIIVVTVFVIALTYVCI
LITILKMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVLPKSGYSTDQNKVVSLFYTVVIPMLNPLIYSLRSRDVKEALRKVTVRIYS*
835 >lcl|XP_001504935.2|Plus1complement(32342775..32343701) NW_001867425 olfactory receptor 8D2-like LOC100072077 __SEG__ Chr7 {Equus caballus} MAKSNHSSVTEFILEGLTKRPELQLPLFILFLGIYVVTVVGNLGMILLITISSQLHSPMYYFLSNLSFIDLCYSSVITPKMLVNFVSEKNIISFLECMTQLYFFLIFVIA
DGYLLTAMAYDRYVAICSPLFYNIIMRHRVCSIMMVVVYSLGLFGATAHTTCMSVLSFCGCHIISHYFCDILHLLTLSCSSTHINEILLFIIGGVNTLAPTLAVFISYAF
ILSSILCIHSTEGRSKAFGTCSSHLMAVGIFFGSITFMYVKPRSSNTMEQEKISSVFYTTVIPMLNPLIYSLRNKDVKNALRKVTGRK*
836 >lcl|XP_001504949.2|Plus1complement(32497134..32498066) NW_001867425 olfactory receptor 143-like LOC100064003 __SEG__ Chr7 {Equus caballus} MAVENDSFVTEFILMGFKDQPELQLPLFFLFLVNYVVTVVGNWSLINLICLNSHLHTPMYFFLFNLSLIDICYSSVFTPKMLTGFISESNFISFKGCMTQLFFFCFFVNA
ECYVLTAMAYDRYVAICKPLLYMATMSPQMCSMLMSGSYVMGFAGAMVHTGCMMRLIFCDSNIINRYMCDIFPLLQLSCSSTYVNELVMSGIVGTIVVVSGLIIFISYVL
IIFNILHISSTKGWFKAFSTCGSHIITVSLFYVCGLLTHVKSSPAGSVAQGKVFSVFCTNVVPMLNPLIYSLRNKDVKLAMKETLKRIIN*
837 >lcl|XP_001504950.2|Plus1complement(89042625..89043548) NW_001867387 olfactory receptor 4N2-like LOC100072254 __SEG__ Chr1 {Equus caballus} MESENSTVVAEFILLGLTQSRDMQLLVFVLVLIFYLIILPGNFLIILTIRLDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EELLLVVMAFDRYMAICRPLRYSTVMNPRACYVLILAQWLGGFVHSIIQVALILHLPFCGPNQLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLASYAV
ILCHVHGSSSKGKSKAMSTCTTHIIIIFLMFGPAVFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASVRRLFNQHIT*
838 >lcl|XP_001504962.1|Plus1complement(2073170..2074312) NW_001867369 apelin receptor-like LOC100066889 __SEG__ Chr12 {Equus caballus} MEEGGEFDNYYGADNQSECEYTDWKSSGALIPAIYILVFLLGTSGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYWDYDWPFGTFACKLSSYLIF
VNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVFRSTGDLENTTKVQCYMDYSMVATTSSEWAWEVGLGVSSTAVGFVAPFIIMLTC
YFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCWGQSR
CGGASHSSSGEKSASYSSGHSQGPSPNSGKGGEQMHEKSIPYSQETLVVD*
839 >lcl|XP_001504990.2|Plus1complement(32703133..32704077) NW_001867425 olfactory receptor 8B3-like LOC100064030 __SEG__ Chr7 {Equus caballus} MLARNDSLVTEFVLAGLTDCPELQKPLLFLFTVIYVVTVVGNLGLIILISLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLVNFVSKKNIISYVGCMTQLFFFLFFVIS
ECYMLTSMAYDRYVAICNPLLYKVTMSHQVSSVLTFAAYLMGFAGATAHTGCMLRLTFCDVNIINHYLCDILPLLQLSCTSTYVNEIVVLIVVGINITVPSFTILISYIF
IITSIFHIKSTQGRSKAFSTCSSHIVALSLFFGSAAFMYLKYSSPGSMEQGKVSSVFYTNVGPMLNPLIYSLRNKDVKVALRRALIKIQRRNML*
840 >lcl|XP_001505075.2|Plus1complement(876431..877387) NW_001867372 olfactory receptor 2AE1-like isoform 1 LOC100067175 __SEG__ Chr13 {Equus caballus} MWQRNQTSLADFILEGLFDDSLAQRFLFILIMVVFLIAVSGNTLTILLICADPQLHTPMYFLLSQHSLMDLMHVSTTIPKMATNYLSGKKSITFVGCATQHFFYLSLGGA
ECLLLALMSYDRYAAICHPLHYTVLMNRKVGLMMAAISWLGASINSLIHTVILMHFHFCGPQNIRHFYCEFPALVKLVCEDITVYETTVFISSVLLILLPIFVVSIFYAF
ILHSVIQMRSAGSKRNAFATCSSHLTVVSLSFGACIFSYMRPRSKRTPLQDKVAPVFYSIITPTLNPLIYTLQNKDVAKALRRVLGRDITRRQQLWFP*
841 >lcl|XP_001505168.1|Plus1complement(80490238..80491305) NW_001867384 G-protein coupled receptor 1 GPR1 __SEG__ Chr18 {Equus caballus} MEDLEETLFEEFENYSYALEYYSPEADLEEKVHLGIAHWASLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLC
KANSFIAQLNMFASVFFLTVISLDRYIHLIHPVLSHRNRTPRNALIVIIFVWLLASLMGSPALYFRDTLEFDNHTLCYNNFHEHDPDLIEMRHHVLTWVKVIIGYLFPLL
TMSICYLCLILKVKKRSIVISSKHFWTILAVVTAFLICWTPYHLFSIWELTIHHNGSFHQVLQAGIPLSTSLAFLNSCLNPILYVLISKKFQVHFRASVAEILKNTLWEV
SCSGTVSEQLRSSETKHAHLLETAQ*
842 >lcl|XP_001505175.2|Plus1complement(89647992..89648963) NW_001867387 olfactory receptor 4K5-like LOC100058435 __SEG__ Chr1 {Equus caballus} MGKANSSVVSEFVLLGLSSSQELQLFFFVFFSTLYVVIVLGNLLIIITVTSDNSLRSPMYFLLGNLSFVDICQASFATPKMIAGFLSEHKTISFSGCIAQIFFIHLFTGG
EMVLLVSMAYDRYVAICKPLHYVVIMNQRTCTVLVMISWTVGLIHTVSQLSFTVNLPFCGPNIVDSFFCDLPRVTKLACLDSYTIEILIVVNSGILALSTFSLLVSSYII
IFVTVWFKSSATMAKAFSTLAAHITVVILFFGPCIFIYVWPFTIYPVDKVLAIFYTIFIPILNPIIYTLRNRDMKAAMRKIVTHYLRPKKISETPLAVRSSFY*
843 >lcl|XP_001505176.2|Plus1<89892987..89893952 NW_001867387 olfactory receptor 11G2-like LOC100058482 __SEG__ Chr1 {Equus caballus} FDGVFTAHRSMKISNTPNNSSTITGFILLGFPCPREGQILLFVLFSVVYLLTLMGNGSIICAVRWDQRLHTPMYILLANFSFLEICYVTSTVPNMLANFLSDTKVISFSG
CFLQFYFFFSLGSTECFFLAIMAFDRYLAICWPLHYPILMTRCLCTNLVVSCWILDFLWFLIPIIVISQISFCGSRIIDHFLCDPGPLLALTCTRAAAIELTSSILSSLL
LFVPFLFIMVSYALVLTAVLRVPSAAGRRKAFSTCGSHLAVVSLFYGSVMVMYVSPTSEHEAGMQKIVTLFYSVVTPLLNPVIYSLRNKDMKHSMKKLLRT*
844 >lcl|XP_001914680.1|Plus1complement(271581..272516) NW_001867395 olfactory receptor 2L5-like LOC100061290 __SEG__ Chr24 {Equus caballus} MENYNQTSTDFILLGLFPPSKIGLFFFILVVLIFLMALFGNLCIMLLISLDTHLHTPMHFLLSQLSIIDLNHISTIVPKMVSNFLFGNKSISFIGCGVQSFFFLTLGGAE
ALLLTSMAYARYIAICFPLHYSSRMSKTVCVLMIIGSWIMGFVNSCAHTTYAFHIRCYQSRTINHFFCDVPAMLTLACMDTWVYDHTVFMSTILFLMLPFLGIACSYGWV
VLVVYHMHSAEGRKKVYSTCSTHLTVVTFYYVPLFYTYLHPRSLRSPTKDKVLAVFYTILTPMLNPIYSLRNREVMGALRRVIQRICTEKM*
845 >lcl|XP_001914683.1|Plus1complement(36392..37330) NW_001867390 olfactory receptor 2M3-like LOC100146773 __SEG__ Chr21 {Equus caballus} MAWENQTINSGFILLGIFNHSPTHIFLFSLVLSIFTVAFMGNTAMVLLIYLDTQLHTPMYFLLSQLSLMDLMLICTTVPKMAFSYLSGKKYISLASCGTQMFFSVSLLGA
ECFLLAAMAYDRYVAICYPLRYSVLMSQKICGLMAASSWILGSLDGIIEVAVVLSFSYCGAREIPHFFCDVPALLTLSCTNTLLFQRMIFICCVIMLLFPVAVIIASYVH
VIRAVIRMGTGDGRRKAFTTCSSHLMVVGMYYGAAMFIYMRPTSDRSPTQDKMVSAFYTILTPMLNPLIYRLRNKEVARAFTKVLGKGKPGE*
846 >lcl|XP_001914741.2|Plus1complement(1100171..1101172) NW_001867433 neuropeptides B/W receptor type 1-like LOC100054252 __SEG__ Chr9 {Equus caballus} MHNATSSEPELSNVSCAGIALGCPNASSLPPPPPPPPPLPLAVAVPVVYSVICAVGLAGNSAVLYVLLRAPRMKSVTNMFVLNLAIADELFTLVLPINIADFLLQQWPFG
ELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYGAARAVSLAVWGLVTLVVLPFAVFAGLDDEQGRRQCVLVFPQPEAFWWRASRLYSLVLGFAIP
VSTICVLYTTLLCGLRAIRLDSHAKALDRAKKRVTLLVVAILVVCLLCWTPYHLSTVVALTTDLPQTPAVIAVSYFITSLSYANSCLNPFLYAFLDDSFRRSLRQLLACR
AAA*
847 >lcl|XP_001914853.1|Plus1complement(2776434..2777765) NW_001867406 beclin-1-like protein 1-like LOC100060790 __SEG__ Chr30 {Equus caballus} MSSIHFMCWRCDQPLKLNQSTETPGLDATQASAASALASAEGAPRETQEGGPTSREETDSDELQDGASCRTLPGDGRMSGDSSNYFILLGKLSSVRTLNSIQKAARDIFD
ILSSEKAVNQPLCEDCTDNLLLQLDSQLVLTASESENYQRFLETRERMSEDERETLQEELKGLELEEARLVQELEEVDKNRERAAADLKAAQAETEMLDQHDRQFWRDYS
QLKWQQLELHDELRSVENRLRHAQTQLDWLEKINVFSVTFEIGHSGPVGVINNFRLGCLPSVPVCWEEINAAWGQTALLLLALSNTIGLQFQRYRLVPCGDHSYLKSVRD
DSIELPLFCTGRQGAFPNDKFDRAMDKFDRAMVAFLDCLQHFNKEAKKGESGLCLPHRIHVSKGLMEDPGGGGAFYSIRTHFNTEERWTKALKLMLVNFKWSLAWVSLRY
RQK*
848 >lcl|XP_001914871.1|Plus1complement(2177457..2178407) NW_001867417 olfactory receptor 2T29-like LOC100147503 __SEG__ Chr5 {Equus caballus} MLVANNTKWSDFILMGFFSESKHPVLLSVVIFVVFLMTLFGNTILILLVYSQAHLHTPMYFFISRLSLMDMMYISVTVPKMLMDQVMGVNEISAPECEMQMFLYLSLLGS
ECFLLAAMAYDRYVAICHPLHYPILMNHRVCLLLVSGCWFLGSVDGFMLTPVTMTFPFCRSQEIHHFFCEVPALMKLSCSDTSLYEMLMYRCCALMLLIPVIVISSSYTF
ILLTIHRMNSAEGWKKALTTCSSHMMVVTLFYGASVYTYMFPSSYHTPEKDMVVSVFYTIITTVLNPLIYSIRNKDVTGALKKMLNVGTVFQETIK*
849 >lcl|XP_001914876.1|Plus1complement(3759113..3760135) NW_001877044 cysteinyl leukotriene receptor 1-like LOC100072636 __SEG__ ChrX {Equus caballus} MDGVGNLTVSPASNNTCNDTIDDFRNQVYSTLYSMISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNL
YCSIFFMTAMSFFRCIAIVFPVKNINLVTQKKARFVCAGIWIFVILTSSPFLTATSYKDEKNNTKCFEPPQDNQAKKHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLL
KNSMKKNLSSRKKAIGMIIVVTAAFLISFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVSKKRVSL
PEKGEEICKE*
850 >lcl|XP_001915086.1|Plus17446409..7447710 NW_001867412 probable G-protein coupled receptor 22 GPR22 __SEG__ Chr4 {Equus caballus} MCFSPILEINMQSESNITVRDDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMKSNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESN
TALICCFHEACVSFASVSTAINVFAITLDRYDISVKPANRILTMGRAVMLMISIWIFSFFSFLIPFIEVNFFSLQSGNTWENKTLLCVSTNEYYTELGMYYHLLVQIPIF
FFTVIVMLITYSKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHETTDMSQSSGGRNVVFGVRTSVSVIIALRRAVKRHRERRERQKRVFRMSLLIISTFLLCWTPIS
VLNTTILCLGPSDLLVKLRLCFLVMGYGTTIFHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPMPNNAVIHNSWIDPKRNRKITFEDSEIREKCLVPQVVTD*
851 >lcl|XP_001915095.1|Plus1complement(501638..502573) NW_001867401 olfactory receptor 2L3-like LOC100070887 __SEG__ Chr29 {Equus caballus} MENYNQTSTDFILLGLFPPSKIGLFFFILVVLIFLMALFGNLSIMLLIFLDTHLHTPMYFLLSQLSIELNHISTIVRKMVSNFLFGNKSISFIGFGVQSFFFLTLGGAEA
LLLTSTAYAHYIVICFPLHYSSHMSKRVCVLMIIGSWIMGFVNSCAHTTYAFHVPYCESRAINHFFCDVPAMLTLACMDTWVYEYTLFMSTILFLIFPFIGIACSYGRVV
LAVYHMHSAEGRKKVYSTCSTHLTVVTFYNVPLFYTYLHPRSLRCPTKDEVLAAFYTILTPMLNPIIYSLRNREVMGTLRRVIQRLCTEKM*
852 >lcl|XP_001915163.2|Plus1complement(3145804..3146751) NW_001867369 olfactory receptor 1S1-like LOC100147351 __SEG__ Chr12 {Equus caballus} MHQGNKTTISEFFLLGLSNQPEQQKLLFVLFLGMYLVTVVGNGLIILVISLDSYLHTPMYIFLANLSFADISSISTSVPKMLMNIQTKSQSISYESCITQMYFALMSVTI
DNFLLGAMAYDRFVAICHPLNYMTIMQKKLCILLTVIPWVLSNIVALTHTLLLLRLVFCDSNTLPHFFCDLALLLKLSCSDTMINELVLFIVGLSVITFPFAIIFFSYIC
IVRAVMRISSTEGKWKAFSTCGSHLTVVLLFYGTIVGVYFFPSSTHHDDRDKIGAVLFTVVTPMVNPFIYSLRNKDMKSALRKLISSKSFLPLMP*
853 >lcl|XP_001915199.1|Plus1complement(3267946..3268884) NW_001867369 olfactory receptor 5B2-like LOC100067534 __SEG__ Chr12 {Equus caballus} MDNKTEVMQFILVGLTDNPELHIPLFIMFTLIYLTNVVGNLGMILLILMDSHLHTPMYYFLSNLSLVDLCYSSAVTPTVVAGFITGDKIISYNACAAQMFFFAAFATTEN
FFLASMAYDRYAAVCKPLHYTTTMTTSMCARLIIGCYACGFLNASIHVGNTFRLPFCMSNVVHHFFCDIPAVLALSCSDRLVSELVLLYVASFNVFFALLVILISYLFIF
ITILNKHSSAGYQKALFTCASHLTAVSIFYGTLIVMYLQPSSSHSMDTDKTASVFYSMIIPMLNPVVYSLRNKDVKSAFKKVLLETKLSVCL*
854 >lcl|XP_001915247.1|Plus16744566..6745300 NW_001877043 OTU domain-containing protein 6A-like LOC100146692 __SEG__ ChrX {Equus caballus} MEDSQRMVRRHYREKKELQARIQSMKNSVPKSDKERRKQLLLDVARLKAEMEQKHQQELEKFQESFPDDSNLDSVTEDLAKMDLENQPPRLAKAQRRRERRAAEEAARLE
RIAEVEAERQAGFRHDDEEEKLSAILEARNLEMKEIPADGHCMYRAIQDQLVFPVTVESLRRRTANYLRKHVDDFLPFFSDSETGDTCSRDSFLSYCDDIVHSALWGGQL
ELRALSHVLADPHRGDHFLLISSY*
855 >lcl|XP_001915301.1|Plus1complement(10313687..10314655) NW_001867408 olfactory receptor 7A17-like LOC100146200 __SEG__ Chr31 {Equus caballus} MVPGNGTQNSEFLLLGLSKEQELEPLIFGLFIFMYLATILGNLLIILATVSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLVNIQTQSKVITYKGCISQMYFYILFAVL
DDFHLAVMAYDRFLAICHPLSYTVMMSPQLCKLLVLISWLISALHSLLESLMVLRLSFCTDLEIPHFFCEIKQVIRLACSDYSLSDTVMYVTAVLLAGGALAGILYSYSK
LVSSICGIPSAQGKYKAFSTCVSHLSVVSLYYFSSLGVYLLPAPTHSSRSSAAASVMYTVVTPMLNPFVYSLRNKDIQRALKRVVQMVCIKKKIVLGLKKCP*
856 >lcl|XP_001915304.1|Plus1complement(3291193..3296157) NW_001867428 RIMS-binding protein 3A RIMBP3 __SEG__ Chr8 {Equus caballus} MTKDSPSPSGGSRATPKKPSSPSPAAAVLEEQRRELEKLRAELEAERARGRAERRRFATHERQLREVAERERQQLVDHLRSKWEAQRGQELRQLQEEMLREREAEIRQLL
RWKEAEMRQLQQLLHRERDGVVRQARELQRQLAEELVNRGYCGRAGAPEAAAAQCHCRLQEVLAQLRWETDGEQASRIRHLQAALDKERQLFLKYILEHFHWHPALSGSP
DPQAVHSSGEPPPETAGASRDPPKSACRLESLDSLSSGVRGLSRSLDEVPAACSNSPDSLLPTRSSSLDSLAPARSHSLNSTLSRPKAPESEERASSSPDASIVGSPSPP
PPPPPPPPPPPPPPPSEHRRPRDPRRGEEARKQPCGAPTPLPPGLDYHELVKQNAELSDAVQVLARRCSGLREENMQLRRAGFPEEANEKVKRLKVKHAELTGLARRLED
RARKLQETNLRAVSAPVPGESRAGLELCQAFARQRARDLSEQASALLAKDKQIEELRQECHLLQARVASGVSSALHSGGIAARTQGLSVSDLDRLQRESQREVLRLQRQL
ALQQGTVGARAEAGGQSAPCEEARRQVQELERELGARRLECEELGAQAAAARRRGEEAEAQLQAALREGAWLAKENARLQAQADWTQKVAAENNDVRGQLGRACQERDAA
GLLAEQLLQQAARGQDRQQQLQHDLRKALSDLQAAREEMWALQCQPGHPSQEPQESPQTVEYQVKGSGRTKFKPGPEDQASSQPSRDKQEKKEASLLETPVALGEPATAP
QVPDRVLASQPLDARPQAKKTSSHLNFSSEVESMWATIQSCPALDMDTASEGEDLEPDSVSSTLEAGDSEAPTTPKFKIFLAQYSYNPFEGPNEHPESELPLTAGDYVYI
FGDMDEDGFYEGELEDGRRGLVPSNLVEQIPDSDILGCLPPEAADLGPTRLPAGQTKALKEDAGHSLLHGKAQEAVDRGPCQMVWAGSKTEAAIEISDAKTEHGRLGLQQ
SVEEEGFSRSLLGANGALCVAPMQLHLQSVAATSAEVTWVYSSSSHPHMVYLGDQEHALTPAGVSSYTFHNLHPGTRYQARVEVRLPWDSLQVLWETMSSTITFDTPLAG
PPDPPLDVLVERHASPGLLVVSWLPVTIDSAGSSNGVRVTGYAVYADGLKVAEVADATAGSTLLEFSQLQLPLMCQKVSVRTMSLCGESLDSVPAQIPHDCFTCQQLPET
SPFSYTCGDPSTCRVTFSFCPQRLALSSLSAKASPHIPGSCGEPQAQFLEALPEEPPRRRSPMPDLSSEGECPSTGSGRQAQGPADTQEVYRKDLLFQKSPQNHRPPLPS
GQPVGEEDHYQHMGTSQSPALGVVHLSPECGPGKEPCQEKAALEKVLRQKQDSQRFAPPQLGTSQRHVSDFCDILQEEAAVCFRPWGTERREQKKELSTQSRRGQALGGK
RECQLHEPSSALCPAPSSKVIKMSRGGPPLLGTGVDSPAKLSVALFDYDPLVMSANTEAAEEELAFQKGQLLRAESSQDTHGFYHGECNGQVGHVPGQLVAEVEGCMEQT
DGRWHLPAQGHLPSVAHLDTLGEVTNPQSSFPMPQGNPRRPPLWTPMTMMAALDYDPKDERAGGPVKGKLSLRAGDVVKVYGPVDDKGFYYGESGGHRGLVPAHLLDHMS
LHGE*
857 >lcl|XP_001915317.1|Plus13570444..3571370 NW_001867369 olfactory receptor 9I1-like LOC100067906 __SEG__ Chr12 {Equus caballus} MAKNNLTTVTEFILMGFTDYPKWEVPLFLVFLSIYLVTLLGNAGMIILIQVDVQLHTPMYFFLSHLSLLDACYTSVITPQILATLPTGKTIISYGQCAAQFFFFTCCAGT
ECFLLSVMAYDRYVAISKPLLYTVAINPRICWILAVGAYVCGMSGAILRTACIFTLPFCDNNQINFFFCDVPPLLKLTCSDTTNTEIVLVLFGNLMLLSNAMVILISYLL
IIKAIWRVKSSGGRTKTFSTCASHLTAVALFFGTLIFMYLRSGSGKSPEEDKVVSVFYTVFIPMLNPLIYSLRNKDVKVAFRKVTGRF*
858 >lcl|XP_001915332.1|Plus1251048..252010 NW_001867401 olfactory receptor 2T4-like LOC100065963 __SEG__ Chr29 {Equus caballus} MDNTTWVTNNTKWSDFILVGLFSQSKHPVLLCVVIFVVFLMTLFGNTILILLVYSQAHLHTPTYFFISQLSLMDMMHISVTVPKMLMDKVMRVNKISAPECGMQMFLYLS
LVGSECFLLAAMAYDRYVAICHPLHYPILMNHKVCLLLVSGCWFLGSVDGFMLTPVTMTFPFCRSQEINHFFCEVPALMKLSCSDTSLYEMLMYLCCVLMLLIPVIVISS
SSTFILLTIHRMNSAEGWKKALNTCSSHMMVITLYYGASIYTYMFPSSYHTPEKDMVVSVFYTIITPFLNPLIYSIRNKDVTGALKKMLSVGSVFQETIK*
859 >lcl|XP_001915368.1|Plus1697330..698277 NW_001867401 olfactory receptor 7A10-like LOC100147534 __SEG__ Chr29 {Equus caballus} MEPGNNTQISGFLLLGFSEKPELQLLIFGLFLTMYLITVCGNLLIILAVSSDSLLHTPMYFFLCNLSFVDICFTSTTILKMLRNIQTQSKVITYEGCITQIYFFILFAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNHRLCGLMILGSWIMCILNSLLQSLTALRLSFCTNLEIPHFFCELNQMVQLACSDTFLNNMVMYFAAVLLGGGPFAGILYSYSK
IVSCILGISSAQGKYKAFSTCVSHLSVVSLFYCTVLGVYLSSAATHSSHSSAIASVMYTVVTPMLNPFIYSLRNKDIKKALKSFFVKETTKLSQH*
860 >lcl|XP_001915377.1|Plus1complement(130940..132517) NW_001867407 uncharacterized protein C1orf65-like LOC100070594 __SEG__ Chr30 {Equus caballus} MPGPQLTDQAPGRLGAGQPSPAWQQQVRAATTNSFGPARFYPRDQGDLTLALTPRGSYTPLSETVRGRKAQSGDQWAVPVCGGLGRWSFSSVPTERSSAPSQEFRTQSAC
MYTRKRDSSGPVESVASQYSQPSVSSREVQGQHTQILKDKLEEAVTSSRDEKIVALVLVRLKKAQRMRELQQQAALAWEELKRSDQKVQMTLERERKLLLQQGREQWQPE
KERRKTRQSREQRVRRQDSHAKNTIQQQNRCKAPLDDQENPRREKLETARAVAEHRKQCQVQRLQEQERVLQNLREQNGLQLQKRLEQACKKKRLYTVESQKKVQETNLS
SLVNYQARKVLMDCQAKAEELLRKLSLEQSSQRSQEIQQSLMKERHRELREKAQKEGAQLQQVKWRAEASEEQRQVHKRLLAELRDQKIQQTRSHVHSNMRDKVQHIREL
SVLREKNHHILKLKAEKEEKCHIEGIKEAIRKKERRMEQISREKDAILEEFQKISRATRRNTERVLANSGFSGLAPRAGRQGGGY*
861 >lcl|XP_001915386.2|Plus1complement(9754583..9755581) NW_001867429 G-protein coupled receptor 81-like LOC100060403 __SEG__ Chr8 {Equus caballus} MDNESCCLIEGDPIPQVMPPLLILAFVLGALGNGIALYGFCFHMKTWKPSTIYLFNLAVADFLLMVCLPFRTDYYLRHRQWAFEDIPCRVVLFMMATNRAGSIVFLTVVA
VDRYFKVVHPHHMMNTISNRTAAGIVCALWTMIILGTLYLLMEKHLCVQGETVSCESFIMESANGWHDVMFQLEFFLPLGIILFCSFKIIWSLKQRQHLARQTRMKKATR
FIMVVAAVFVTCYLPSVSARLYFLWTVPLSACDPSVHIALHVTLSFTYMNSMLDPLVYYFSSPLFPKFYAKLKIGSLRPKRPGRSKTRRPEEMPVSSLCHRSCTSVTNSF
QS*
862 >lcl|XP_001915397.1|Plus1complement(809185..810129) NW_001867401 olfactory receptor 2T33-like LOC100146765 __SEG__ Chr29 {Equus caballus} METRNTTSDFILLGLFKHTGPHLFLFMVVLTMAIASFMGNALMLLLIYWDPRLHIPMYFLLSQLSLMDVMLVATILPKMAADYLTGKKSISLAGCGLQIFVSITLDGGES
FLLAAMSYDRYVAVCHPLQYPVLMSQELCLRMILGSWFLGAADGLMQAAATLSFPFCSTREMDHFFCEAPMLVRLACADTSVFEYVMYICCVLMLLAPLSLILTTYSLIL
IAVLQMRSREARQKASATCSSHLAVVGLFYGAAIFIYMRPKSYRSANHDKLVSAFYTIFTPVLNPLIYSLRNSEVKGALKMWLGKCVNLNCQQT*
863 >lcl|XP_001915420.1|Plus1complement(13129885..13130808) NW_001877047 olfactory receptor 1019-like LOC100057900 __SEG__ ChrX {Equus caballus} MENSSIVTEFILLGMTDNPQLGILLFVVFLIVYIVTVLENLGLVVLIRVSPCLHTPMYFFLSNLSFLDVCFSSVTIPNTLANLLSKLQAVSFLGCVTQMDLFIIFASAEC
NLLASMAYDRYTAICHPLLYHVKMSRIRCLLLVAGCYLGGLINMVSVTTSITKLSFCQPFVLPHFFCDIPPLLALACSDPWVTQILVVACGGFTLVTSIVVILASYMSVL
MTILGIPSSFGKQKAFSTCASHLIAVGLYYGTTMYTYLQPSRHGSQEGNQMVSVFYTMVFPMFNPLIYSLRNQEVKVALWKILRQSP*
864 >lcl|XP_001915468.1|Plus110955277..10956083 NW_001867368 olfactory receptor 8J3-like LOC100146189 __SEG__ Chr12 {Equus caballus} MPVLEKNSPNDVTTSSFLPQTDEFPNSYVAPGNFTRVTEFILTGVSGCPELQIPLFFVFLVIYGLTVAGNLIIITLTIVDSRLQTSMYFFLRHLAMINFGNSTVIASKRL
INFFVKKKTTFYYECATQLGVFLVFIVAEVFMLAVMAYDCYVAICNPLLYMVVVSQRVCFLLVSLTYLYSFSTAVVASSAVFSMSYCSSNVINHFFCNIVGVIALSCSDT
YFPETSDFISAKFILNFFLFQLMQFIQLFYERLRVPSLDMLSSWVQFD*
865 >lcl|XP_001915475.1|Plus12398772..2399716 NW_001867419 olfactory receptor 10K2-like LOC100146177 __SEG__ Chr5 {Equus caballus} MEQVNETLVREFVFLSFSSLAGLQWLLFIVFLLLYLFTLGTNAIIISTIVLVRALHTPMYFFLAILSCSETCYTFVIVPKMLADLLAQKKTISFLGCAIQMFTFLFLGCS
HSFLLAAMGYDRYVAICNPLRYTVLMGHGMCVGLVAAACACGFIVAQIITSLVFYLPFYSSNQLQHFFCDISPVLKVASHHTHFSQIVIFILCALVLVIPLLLILVSYIH
IISAIHQFPSTLGRHKAFSTCASHLIVVTVHYGCASFIYLRPKSNFSSSQDALISISYTILTPLFNPMIYSLRNKEFKSALRRVVGRTISLPQH*
866 >lcl|XP_001915488.1|Plus1complement(11086120..11087067) NW_001867414 olfactory receptor 6V1-like LOC100055810 __SEG__ Chr4 {Equus caballus} MGNFSVVREFVLLGFSHLRGFQILLFALILLIYVLTVLGNLAIITLTCLNSRLHSPMCFFLCNFSLMEMLVTCTVVPRMLADLLTTRKTMSLAECLTQSFFYFSLGSTNF
LILTVMTFDRYMAICHPLHYPTIMNDPVCMKLVVVCWVVGFLSIISPTVQKTQLWFCGPNVIDHYFCDSAPLLKLSCSDTRHTEHMDFFLSLVFVLATMLLIVVSYILIV
AAVLHIPSSSGRQKAFSTCASHLTVVVLGYGSAIFIYVRPGKGHSTHLNKSVALLTAVVTPFLNPFIFTFRNEKVKEVIEDMTKRILLRDPAAHR*
867 >lcl|XP_001915515.1|Plus1complement(11188933..11189877) NW_001867368 olfactory receptor 1002-like LOC100146502 __SEG__ Chr12 {Equus caballus} MDCGNQTLVIEFFFVGLTNHFQHQVVLFVVFLLIYLISLLGNLGMITLIWMDSRLHTPMYFFLSHLSFVDVCSSSVIGPKMLTDISVEKKVISFCGCAAQLWFFLQFLVT
ECFLLASMAYDRYMAICKPLLYMLIMSQPVCVELVVGPYTMGLLIATTHTTFAFHLPYCGPQIINHFFCNLLPVLSLACADTQVNQFLLFILAGVLGVLSGAIILVSYIY
IVIAILRIHSADGRHKAFSTCSSHLTAVSMLYGTLFFIYVRPSSSFSLDINKVVSVFYTSVIPMLDPLIYSLRNKEVKDSFRRAFERKKFLIGK*
868 >lcl|XP_001915623.1|Plus112083593..12084525 NW_001867414 olfactory receptor 2A2-like LOC100146500 __SEG__ Chr4 {Equus caballus} MGSNQSWVTEFVLMGFELSADVEVLLLWVFSLFYIFNLLANGVILGLICLDPSLHTPMYFFLSHLSIIDMSYASSNVPKMLANFVNQNKNISFVPCIMQTFLYLSFAHTE
CLILMAMSYDRFVAICHPLQYTGIMNWRVCSVLAVTSWSCGFILALVHAILLLRLPFCGPWEVNHFFCEILSVLKLACAETWINQVVILAACVFVLVGPLCSILVSYVFI
VWAILKIQSKEGRTKAFSTCLSHLCVVGLFFGIAMVVYMVPDSNQRKEWEKILTLFHSLFNPMLNPLIYSLRNAQVKGALYRALQKKRPT*
869 >lcl|XP_001915640.1|Plus1complement(11776782..11777723) NW_001867368 olfactory receptor 5AL1-like LOC100054906 __SEG__ Chr12 {Equus caballus} MAKGNHSQVSEFILLGLTDNPELQVILFGVFLGIYLVSVMGNLGLIVLIQISPQLHTPMYFFLSHLAFIDFSFTSSVTPNTLVHFLCDIKSITFYGCAIQVCCFITFVVC
ELYLLAIMAYDRYVAICSPLLYVTLMPRKLCYRIIASTYVYGFAVGLVQTVATFRLSFCGSNMVNHFYCDDVPLVALACSDTHIKELMLLIIAGFNTLCSLLIVMISYVF
ILFAVLRIHSAEGRQKAFSTCASHLTSITVFYGTIIFMYVLPNSSHSLNTDKFASVFYVVVIPMLNLLIYSLRNQEVKNALKRIREKLCLAIK*
870 >lcl|XP_001915696.1|Plus13933436..3934854 NW_001867384 serine/threonine-protein kinase MARK2-like LOC100052625 __SEG__ Chr18 {Equus caballus} MLPGLAATSAGRQPCPRDYQLRRTLGEGSFGIVKLALHVPSGTEVAVKIIQKKEQSAATAKRLLCETQGLARLRHPHILRLVEVMESEETVFIISEYVRGGNLLDHLMEH
GALTEEEARGWFRQLVSALQYCHPRGVIHRDLKPENVLLDPAGSAKLADFGFCSLDPGGPLSTFCGTPGYMAPEVMQLQPYDGPPADVWSLGVLLHAMLAGSLPFWGEDF
DAIQRSTLSGAYSPPRLVSCQCAQLLRGLLTLDPGKRKTLEEVMGDPWVNWGQPRLRPYREPPADMRTAWGTDEMPKAQQPQGGGHARPLTSLPSNKAHSCRALQHCTAW
RRASEPRGRHAGSEPVLPTWLREAGRQRPSEKLQSGPKAAEPGGALPSLDSCPAAPSPAPPRDPGAVPSSDSTHTTRGAQEGSCQGDSRQAGQPHVVTPASPSGRSQGRG
GAARRLFKALRRLCCCLPIRIGSGKRNRVWPR*
871 >lcl|XP_001915768.2|Plus1complement(11378858..11379868) NW_001867393 neuropeptides B/W receptor type 2-like LOC100051823 __SEG__ Chr22 {Equus caballus} MMQAVGPEPLGSRGSPFSAATGASLSGDNGTSHNVTFPEPPPVLYVLLPAVYSVICAVGLTGNTAVIYVILRAPKMKTVTNVFILNLAIADDLFTLVLPVNIAEHLLQRW
PFGELLCKLVLAIDHYNIFSSVYFLAAMSVDRYLVVLATAQSHRMPQRTLRGAKVTSLCIWLAVTIMVLPYFAFAGVHSNELQVTSCGLSFPRPERAWLKASRVYTLVVG
FMVPMCTLCALYADLLRRLRALRLHSGAKALGKAKRKVTVLVLAVLAVGLLCWTPFHLASIVALTTDLPQTSLVIGISYAITSLSYTSSCLNPFLYAFLDNSFRKSFRTT
FRCPGA*
872 >lcl|XP_001915785.2|Plus1complement(5495234..5496292) NW_001867419 relaxin-3 receptor 2-like LOC100063783 __SEG__ Chr5 {Equus caballus} MPTPNTSAPLPAFRGNTSGGSVLSTDDAAMPVEFPALRVVVALAYGLVGAVGLLGNLAVLWVLGNCARRVPSDTFVFNLALADLGMALTLPFWAAESALDLHWPFGGALC
KMVLTATVLNVYASIFLITALSVARYWVVAMATGPGTHLSLFWARMATLAVWMAAALVTVPTAVFGAESEVCGVRLCLMRFPSKYWLGAYQLQRVVLAFMVPLGIITTSY
LLLLAFLRQRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGILVKFDLVPWDSTFYIIHSQVSHVTTCLAHSNICLNPVLYCLLRREPRRALADTFRDLRARLWPQ
GRGWVEQVALNEVGRRWVGSTP*
873 >lcl|XP_001915799.1|Plus1complement(11170220..11171164) NW_001867368 olfactory receptor 1009-like LOC100146388 __SEG__ Chr12 {Equus caballus} MADENYTRITEFIFTGLKYHPRIQVFLFLLFLLFYLITMTGNLGVIILIWYDSRLHTPMYFFLSHLSFVDICFASVVGPKMLTDFFAERKAISFLGCVLQQWFSGFFVAI
ECLLLASMAYDRYVAICNPLLYSAAMSKRLCIQLVVGPYTVGFLNTMTHTTAAFRLPFCRSNIINHFFCDMSPIISLICADIQINKLLVFIVAGAVLVISSLTIIVSYFY
ILTAILRIHSADGRRKAFSTCSSHLTAVSILYGTLFFIYVRPGAIFSLDLNKMVSVFYTAVIPMLNPLIYSLRNKEVKAAMHRTVTRRMLCIRS*
874 >lcl|XP_001915816.1|Plus111858107..11859060 NW_001867414 olfactory receptor-like protein OLF3-like LOC100057175 __SEG__ Chr4 {Equus caballus} MGTDNQTWVREFILLGLSSDWDTQVTLFVLFSITYMVTVLGNFLIVLLIRLDSRLHTPMYFFLTNLSLVDVSYATSIVPQMLVHFLAGHKVISHVSCAAQLFFSLGLGGI
EFVLLEVMAYDRYVAVCDPLRYSVMMHGGLCTRLAITSWVSGSINSLMQSTITFQLPMCTNKFIDHISCEILAVIRLACVDTSSNEVAIMVSSIVLLMTPFCLVLLSYIK
IISTILKIQSTEGRKKAFQTCASHLTVVVLCYGMTIFTYIQPHSSPSVLQEKLISVFYAILMPVLNPMIYSIRNKEVKGAWQKLLGQLSGLTSKLAS*
875 >lcl|XP_001915872.1|Plus112762788..12763726 NW_001867368 olfactory receptor 1052-like LOC100146990 __SEG__ Chr12 {Equus caballus} MAEENLTAVTEFILLGLTDIAELKVMLFVLFLVIYAVTLVGNLGMIFLIQITPKLHTPMYFFLSCLSFVDACYSSVIAPKMLINFLVVSETISFSACIVQHLFLGVFITT
EGFLLSVMAYDRYVAIVNPLLYTAAMSKRKCVGLVIGSFIGGMTNSLTHTISVGRLSFCESNVVSHFFCDVLPLLKLSCSDTSMNELLLLTFSGVIALATFLIVIISYVF
IAIALLRIHSAAGRQKAFSTCVSHLTAVTIFYGTLSFNYIQPNSQYSVEQEKVVSVFYTLVIPMLSPLIYSLRNKEVKDAVRRAIEMKHFPC*
876 >lcl|XP_001915974.1|Plus1complement(13113890..13114849) NW_001867368 olfactory receptor 5D16-like LOC100058346 __SEG__ Chr12 {Equus caballus} MFLAERNLTAGATFTLLGFSDYPKLKIPLFLVFLAIYSFSVVGNLGMIVIIKINPKLQTPMYFFLSHLSFVDFCYSSIIAPKMLVYLLAEDRTISFSGCMVQFFFFCTFV
VTELILFAVMAYDRFVAICHPLLYTVAMSQKLCAMLVFVSYAWGIGCSLLLTCSAIKLSFQGFNRINHFFCELSSLISLSISDSYLSQLFLFIVATFNEVSTLLIILTSY
VFIVVTTLKIRSAGGHRKVFSTCASHLTAITIFHGTILFLDCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKDTVGKITKTNCFHMECMNG*
877 >lcl|XP_001916038.1|Plus140907541..40910417 NW_001867383 SLIT and NTRK-like family, member 5 SLITRK5 __SEG__ Chr17 {Equus caballus} MHTCCPPVTLEQDLHRKMHSWMLQTLAFALTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLESLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKS
PKGTRQPNKPRARPTSRQPSKDLGYSNYGPSIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYIAVVRRSDFLEATGLDLLHL
GNNRISMIQDRAFGDLTNLRRLYLNGNRIERLNPELFYGLQSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQSMPSGVFSGLTLLRLNLRSNHFTSLPVSGVLD
QLKSLIQIDLHDNPWDCTCDVVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQVPERTSAVTPAVRLNSTGAPAGLGAGGGASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYGGGGGSGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKTPIYRSREG
NSVEDYKDLHELKVTYSSNHHLQQQPPPPPPPQPQQQPPPPQLQLQPGEEERRESHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKF
PCSPAAYTFSPNYDLRRPHQYLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF*
878 >lcl|XP_001916079.1|Plus146386..47318 NW_001867370 olfactory receptor 4D9-like LOC100055910 __SEG__ Chr12 {Equus caballus} MELKNYTRVKEFIFLGLTQNQELNLLLFLLLLWVYVTTLLGNLLIMVTVTCDSRLQTPMYFLLRNLSIADICFSSITVPKVLVDILSERKTISFNGCFTQMFFFHLIGGV
DVCSLSVMALDRYVAISKPLHYVTIMSRGRCIGLIVACWVGGFVHSIVQIVLLLPPFCGPNVLDTFYCDVPQVLKLACTDVFMLELLMISNTGLLSALWFMFLLVSYTVI
LMMLRSQAGEGRRKAISTCTSHISVVTLHFVPCIYVYAQPYTALPPNKAISATLSVISPLLNPVIYTLRNQEMKSAMLRLKRRFVPSDKV*
879 >lcl|XP_001916088.1|Plus184000..84935 NW_001867370 olfactory receptor 4D11-like LOC100146963 __SEG__ Chr12 {Equus caballus} MELGNGTRVKEFIFLGLTQSQDLSLVLFLFLCFVYMTTLLGNLLIMVTVTCEPRLHTPMYFLLRNLAILDICFSSITAPKVLADLLSKIKTISYTSCMTQTFFFHLLGGA
DIFSLSVMAFDRYIAISKPLHYVTIMSRGRCTALILASWVGGFVHSIMQISLLLPLPFCGPNVLDSFYCDVPHVLKLPCTDTSALELLMISNNGLVSTLWFIFLLVSYTV
ILMMLRSQAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLMNPLIYTLRNQEMKSAMKRLKRRLMPSVVE*
880 >lcl|XP_001916136.1|Plus118258498..18259448 NW_001867422 olfactory receptor 12-like LOC100067193 __SEG__ Chr6 {Equus caballus} MPPHRDGNVSVVPLQEFVLEGFEGGLETQALLFAVFLALYLGTVLGNLTMVVVITLDARLHSPMYFFLKNLSFLDLCYSSVIAPSALANFFSSSKVINFEGCATQFFFFS
LLVTTEAFLLAVMAYDRFMAICSPLRYPITMCPSACFRLVLGTYCAGCLNSIVQTGFTFSLPFCSSKHIDHFFCDVPRLLRLACTNTALNKLVMFGICGLIIVGTTLVVL
VSYSYITVTIMRMQSGAGRHKVFSTCGSHMMAVSLFYGTVFVMYAQPGAVESMKQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEALGRLRPKHTAT*
881 >lcl|XP_001916159.2|Plus118634630..18635550 NW_001867422 G-protein coupled receptor 35-like LOC100147336 __SEG__ Chr6 {Equus caballus} MNNSNCSSNGLTWPPAVMSIFYTYTGVVLVLGLLLNSLALWVLCCRMQQWTETRVYMANLAVADLCLLCTLPFVLYSLKHSTTKDTPFCQLSQGIYLANRYMSISLIMAI
AVDRYLAVRHPMRVRGLRSPRQAMAVCLALWVLVVGSLVLRWILGMQEGSFCFTSLSKQNYNTAVFSLLGFYPPLVVLVFCSLQVVTALGRRPTADLGQVEASRKAARMV
WANLVVFVVCFLPLHVMLTVYMATSPPTCVIRRALYITSRLSDSNCCLDAICYYYMAKEFQEASALPGLPTAKVHKSQESLCVTLA*
882 >lcl|XP_001916201.1|Plus1complement(12744565..12745524) NW_001867368 olfactory receptor 8K1-like LOC100057269 __SEG__ Chr12 {Equus caballus} MNHMENQNHTAVTKVTEFILMGITDNPGLQAPLLGVFLIIYLVTVMGNLGMVILTHLDSKLHTPMYFFLRHLSITDLGYSTVIGPKMMANFAVHKNTISYTCCAIQLVFF
EIFIITELFILSAMAYDRYVAVCKPLLYVIIMAEKVCWGLVVTPYLYSTFVSLFLTIRLFNSSFCGSNIISYFYCDSLPLISMLCSDTHELELIILIFSGCNLLSSLFIV
LLSYTFIFVAILRMNSTERRYKAFSTCSSHLTVVAVFYGTLLFIYLKPKSSHIFDIDKMASVFYTLLIPMLNPLIYSLRNKDVKDALKRTLTNQCKMFI*
883 >lcl|XP_001916364.1|Plus113419989..13420939 NW_001867424 olfactory receptor 6C68-like LOC100055039 __SEG__ Chr6 {Equus caballus} MRNYTALTAFILQGLTEDPQLQVFLFLFLFITYIFSVTGNLTIITLTLADPHLKTPMYYFLQNFSILEVSFTTFCIPRFLYSMSTGDKTITYSACFIQLFFIDLFGVTEF
FLLATMSYDRYVAICKPLHYMTIMNNKVCKTMIICCWMVALMIILPPLSLDFHLEFCDSNVIDHFACDASPILKISCSDTRLLERVVIACAVLTFISTLVCVILSYLYII
RTILKFPSVQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVNINKGVSLLISSVSPMLNPFIYTLRNKQVKQAFNDSLKKSCVPLETVICT*
884 >lcl|XP_001916375.1|Plus1complement(50644499..50645494) NW_001867383 n-arachidonyl glycine receptor-like LOC100147633 __SEG__ Chr17 {Equus caballus} MTTPHNQVQLGPSNDSHPDEYKIAALVFYSCIFIIGLFVNVTALWVFSCTTKKRTTVTIYMMNVALLDLIFIMSLPFRMFYYAKGEWPFGEYFCQILGALTVFYPSIALW
LIAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTIPLLLLYEDPDKGSTPATCLKISDIIHLKAINMLNFTRLIFFFLIPLFIMIGCYLVIIHSLLHGRTS
KLKPKVKEKSIRIIITLMVQVLVCFMPFHICFAFLMLGGDDNSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSVRRKSFRSGSLRSLSNINSEM
L*
885 >lcl|XP_001916422.1|Plus113717101..13718045 NW_001867424 olfactory receptor 6C6-like LOC100055946 __SEG__ Chr6 {Equus caballus} MKNQSMKTEFILLGLTDDPQLQILIFLFLFLNYSLSLMGNLIIILLTLLDPRLKTPMYFFLRNFSFLEMIFTTVCIPRFLITLVTREKTISYNNCVAQLFFILLLGVTEF
YLLAAMSYDRYVAICKPLHYPVIMSSKVCYQLVLSSWVTGFLIIFPPLLMGLKLDFCASNIIDHFMCETSPILQISCTDTRVLELMSLVLAVVTLVVTLVLVILSYTCIV
KTILKFPSAQQRTKAFSTCTSHVIVVSMTYGSCIFMYVKPSAKERVTVSKGVALLYTSVAPVLNPFVYTLRNQQVKEVFWDMLQKMMCFSKRLL*
886 >lcl|XP_001916727.1|Plus130056865..30058637 NW_001867387 LOW QUALITY PROTEIN: ectoderm-neural cortex protein 2 KLHL25 __SEG__ Chr1 {Equus caballus} MSVSVHETRKSRGSTGSMNITLFHKASHPDCVLAHLNTLRKHRMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VIYEDTAESLLEAGDMLPIPRTWGDAAAEFQEKYPLPLTLPGPDAPVRRPPVPPAL*VLLAHVPGAL*RRCDRARTSTACPRTPCWTSSRVMSWRQRTSGWSSRLSSSG*
SMTLSCARPTCPNCSGVCGWPCCHLTA*RRPSPMRPCSWRTSAPSFS*TRRSTARARSCRTTGWSPAPVPGRARRATRCSSWGARPSCVTRSTRWTTRPRRSSPRRTCPA
PGRSSAPRRLAARSM*LGAGALRMGSPRTCGCTTLSMKSGPRQRRC*SPASATARLSWRTASTWSGDTRPWQVSSQLPLLSP*SRWRSTTPGLTSGRWWPR*EMASAMPR
W*VPS*SSLFLGGPASTGTWCPKSSATTPRRTGGRSRLSVPSLGGTQPPPCWAARSSSWEVTRNSRLPRPTASTARPTSGLGSGT*LPSACPAMPWPRVTSSMWWGATSG
PRGVRPWTAMTPLRTRGTASPPCPTRSSPRPLSAPGSTCLR
887 >lcl|XP_001916753.1|Plus11368268..1369215 NW_001867377 olfactory receptor 2V1-like LOC100066238 __SEG__ Chr14 {Equus caballus} MGILSNRSSIDGFILLGIFSCSQTDLVLFSVVTVVFTVALCGNVLLIFLVCTDPQLRTPMYFFLKQLSLMDLMLVCTIVPKMAVNFLSGRKYISFVGCGIQIGFFVSLVG
SEGLLLGLMAYDRYVAISHPLHYPILMSQRVCLQIAGSSWAFGILDGMIQMVAAMSLPYCGSRNVDHFFCEVSALLKLACADTSLFDTLLFACCVLMLFLPFSIVVVSYA
RLLGVVFQMRSAQARKKALATCSSHLMAVSLFYGAAMFIYLRPRRYRTPSHDKMVSIFYTVLTPMLNPLIYSLRNRDVMGALRKRLENCKFGSQP*
888 >lcl|XP_001916905.1|Plus1complement(3962771..3963709) NW_001867427 olfactory receptor 7G1-like LOC100063450 __SEG__ Chr7 {Equus caballus} MEPRNQTDVLEFFLMEVTEDPEMQSLIFILFLFMYLVTILGNLLILLAIISDSNLHTPMYFFLSNLSFADICLSTTTIPKILLNIQTQNQSITYIGCLTQACFVLSFANL
ENFLLVVMAYDRYIAICHPLSYMVIMNPHLCGLLILLCLFISILNALLHSLMVLRLSFCTDMEIPLFFCEISQVIKLACSDTLINSILLYFAAGIFGAVPPFGIIFSYTL
ISSSILRMASSGGKYRAFSTCGSHLSVVSLFYGTGVGVYISSAFTHSSRNMAVASVMYTVVTPMLNPFIYSLRNRDMKGALRKISGSVPSFQ*
889 >lcl|XP_001916926.1|Plus133804161..33805171 NW_001877040 probable G-protein coupled receptor 82-like LOC100146443 __SEG__ ChrX {Equus caballus} MSNNTTCIHPSMISSMALPIIYTFLCIIGLFGNSLSQWVFLTKIGKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYRSAQCRVVNFLGTLSMHVSMFVSLLIL
SWIAISRYATLMKKDSMQETSSCYEKVFYGQLLKKFRQPNFARKLCVYIWGVVLGLIIPVIIYYSAVEATEGEETLCYNRQMELGAVISQIAGLIGTTFIGFSFLVVLTS
YYSFVSHLRKIRTCTSITEKDLTYSSVKRHLLVIQSLLIVCFLPYSIFKPIFYVLHQREDCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKTLYNLFTKSDSP
HTQSDG*
890 >lcl|XP_001916964.1|Plus128399926..28400855 NW_001867389 olfactory receptor 7C2-like LOC100147487 __SEG__ Chr20 {Equus caballus} MNCSKNPDFILSGLSRDPEKQQFLFGLFLALYLLSLLGNLLFLLAIFADIHLHTPMYFFLSQLSLVDICLTSTTVPKILEDLWTSNRFISFTGCLAQLYFFVVFANMDNL
LLTAMAIDRYAAICRPLHYPLLMTPCRCGLLVGGSWGVAYSDSLIQTLLLTRLSFYTNQEIPHFFCDFYPLLRLSCSDTHLNEDLMMVLTALLGISPLLCIVSSYAHIFH
AVARVPSTQGKKKALATCSSHLSMVILFYSTVFATYLKPTSTSRSSGELVSAVMYTLVTPTLNPFIYSLRNKDVKSSLKRVLGMESSWD*
891 >lcl|XP_001916986.1|Plus126719564..26720556 NW_001867396 olfactory receptor 1J4-like LOC100147676 __SEG__ Chr25 {Equus caballus} MRLENQSTTTEFLLLGLPNPPEQQDMFFALFLGMFLTTVLGNLLIILLIMLDARLHTPMYFFLCHLAFSDISLSSVTVPKMLINMQTQQQSISYVGCISQLYFFIVFGCL
DNLLLGVMAYDRYVAICQPLHYTTVMRQELCVSLVAGSWFLSCAHALLHILLLVQLSFCADNTIPHFFCDFTALLKMSCSDIFLNELLIFTEGGMLVILPLTSILASYVS
IGTTVLRVPSTKRLFKVFSTCGSHLFVVCLYYGTLVGVNFFSSSWGSNDKEIIASVMYAVFTPMLNPFIYSLRNRDINQALGIFVNRANFLKQQSLNPFIAVVSRVRCAS
*
892 >lcl|XP_001917204.1|Plus1complement(36554762..36555709) NW_001867410 olfactory receptor 7A10-like LOC100146535 __SEG__ Chr3 {Equus caballus} MEPGNNTQISGFLLLGFSEKPELQLLIFGLFLTMYLITVCGNLLIILAVSSDSLLHTPMYFFLCNLSFVDICFTSTTIPKMLWNIQTQSKVITYEGCITQIYFLILFAVL
DIFLLTVMAYDRFVAICHPLHYTVIMNHRLCGLMILVSWIMCILNSLLQSLTALRLSFCANLEIPHFFCELNQMVQLACSDTFLNNVVMYFAAILLGGGPFAGILYSYSK
IVSCIRGISSAQGKYKAFSTCVSHLSVVSLFYCTVLGVYLSSAATHSSHSSAIASVMYTVVTPMLNPFIYSLRNKDIKKALKSFFVKETTKLSQH*
893 >lcl|XP_001917256.1|Plus114058438..14059373 NW_001867424 olfactory receptor 6C76-like LOC100056905 __SEG__ Chr6 {Equus caballus} MKNQTFVKEFILLGLTDDPELNVLIFLFLFVTYILSVTGNLTIITLTLIESHLKTPMYFFLRNFSFLEISFTTVTIPRFLVSIVTGDMTISYNSCMAQVFFFIFLGSTEF
FLLAAMSYDRYVAICKPLHYTTIMNSRVCKELVICSWLAGFLIIFPPVIMGLQLDFCDSNIIDHFTCDSSPMLLISCTDTAFLELTGFFMAVFTLMVTLMLVILSYVFIL
KTVLRIPSAEQRKKAFSTRSSHVIVVSISYGSCIFMYVKTSAKEGVALTKGIAVLNTSVAPVLNPFIYSLRNQQVKQSFKNLVKKCFSNKL*
894 >lcl|XP_001917265.1|Plus1complement(10685601..10686596) NW_001867370 mas-related G-protein coupled receptor member X1-like LOC100061396 __SEG__ Chr12 {Equus caballus} MAHEPRNDPTGVSPRPQPWPSHPNNGSELPTAANATAHSTSVDGAHAFSTYQNTLFLATVLVSLCGLVGNGTVIWLLGFRIKRNPFSVYILNLAGADFAFLFCKSIRFLL
FVLNRSVAVLNLLIRGVTFSSYLGGLSLLMAVSVERCLSVLFPIWYRCRRPAQLSAIACALIWGLSLCPGISVLLCVHFVAFSCDVVNLVYYGMFLLTFLVLCVSSLVLL
IRVQCFSMRRQPARLSRIVLLTVLAFLVLGLPLGAGLLADRLSPSLPYFDILLPILHLLSALNSGVNPLIYFFMGRQRQQRGRKPLREVLQSALTEDVELSTEELPSPDD
T*
895 >lcl|XP_001917361.1|Plus126292588..26293532 NW_001867389 olfactory receptor 2G6-like LOC100062731 __SEG__ Chr20 {Equus caballus} MERANDSTFSGFILLGFSNRPHLEAALFVVMLIIYILSILGNGMIILLSVVDPHLHTRMYFFLSNLSFIDLCLTTSTVPQTLANFKGKDKTITYGGCVTQLFISLGLGGV
ECVLLSFMAYDRYVAVCRPLHYMVIMHPQLCLQLIVTAWFTGFGNSVVQTALAMTLPLCSKNQVDHLLCEVPVIVKLACTNTSINEAEIFAVSIFFLVVPLLFILVSYGH
ITLAVLKIKSAQGRRKVFGTCGSHLMVVIIFFGTLMSMYLQPPSSYSQDVNKSIALFCILVTPLLNPLIYTLRNKDVKGALRSLVRGIIDSRER*
896 >lcl|XP_001917561.1|Plus127836337..27837308 NW_001867389 olfactory receptor 2Y1-like LOC100146689 __SEG__ Chr20 {Equus caballus} MRRFNNTFHHFNGFVLVGFSEWPRLEMVLFVVICIFYILTLFGNSTIIILSHLDPRLHTPMYFFLANLSFLDLCYTTSTVPQMLVNIQSHKRNISYIGCVAQLFIFLGLG
STECVLLSVMAFDRYVAICQPLQYTVIMHSWLCQQLAAVAWVTGFSNSLVQTVLTFLLPRCGQYRVENFFCEVPAMLQLSCVDTRINEVEMYAAVVVIKVIPVGLILFSY
INIVRAVVRIQSSEGRKKAFNTCGSHLLVVIMFYGSAISGYAYMAPKSNSAKLKGKLLALFYGLLTPMLNPLIYTLRNKDVKGAVKKLLGREQEQGGTCLRRM*
897 >lcl|XP_001917625.1|Plus128357798..28358724 NW_001867389 olfactory receptor 14J1-like LOC100147577 __SEG__ Chr20 {Equus caballus} MANFTTLKGFLLMGFSAKPEIEIVCASVFLVLYLVALTGNILIITATSIDDSLHSPLYFFLKHLSFLDLCYISVTVPRYICNSFMHNGNISLWECILQCFAFTLCGSSEM
AMLTVMSYDRYVAICLPLHYEIIMNVSTCIHGILAVWISGVISGVMHTAATFSIHFCGANIIHQFFCDVPQLLKFSCSNEYVGELGVIVFLSLVAFLCFICIGLSYMHIF
STVLQIPSAEGRAKAFSTCLPHLSVVMLFLSTGVFDFLKPQSDSPTALDFLLTGFYTVLPPALNPMIYSLRNKAMKTALRKVFKRRKV*
898 >lcl|XP_001917650.1|Plus123968635..23969579 NW_001867427 olfactory receptor 52B4-like LOC100053225 __SEG__ Chr7 {Equus caballus} MTTLNHTGVSHTVFHLLGIPGLEDQHMWISIPFFISYVVALLGNSLLIFIILTKSSLHEPMYLFLCMLAGADVILSACTVPQALAIFWFHAGEISLDRCITQFFVTHCIF
MSESGILLVMAFDRYIAICYPLRYSTILTHALIGKIGVAIFLRSYCTIFPIIFLSKRLTFCQNNVIPHTFCEHISLAKYACNDIQVNIWYGLFVIVSTVVLDVLLIFVSY
VLILHAVFRMPSQDARHKAVNTCGSHVCVIILFYGPGIFTTLTQRFGCHIPPHIHILLANVCIVAPPMLNPIIYGVKTKQIREQVAHMLFPKQK*
899 >lcl|XP_001917656.1|Plus1complement(24928876..24929835) NW_001867427 olfactory receptor 51L1-like LOC100146503 __SEG__ Chr7 {Equus caballus} MATLNSSNSLSSTFYLTGIPGYEEFHHWISIPFCLLYLVGIMCNCTILHIVRTDPRLHEPMYYFLAMLSLTDMGMSMPTMMSLFRVLWSISREIQFNICVVQMFFIHTFS
FTESSVLLAMALDRYVAICHPLQYATILTPRLITKIGIAALLRSGFAMIPLLSRLPFFPFCRSHKLSHSYCLHQDMIRLACADTKFNVIYGLVLITVLWGMDSLGIFVSY
VFILNSVLRISSRAGRFKALNTCASHICAVLILYVPMIGLSIVHRFAKHSSPLIHIFMAHIYLLVPPVLNPIIYSVKTKQIREGILHLLLPPKIRSTVL*
900 >lcl|XP_001917662.1|Plus1complement(24958102..24959085) NW_001867427 olfactory receptor 52D1-like LOC100147186 __SEG__ Chr7 {Equus caballus} MKRKQKHLMLTMSAYKKTDVHPSTFILIGIPGLEAAHIWISIPFCMVYILALLGNCSLLFIIKTDSSLQEPMYLFLCMLAVADLIVCTTAVPKLLSLFWFHDREIPFEAC
LTQVFLIHSFSTMESGFFLAMAFDRYVAICNPLRHSAILTHSSTGGMGLAIVFRGTALLSPHPFLLRWLPYCRTNIISHTYCEFMALIKIACAETRIRKAYSLIVAFLTG
GVDFILIICSYVLILHTVFHLPSKDARLKTLGTCGSHVCVILVSYTPAFFSFLTHRFGHHAAPHVHIFVANIYLLVRPMVNPIIYGVRTKKIWDRFPKFFIFSKSLK*
901 >lcl|XP_001917691.1|Plus1complement(25207547..25208491) NW_001867427 olfactory receptor 52K1-like LOC100068248 __SEG__ Chr7 {Equus caballus} MSSCNNSISQPLIFVLAGIPGLESSHGWFSIPFFLVFVITVLGNTTILCIIQVEKSLHEPMFLLLAMLSVVDLSLVSVIVPRMLGIFWMKAKEISFNACLTQMFFIPSFY
VMESGILLAMAFDRFVAIWYPLRYTTILAKNMLVKMALAVMARAVAVLTPVPILAKRLESFQTHIIAYSYCAYMAVVQIACGDISDHIVYGLMVIVASVGFDLFFIILSY
GLILHAVFQMPSWEARGKALSTCGSHLCVIALFYSPVVFSVLAQILGYHMAPYLQIIIDNLYFLLPPMVNPLIYGARTKQMREWVLRILHCHGN*
902 >lcl|XP_001917708.1|Plus125371914..25372864 NW_001867427 olfactory receptor 51V1-like LOC100146185 __SEG__ Chr7 {Equus caballus} MLMSASSASIINSSIFILTGFPGLDQYHPWFSIPFSSIYAMVFLGNCMVLHVIRTESSLHQPMFYFLALLALTDLCMGLSTVHTVLGILWGLNQEVNLDACIAQSYFIHG
LSCTESGVLLAMAFDRFIAICNPLRYTSILTNNRVIHFMVTILMRSALSILPVIIRLKFFPYCRPHILSHSFCLHQDLLRLACSDIRFNSLYALALVICTLLLDAVLILI
SYIFILHTVLAIASREERLKSLQTCVSHICAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNIYILFPPLMNPIIYSVKTQQIRSRMKKWFSLKMG*
903 >lcl|XP_001917796.1|Plus1complement(35571577..35574159) NW_001867377 protocadherin gamma-A10 PCDHGA10 __SEG__ Chr14 {Equus caballus} MAAQRNRSDRSALVLLCLFLGMPREVEARQIRYSVPEELEKGSFVGNISKDLGLEPRELAERGVRIVSRGRTQLFALNSRSGSLVTAGRIDREELCAQSSRCLVNFNILV
EDRVKLFGIEVEVTDINDNAPKFQAENLDVKINENVAPGMRFPLPEAVDPDVGVNSLQSYQLSPNKHFTLAIQSRANGVKYPELVLERALDREEEALHHLVLTASDGGDP
LRSGTVLIIVTVFDTNDNAPVFTLPEYRVSVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKNTGEIKISENLDYEETGFYEIEIQAEDGGAYLAT
AKVLITVEDVNDNSPEVTITSLFSPLMEDSPLGTVIALLNVHDLDSGQNGQVTCSISGNLPFKLEKSIDSYYRLVTYRALDREQVSSYNITVTATDGGSPPLSTGIHFTL
QVADINDNPPTFSDISYFTYIPENNPRGASVFSVTALDPDSKENARVIYSLAEDTIQGAPLSSYISINSETGVLYALQSFDYEQFRDLQMQVTATDSGDPPLSSNVSLSL
FILDQNDNAPEILYPSLPTDGSTGIELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALLDRDALKQSLVVSVQDHGQPPLSATVTL
TVAVADSIPDILADLGSLEVRHDSDASELTLYLVVAIAAVSCVFLAFVIVLLALRLRRWHRSRLLQASGGGLVGVPASHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIF
PQPNYADTLLSQESCEKKDPLSLLDDSKFPIEDTPLVPVSSIFTLLLSFKKLSLVLLLGFQHDDGKFLYFFHFSLFQRPLLLAKTFKSRT*
904 >lcl|XP_001917799.2|Plus1complement(35576332..35578836) NW_001867377 LOW QUALITY PROTEIN: protocadherin gamma-B6 PCDHGB6 __SEG__ Chr14 {Equus caballus} MGGSCARRRPAGPRQVLFPFLLPLFYPALSEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLLFSVDAESGELLVKDRIDREQMCKERRRCELQLEAVV
ENPLNIFHIVVVVEDINDHAPQFDKKEIHLEIFESASLGARLSLDPATDPDINMNSIKDYQINSNPYFSLMVRVNSDGGKYPELSLEKPLDREEKRFHHLILTALDGGDP
PRSATAQIEIFVKDTNDNSPVFSKDEYRISVSENLLPGSSVLQVTATDQDEGVNAEINYYFRSTAQSTRHMFSLDEKTGMIKNNQSLDFEDIERYTMEVEAKDGGGLSTQ
CKVIIEILDENDNSPEIIITSLSDEILEDSLPGMVVAIFKTRDRDFGENGEVKCNVGRGVPFKISSSNNNYYKLVTDGFLDREQTPEYNITITATDRGKPPLSSSTTITL
HIADINDNAPIFHQANYVVHVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALSSYVSVSAQSGVVVRAARLRPRAAARLQADAEGPQTGLVRASSPTRACS
CWWG*PKRQRAKGAGNPAPGARTFSALFRLGAGWPGSPATWSPRWWRWTPTRDTTPGCPTTCCRPASPDSSAWGCARARCARRVLWATGTRPASACWSPCGTGDSRPSRP
PPRCSWSSQTAYKRHCRTSATILHPLSPRLSCSFTWWWPWP*SPCSSCSR*FWPLPCACDAPPAPPPGAAFSLVSVSSLDLWFPPTTAKGLYLIPTICALPILERQSLIS
*NAVSP*IPLKT*FAVILQGP*FHFRVGML*LHILRLYHR*VSFFVSSVILY*FLIFQAYFIFIF
905 >lcl|XP_001917801.1|Plus1complement(35581017..35583509) NW_001867377 protocadherin gamma-A9 PCDHGA9 __SEG__ Chr14 {Equus caballus} MAAPRNRPHHTGLVLLCLFLGRLWEIRASQIHYSVPEETEKGYIVGNISKELGLEPRELAERGVRIVSRGRTQLFALNPRSGSLVTAGRIDREELCAQSTRCLVNFKVLV
EDRVQLYGIEIEVTDINDNAPKFQTENLEVKINEIAAPGTRYPLPEAVDRDVGLNSLQSYQLSPSHHFSLDVQTGDDGTINPELVLERALDREEEAAHHLVLTASDSGDP
RRSSTVHIQVTVLDTNDNAPVFAQPIYRVKVPEDVPQGTRLLTVRASDPDEGANGRVAYTFWKISEKQSPLFELNENTGEISTAKNLDYEECAFYEMEIQAEDGGGLKGR
TKVLISLEDVNDNRPEVIMTSLFSPVREDAPPGTVILLFNAHDRDSGKNGQVVCSIQESLPFQLEKSIEDYYRLLTAQILDREKNSEYNITVTATDRGTPPLSSEIHVTL
HVVDINDNPPSFSQTSYSVYLPENNLRGTAIFSVTARDPDSNENARIIYSLAEDTIHGALLSSYVSINSDTGELYALRSFDYEQFRNLQMQVRASDSGDPPLSSNVSLSL
FVLDQNDNTPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALLDRDALKQSLVVSVQDHGQPPLSATVTL
TIAVADSIPDVLADLGSFEPSANPDDSDLTLYLVVAVAAVSCIFLAFVIVLLALRLRRWRTSSQFQAERIGLAGMPASHFVGVDGVRAFLQTYSGEISLTADSRKSHVIF
PHPNYADTLVSQESCEKNEALCVSDDSKFPIEDTPLVPVSSVFPLLSITIGFLFECLHLR*
906 >lcl|XP_001917802.1|Plus1complement(35585623..35588043) NW_001867377 LOW QUALITY PROTEIN: protocadherin gamma-B5 PCDHGB5 __SEG__ Chr14 {Equus caballus} MGSGAGENGWAERRPVLFPFLLSLFWPALSEQIRYRIREEMPGGSVVGNLAKDLGLSVLELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREQICGKNPACALEFEAVA
ENPLNFYHVNVEIEDINDHMPKFTQNSFDLQISESTLPGTRFILEVAEDADIGLNSLRNYKLSLSPSFSLINKEKQDGSKYPELTLEKPLDREQQGYHRLVLTALDGGDP
PLSGTTELRIQVTDANDNPPVFHQDVYRVSLRENVPPGTAVLQVSATDQDEGVNSQITYSFYRTGQVFHLNSKSGEITTLRTLDFEEIKKYSIVVEGRDGGGLVAQCTVE
INIQDENDNSPEVTFHTLVENILENAVPGTLIALIKIHDQDSGENGEVNCRLEGEVPFQIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSASISVTLHITD
VNDNAPVFHQASYVVHVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALSSYVSVSAQSGVVFAQRSFDHEQLRAFELTLQARDQGSPALSAKREPARAGGR
PQRQRARVLYPALGARRLGALRHGAARRAARLPGHQGGGGGRRLGTQRLAVLPRAAGQRARTLQPGAAHGRGAHGACFGRQGRGPPAPAGRRAGRGTAAPLGHRHAAPGL
RRQPTRGAAGPRRPSCTL*APG*AAVLPGGGLGLDLRALPARSDSGHCPAPATLLQPRRLGLLSAWSLCQVWTWGSPQLQRRDFTLFLQFVRCPYWKERV*FSKM**TIE
FRTGHALW*FVWAVISGL*FQ*VDFPSRNSNSGEFHL
907 >lcl|XP_001917815.1|Plus1complement(35632416..35634854) NW_001867377 protocadherin gamma-B1-like LOC100146948 __SEG__ Chr14 {Equus caballus} MQRSSRKAETMKNQVLFLFLLSLLGRAISQQIQYAVPEELAKGSRVGNLAKDLRLSVQELPARKLRISAEDFFSVSAESGDLLVSGRIDREKICGRKSECALEFEMVAEN
PMNVFHLIVAIQDINDNAPHFIAKAIDLEICESALPGVKFPLDSAQDADVESNSLKIYTINPNEHFSLSTKESPDGTKYPELLLEKPLDREQQSSHRLILTAMDGGDPPL
SGTTQIRIQVTDANDNAPLFSQESYRVSLQENVPPGTSVLRVMATDQDEGVNAEVTYAFLNAPTSTSLLFNLNPNTGDITTNGTLDFEETSRYILGVEAKDGGVHTAHCN
VQIDIVDQNDNAPEVTFMSYSNHIPEDSDLGSVIALIKVQDQDSGQNGLVMCYIQEEVPFKLESTSKNYYKLVIDSALDREQMAEYNVTITATDKGKPPLSSSTSVTLHI
GDVNDNAPVFHQASYVVYVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALSSYVSVSAQSGVVFAQRSFDHEQLRAFELTLQARDQGSPALSANASLRVLV
GDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLLL
VFADSLQEALPDLGDHPAPSEPQAELQFYLVVALALISVLFLLAVILAIALRLRRSSSPAAWGCFQPGLCSKSGPMVPTNYNEGTLPYSYSLCVASHSAKTKFNFPNLTP
EMAPPRDLLCEDPSMDVCASGEDPQIANDFSFSSHVSFWKAP*
908 >lcl|XP_001917818.1|Plus1complement(35642584..35645046) NW_001867377 protocadherin gamma-A2-like LOC100072262 __SEG__ Chr14 {Equus caballus} MAALQKLPHRGKLVLLFILLAALWEAGAGQMRYSVPEEMEKGSFVGNIAKDLGLEPVALAGRGVRIVSRGRTQLFALNSRSGSLITAGRVDREELCAQSMRCLVNFNILL
EDKLNIYSVEVEIRDINDNAPRFGVEELELKISEMTTPGFRIPLKSAHDADIGENTLQKYELNPNDHFSLDVRSGVDGNKYPELVLERALDREEEAVHHLVLLAFDGGDP
IRSGTSRIRVVVQDVNDKAPVFTQSEYRVSVLENIPLGTRILTVTATDADEGYNAQVAYFQEKTPGESSEVFELKSTSGDITIIKSLDYEEAKFHEIDIEAQDGPGLLTR
TKVIVTVLDVNDNAPEFYMTSATSSVPEDSPPGTVIALFNVHDRDSGQNAFITCSLSENLPFKLERSVDNYHRLVTTSALDREQFSSYNITVTAKDGGNPSLSTDAHVLV
QVADINDNPPTFPHMSYSAYIPENNPRGTSIISMKAHDPDSDDSAHVTYSLTQDTLQGAPLSSYISINSDTGVLYALHSFDYEQFRHLQLWVTARDSGKPPLSSNVSLSL
FVLDQNDNTPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDQDSGQNAWLSYRLLKASEPGLFTVGLHTGELRTARALLDRDALKQSLVVSVQDHGQPPLSATVTL
TVAVADSIPDVLADLGSLNPSANPGDSDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHMSRLLQASGGRLAGVPTSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIF
PQPNYADTLLSQESCEKKDFLSAPQSLLEDKGEETFSQVNSLHNIFISYC*
909 >lcl|XP_001917888.1|Plus1complement(27753535..27754482) NW_001867427 olfactory receptor 2D2-like LOC100147393 __SEG__ Chr7 {Equus caballus} MTQTNETQVTEFLLLGLSDDPHTQQLLFILFLGVYLVTVLGNLLLMSLVQVDSQLHTPMYFFLFNLSLADLCFSTNIIPQTLAHLLSRKKLISFTRCAAQLLLFLIFGCT
QCALLAVMSYDRYVAICNPLHYPSIMTWRVCARLAAGSWTSGIVVSVVDTTFILRLPYRGSNSIAHFFCEAPALLILASTDTRTSEMVIFLMGVMILLIPVSLILISYGR
IIETVVRMKAAEGRLKAFSTCGAHLMVVILFYGSGIVTYMTPKSSKEQEKLVSVFYAMVTPMLNPLIYSLRNKDVKGSLRKAATRNFPRRLGIFR*
910 >lcl|XP_001917901.1|Plus1complement(28031907..28032851) NW_001867427 olfactory receptor 2AG1-like LOC100070346 __SEG__ Chr7 {Equus caballus} MELWNSTLGSDFILVGILNDSRSPELLCVTLSALYILALTSNGLLLPVTAMDAWLQVPVYLLLSQLSFMDLAFASVVTPKTLVDHLLGENAISFGDCAFQMLVDLTLGGA
EDLLLAFMAYDRYVAIYHPLNCMVLMRPKICWLIMATSWILAVLNAVIHTSYTMHFPFCMSQETKHLLCENSPLLKLACVDTSRCELMVYMTGVTFLIPTFTAILASYTF
VPVATLHMSSGEGRQKALIMVSSHLTVVGMYYGTAMFMYIQPSLYHGPQQDNILSLFYTIITPVLNPLIYSLRNKEVMEAFRRVLGRLTSVQRL*
911 >lcl|XP_001917935.1|Plus145040097..45041149 NW_001867381 c-C chemokine receptor type 11-like LOC100146120 __SEG__ Chr16 {Equus caballus} MALEHNQSTDYYYEENEMNNTHDYSQYEVICIKEEVRKFAKVFLPAFFSVAFIIGLAGNSTVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKI
MCKVTSALYTVNFVSGMQFLACISIDRYWAVTKAPSPSGVGKPCRLICFCVWMAAILLSIPQLVFYTVNHKARCIPIFPYHLGTSMKASIQMLEICIGFVIPFLIMGVCY
FLTARTLIKTPNIKKSRPLKVLLTVVIVFIVTQLPYNIVKFCQAIDIIYSLITDCDMSKRMDVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQN
VEEIPFDSEDPTEPTSTFSI*
912 >lcl|XP_001917948.1|Plus156818155..56819084 NW_001867385 olfactory receptor 186-like LOC100072533 __SEG__ Chr19 {Equus caballus} METKNATWLTEFVLTGLSYQLEWQIPLFLVFLVIHLITIVGNLGLIALICNDPHLHTPMYLFLGSLAFMDAWISSTVTPKMLVNFFATNQMISLSECMLQFFSFAFSATT
ECFLLAAMAYDRYVAICKPLLYPVIMTNRLCIRLLVALFLCGLIHSAFHLLFLLRLTFCNSNIIHHFYCDIMPLFKISCTDPSINVLMAFVSSGSIQVFTIMTVLVSYTL
VLFTILKRKSVQGIRKAFSTCGAHLFSVSLYYGPLLFMYVRPGSAQADDQDMMDSLFYTVIIPLLNPIIYSLRNKKVIDSVAKLLKRSV*
913 >lcl|XP_001918025.2|Plus1complement(35520621..35523209) NW_001867377 LOW QUALITY PROTEIN: protocadherin gamma-C3 PCDHGC3 __SEG__ Chr14 {Equus caballus} MVPEAWRSGLVSSGRVVGVLLLLGALHKASAVIRYEILEEREKGFAVGNVVTDLGLDLGSLSTRRLRVVSGASRRFFEVNRETGEMFVNDRLDREELCGTLPSCTVTLEL
VVESPLELFSAEVVIQDINDNNPAFPTREMKLEISEAVVPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGG
TPARSASLPILIAVLDANDNAPAFNQSLYRARVLEDAPPGTRVVQVRATDLDEGLNGEIVYSFGSHNRAGVRELFSLDLVTGVLTIKGRLDFEDTKLHEIYIQAKDKGAN
PEGAHCKVLVEVLDVNDNAPEITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSAALDRETVPEYNLSITARDSGAPSLSAL
TTLRVQVSDINDNPPQSSQSSYDVYVEENNLPGVPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDSGVVSSLVPLDYEDQREFELTAHISDGGTPVLTTN
ISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTAAGHVVTRVVGWDPDAGHNAWLSYSLLGAPNQSLFAVGLHTGQVSTARPVQDTDSPRQTLTVLIMDNGEPSLSTTA
TLTVSVTEESPEARAEFPSGSAPREQNKNLTFYLLLSLILVSVGFAVTVLGVIIFKVYKWKQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMPPHLYHQVYLTTDSRRSD
PLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESSPPGQVRVSKSSHNDSNAF*FLHHVVEGMRCFLVMKIFT*LCIYIFTWPFLEQTLYLC
914 >lcl|XP_001918050.1|Plus126700681..26701646 NW_001867427 olfactory receptor 52N4-like LOC100069649 __SEG__ Chr7 {Equus caballus} MIMLNQTHVTPASFILNGIPGLEDMHMWISFPFCSMYVLAMVGNCGLLYLIHYEDSLHRSMYYFLAMLSLTDLVMCSSTIPKALCIFWFHLKEISFEECLVQMFFIHTFT
GMESGVLMLMALDRYIAICYPLRYSTILTNPVIAKAGLATFLRALLLIIPLIFITKRLPYCRGNIIHHTYCDQLSVAKLSCGNIKANVIYGLMAALLIGGFDILCITVSY
TMILRAVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFCFFFNRFGSHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDCVIRILSGSKHIKSHSI*
915 >lcl|XP_001918052.1|Plus1complement(35637455..35639947) NW_001867377 protocadherin gamma-A3 PCDHGA3 __SEG__ Chr14 {Equus caballus} MTNYLRFRTGGGLALLCALLGTLCKTGSGQIRYSVPEELDKGSFVGNIAKDLGLEPWELAERGVRIVSRGRTQLFALNQRSGSLITAGRVDREELCAQSTQCLVKFNILV
EDKLKIFDVEIEIKDINDNAPDFVTEELEIKIGELTAPGTRFPLKTAFDPDVGVNSLQNYELSTNDYFSLAVNSLSDGAKYPELVLERALDREEKKVHQLILIASDGGDP
AHSGSLCIQVVVLDANDNPPVFTQPEYRVSVQENLPVGTWLLTVNATDPDEGFNSQVSYILDKMPGKIAQIFHLNSVTGDISILKSLDYEDAMFYEIKIEAQDGPGLLSR
AKILVTVLDMNDNAPEVTITSLIRSVPEEATAGREIALINVHDRDSGQNGQVTVFILGNMPFNLEKSIDQYYRLVTARSLDREKVSEYNITLRATDGGSPPLSTDTHITL
YVADINDNPPTFTHDSYLAYIPENNPRGAVIFSVTAQDPDSIENAHITYALIEDTIQGAPLSTYVSINSDTGVLYALCSFDFEQVRDLRLLVTASDSGNPQLSSNVSMSL
FVLDQNDNMPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFTVGLHTGEVRTARALLDRDALKQNLVVAVQDHGQPPLSATITL
TVAVADSIPDVLADLDSFSPSANPEDSDLTLYLVVAVAVVSCVFLAFVIILLALRLRHWHRSRLLQASRGVLPGMPVSHFVGMDGVQAFLQTYSHKVSLTSDSRETHLIF
PQPNYADTLISQESCEKSEPLLVSEDLLETTGDPKLLQVSLLLSLNIIKKNYSSMVIIKL*
916 >lcl|XP_001918068.1|Plus1complement(35717714..35720101) NW_001867377 protocadherin beta-18-like LOC100072297 __SEG__ Chr14 {Equus caballus} MEPGGGSRQQIRQVLLFFVFLGEYLVCSETWRYSVAEETEIGSFIANLVKDTGLRVDDLAVRGARVIFDDYKPYLWLDQQTGNLLLNEQLDREALCDLTEPCILHFQVLF
ENPLQFFQAELWVKDINDHTPTFLEKHILLKISEGTAPGASFHIDSAQDLDVGKNGVQNYTLSPNPHFHLKLQDNDGGRKYPELLLDQSLDREKESEFRLTLTALDGGSP
PRSGTALVRVLVLDINDNAPEFERPIYEVQVPENSPLDSLVVQVSATDLDAGINGEISYSFSHNSRDIWKTFEIHPISGEVHLKALLDFELTQSYTINIQAIDGGSLLGK
STILVRVVDVNDNPPEIVMTSLTSPIPENSSPEMVVAVFSVRDQDSGDNGRMICSIQDNLPFVLKPTFKNFYTLVTERPLDRESRAEYNITITITDMGTPRLKTEHNITV
LVSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRV
LVLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLH
VLLVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGGCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRAGSGTSEFKFLKS
LACDHQGSVNDVEENSNFVNGFGFN*
917 >lcl|XP_001918074.1|Plus1complement(35737120..35739516) NW_001867377 protocadherin beta-11-like LOC100061584 __SEG__ Chr14 {Equus caballus} MENGGTSTLRIRQVLLLFVLLGISQARSQSGRFSVAEEMQSGSFVGNLAKELGLEMGELFSRGARVVANDDKQRLQLDVNTGDLLLSEVLDREELCGSTEPCVLHFQVLM
KNPVQFLQIELQVRDINDHSPVFLEKEMLLEIPENSPVGAVFLLESAKDLDVGINALKNYTISPNSHFHVKMRVNPDDRKYPELVLDKALDYEEQSELSFILTALDGGSP
PRSGTASVRVVVVDINDNSPEFQQPFYEVKIPENSMLGSVVVTVSAWDLDSEKNGEISYTFSHASEEIRKTFEINQKSGEISLMAPLDFETIDSYSVIIQATDGGGLFGK
STVRIQVIDVNDNAPEIAVSSITSPIPENLPETVVMVFSIRDRDSGDNGRMICSIPEDLPFTLKSSVENYYTLETESPLDRESKAEYDITITVTDMGSPRLKTQHTITVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDRDAGANAQLTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFGVGATDRGSPALSSQARVRVL
VLDANDNSPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWPHNGEVRTARLLSERDAPKHRLLVQVRDNGEPPRSASVTLHV
LLVDGFSQPYLPLPEAAAEQARADPLTVYLVVALASVSSLFLLSVLLFVAVRLCRRSRAASLGGCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLRGDTRTNEFKFLKPV
IPNLPPQCPGKEIEENPTFHNTFGFNIQ*
918 >lcl|XP_001918078.1|Plus1complement(9535872..9537227) NW_001867420 probable G-protein coupled receptor 61 GPR61 __SEG__ Chr5 {Equus caballus} MESSPIPESSGNSSTLGKVLQTPGPSTASGVPEVGLRDVASESVALFFMLLLDLTAVAGNAAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHDLF
GEVACRLYLFLSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVGVWVKALAMASVPVLGRVSREEGAPSIPPGCSLQWSHSAYCQLFVVVFAVLYFLLP
LVLILVVYCSMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSTQPISTGQVENVVTWIG
YFCFTSNPFFYGCLNRQIRGELSKQFVCFFKQAPEEELRLPSREGSIEENFLQFLQGTACPTESWVSRPTPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSY
LRPAPSPRPES*
919 >lcl|XP_001918134.1|Plus1complement(28078209..28079192) NW_001867427 olfactory receptor 226-like LOC100070383 __SEG__ Chr7 {Equus caballus} MEQRNQSGRVSEFVLLGFPAPVPLRTLLFALSLLAYVLVLTENTLVIMAVRNHPTLHKPMYFFLANMSFLEIWYVTVTIPKMLAGFTGSKQGHGQLISFEGCMTQLYFFL
GLGCTECVLLAVMAYDRYVAICHPLHYPVIVSGRLCVQLATGSWAGGFGISMVKVFLISRLSYCGPNIINHFFCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTG
ASYMAITHAVMHIPSAAGRHKAFSTCASHLTVVVIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQEVKRALRRTLHLYQGQDAKPGKISRDG*
920 >lcl|XP_001918142.1|Plus1complement(11537497..11538627) NW_001867420 protein arginine N-methyltransferase 6-like LOC100060260 __SEG__ Chr5 {Equus caballus} MSQPKKRKLESGGGGGGGGEGTEEEDGGEREAAVPRPRRTRRERDRLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVY
AVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLELRLDFWSQVKQLYDVDM
SCLESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRFSCYGSAPMHGFAIWFQVTFPGGDSEKPLVLSTSPFHPVTHWKQALLYLNEPV
QVEQDTAISGEITLLPSRDNHRLLRVLLRYKVGDQEEKTKDFAMED*
921 >lcl|XP_001918222.1|Plus161675954..61677078 NW_001867381 p2Y purinoceptor 1-like LOC100055494 __SEG__ Chr16 {Equus caballus} MTEVLWPAVPNETDAAFLGGPGSPWSNSTVPPPPAVAATSFRCALTKTGFQFYYLPAVYIVVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIF
YYFNKTDWIFGDAMCKLQRFILHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAVYVSVLVWLIVAGGISPILFYSGTGVRKNKTVTCYDTTSDEYLRSYFVYSM
CTTVAMFCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGD
TFRRRLSRATRKASRRSEAHLQSKSEDMTLNILSEFKQNGDTSL*
922 >lcl|XP_001918302.1|Plus188451820..88452761 NW_001867387 olfactory receptor 4L1-like LOC100072107 __SEG__ Chr1 {Equus caballus} MDLLSNRSSVSEFILLGLSSSQEIQIFFFVIFFLVYVAIVVGNLLIVISVIFDKHLHSPMYFFLANLSFFDLCLSSAATPKVIADFLRKRKTISFWGCMAQMFFMHFFGG
GEMSLLIAMAIDRYAAICKPLHYKTIMSCRVLILFLLLSWTIGFIHTTSQMVFTVGLPFCGPNIVDNIFCDLPLVIKLACTETYTLELLIISESGLLSLICFIILLISYV
VMLLTIWQRSSSASSKAVSTLSAHITVVTLFFGPAIFIYAFPFNSYSVDKFLSVFYSIITPLLNPIIYTLRNQEMKAAIGRLSSQHVGSWLTH*
923 >lcl|XP_001918311.1|Plus192868379..92869338 NW_001867377 olfactory receptor 2C3-like LOC100146557 __SEG__ Chr14 {Equus caballus} MEIANASSPEVFVLLAFSSQPLLEPILFVLVLGFYVVSLLGNGTIILVSCLDVHLHTPMYFFLANLSFLDIGFTTSIIPQLLVNLWGPQKTISYGGCVVQFYISHWLGAT
ECVLLAVMSYDRYAAICRPLQYTIIMHPQLSLSLALTSWLGGLTTSMVASTLTMLLPLCGNNRIDHFLCEMPLIIQLACVDTSFNEMEMYVACFIFAVLPLGLILVSYGH
IACAVLKIRSAEGRRKAFNTCSSHVAVVALFYGSIIFMYLQPAKSNSHERGKFLALFYTVVTPMLNPLIYTLRNKDVKKAFRRLVLEKSCGFVGTRGHI*
924 >lcl|XP_001918352.1|Plus193874029..93874958 NW_001867387 olfactory receptor 6C4-like LOC100056663 __SEG__ Chr1 {Equus caballus} MENHTTVTEFVLLGLSDACELQMLIFLGLLLTYSLTLLGNLLIVVITLMDRHLHTPMYYFLRNFAVLEIWFTSVIFPKMLTNILTGYKTISLPGCFLQSFLYFFLGTTEF
FLLAVMSFDRYVAICNPLRYATIMSKRVCVQLVLSSWLAGFLLIIVPSFIVLQQPFCGPNIINHFFCDNFPLLELICADTSLIELLGFIVANVSLLGTLSVTATCYGHIL
HTILCIPSAKERQKAFSTCSSHITVVSLFYGSCIFMYIRSDKGDQGEDRNKVVALLNTMVTPMLNPFIYTLRNKQVKQVFREQMNKLFL*
925 >lcl|XP_001918364.1|Plus188433117..88434043 NW_001867387 olfactory receptor 4N5-like LOC100072099 __SEG__ Chr1 {Equus caballus} MERENSTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFFIILTIRLDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYGGCITQLFFLHFLGAG
EMFLLVVMAFDRYMAICRPLHYSNLMNPRVCYALLLALWLGGFAHSIVQVALILHLPFCGPNQLDNFFCDVPQVIKLACTDTFMVELLMVSNSGLLTLLCFLGLLSSYVV
ILYRVKGHSSERKNKAISTCTTHIIIVFLMFGPAIFIYTRPFRAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRRLLSRHMVC*
926 >lcl|XP_001918381.1|Plus189872405..89874174 NW_001867377 ectoderm-neural cortex protein 1 ENC1 __SEG__ Chr14 {Equus caballus} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
927 >lcl|XP_001918392.1|Plus1complement(45465765..45466694) NW_001867366 olfactory receptor 1A1-like LOC100072577 __SEG__ Chr11 {Equus caballus} MRERNQSSTLEFILLGVMSQQKQEDFFFILFLFIYPTTLIGNLLIILAIHSDIHLHNPMYFLLANLSFVDIFFSSVTLPKTLMNYLLNTKAISFGGCLTQMYFMIALANT
DSYMLAAMAYDRAVAISRPLHYTTIMSPRSCVLLVVGSWVVGNANALPHTLLTAKLSFCGNQKVANFYCDIVPLLKLSCSDIQFNVKMMYLGVGVFSVPLLCIIISYLWV
FSTVLRVPSTKGVRKAFSTCGSHLTVVSLYYGTVMGMYSRPLISYTLKDAVITVMYMTVTPMLNPFIYSLRNRDMKAALGKLFSKRISS*
928 >lcl|XP_003362349.1|Plus125586551..25587483 NW_001867363 olfactory receptor 13H1-like LOC100630193 __SEG__ Chr10 {Equus caballus} MDSQNSTEEVYFLLLGFSQYPWAQTIFFCLLLMSYIITLFGNSLILLLIYCDTRLHTPMYFFLSNLSFLDMCYTTCSVPQMLINCLATIPVISLGQCWAQMATGLYLGGV
ECLLLAAMAYDRCVAIVDPLRYSVHMGPQLCGLLAGTSWTAAFLLTVVPVLTMPLEFCGHQVINHFSCELPALLKLACSDMRFYESLMVGTGALTLLAPFSFIVGSYGRI
LMAVMRVQSMQGRGKAFSTCGSHLIVVVLFYGTAISMYMMPQDKTIRDRDKIISISYGVLTPMMNPLIYSLRNKDMKGAFRRLLGKKIDL*
929 >lcl|XP_003362350.1|Plus125612548..25613513 NW_001867363 olfactory receptor 2H2-like LOC100630245 __SEG__ Chr10 {Equus caballus} MGAANWNETGTSDFVLLGLWTPPPLRPLLWAALLAAYLATVLGNGALLGLIALDQRLHRPMYRLLAHLALLDTAYVSTTLPQALVHMVARRATLSPARCGAQLYVGISLG
SCEAILLAAMALDRCLAVCQPLRYSAIMTPPHCAALAATAWALGFLLSVPNAAAALRLPFCPGRPPVDHFFCELPAVLRTACADTTANHMLVYGLGTPILLVPLAFILAS
YALILVAVGQLPSANSRFKALSTCSSHLAVVGLFYGTVTAMYLRPRGSSALPAKRHKLVAVFYLVITPVLNPLIYSLRNREVHAAARYALARLRGSRAVLR*
930 >lcl|XP_003362351.1|Plus125620040..25621023 NW_001867363 olfactory receptor 10A7-like LOC100630300 __SEG__ Chr10 {Equus caballus} MTVALGSPGAPAAPPWANQSSGREFFLLGFAHVPALRPLLAALFLAMFLLTLLGNALIVLLTALDPALRAPMYFFLRHLALVEICFSLDIVPQLLVTLLRPGRGVSPAGC
ALQLLLVLSCVTSECFLLTAMAWDRYVAICRPLRYGAIVSPRVCHLLAATCWLAGVPVSLVFTVWLFHFPFCGPRGIRHFFCDIAPLLSLVCADTRVLEANVLAATVLIM
IVPFCLIAVSYTKILATVLQMPSATGRHKALSTCASHLIVVVLFYGTTGVIHLRPKASCSPESKQVVSLSYTLVTPMLNPLVYSLRNKEVKAALGRACVQRRGIRIP*
931 >lcl|XP_003362352.1|Plus125630492..25631430 NW_001867363 olfactory receptor 5-like LOC100630317 __SEG__ Chr10 {Equus caballus} MERSLELGNMTRVQHFVLLGLSTSLGIRDVLFAVFLTLYLLTLLENTLIIYLICSHRELHKPMYFFLGNLSCLEMCYVSVTMPSLLVGLWTGPCHVPFTTCMTQLFFFIS
LICTECTLLASMAYDRYVAICHPLHYPLLMRPQVFLGLAMTSWFGGLLVSVIKTACIASLSYCGPNVLNHFFCDVSPLLNLSCTHVALTELVDFISAIVILWGSLIIAIA
SYVAIVRAVLHMPSAAARCKAFSTCASHLIVVGIFYSATIFIYARPNRIEAMDLNKVLSVIYTVVTPMCNPVIYCLRNKEVQAVFHRTIHSS*
932 >lcl|XP_003362354.1|Plus1complement(25666169..25667155) NW_001867363 olfactory receptor 10A7-like LOC100630379 __SEG__ Chr10 {Equus caballus} MTVALGSPGAPAAPPWANQSSGREFFLLGFAHVPALRPLLAALFLAMFLLTLLGNALIVLLTALDPALRAPMYFFLRHLALVEICFSLDIVPRLLVTLLRPGRGVSPAGC
ALQLLLVLSCVTSECFLLTAMAWDRYVAICRPLRYGAIMSPRLCHLLAATCWLAGVPVSLVFTVWLFHFPFCGPRGIRHFFCDIAPLLSLVCADTRVLEANVLAATVLVI
MVPFCLIAVSYIGVLATVLQMPSATGRHKALSTCASHLIVVVLFYGTTGVIHLRPKASCSPESKQVVSLSYTLVTPMLNPLVYSLRNKEVKAALGRLCCSYQGSGCHE*
933 >lcl|XP_003362393.1|Plus1complement(12585163..12586581) NW_001867364 cannabinoid receptor 1 CNR1 __SEG__ Chr10 {Equus caballus} MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDSPQLVPADQVNITEFYNKSLSSYKENEENIQCGENFMDMECFMI
LNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHR
PLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVT
RPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTA
SMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL*
934 >lcl|XP_003362656.1|Plus1complement(10620549..10621499) NW_001867368 olfactory receptor 4S2-like LOC100058728 __SEG__ Chr12 {Equus caballus} MENNVTEFILTGLSQNEQVQQLCFFLFLLFYMILMTGNFFIVMTIQRSLNLNSPMYFFLSFLSFVDICYSSVTAPKLIIDFQAKVRRISFVGCMVQLFCVHLFGCTEIFI
LTVMAYDRYVAICKPLRYTTIMDWKVCSILVLTCWLGGFVHSFIQTILTVQLPFCGPNLIDHYFCDVHPLLKLACTDTYAVGLIVVANSGMISLSCFVILVGSYTVILLS
FKTRSSEGRHKALSTCASHITVVILFFVPCLFIYLRPSTTFTEDKMVAVFYTIITPMLNPMIYTLRNMEVKNAMKRLWLGRNRRYPDVKLNGVGTA*
935 >lcl|XP_003362809.1|Plus1complement(3316253..3318277) NW_001867376 vasorin-like LOC100629909 __SEG__ Chr13 {Equus caballus} MRSRIPPPLLLLLLLLAPGPGVQSCPSGCQCNQPQTVFCTARRGTTVPRDVPPDTTGLYVFENGITTLDVGSFAGLPGLQLLDLSQNQIASLPSGVFQPLTNLSNLDLTA
NRLREITNGTFRGLRRLERLYLGKNRIRHIQPGAFDALDRLLELKLQDNELRALPPLHLPRLLLLDLSHNSLPALEPGALDTANVEALRLAGLGLRHLDEGLFGRLRNLH
DLDVSDNQLEHVPPAIWGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDLSNLSLQALPHELSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESRVALISSEETRCH
FPPKNAGRLLLELDYADFGCPATTTTATVPTMRPAAWEPTLSPSSLAPTWLSLTEPATEAPSLPPAAPPTVGPVPQPQDCPTSICLNGGTCHLEARGHLKCLCPEGFTGL
YCESQVQQGPRPSPAPATLRPPRPLPLGIEPASPTSLRVGLQRYLQGSAVQLRSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVRPLGAGRVPEGEEA
CGEARTPAAVRSSHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVRRGRAAAAAAQGKGQVGPGAGPLELEGVKAPLEPGPKVTEGGGEALPSGPECEVPLMGYP
GPGPQGPLPAKPYI*
936 >lcl|XP_003362907.1|Plus11717341..1718273 NW_001867377 olfactory receptor 2G6-like LOC100066487 __SEG__ Chr14 {Equus caballus} MMEINDSSGDDFTLVGFSEYPQAEFILSLFVSGFYAMTLTGNVAIILVSLLDSRLHTPMYFFLRNLSFLDMCFTTCIVPEMLANMWKGSKKISYIGCVVQYSVALALGST
ECVLLDVMAVDRYVAVCWPLRYATIMHQQICHLLATMSWLSGFVNSLFQSSLAVVLPLCGHRHVDHFLCEVLVIIKLSCVDTGPTELKMLIARLIILTVPVCIILTSYAC
IARAVVRMHSAEGRQKAFGTCASHLIVVSLFYGTIMFMYLQPKSNYSQNQGKVFALVYTIVAPTLNPLIYTLRNKDVKRAIRKVVWKDSV*
937 >lcl|XP_003362938.1|Plus1complement(92762135..92763088) NW_001867377 olfactory receptor 2G2-like LOC100630679 __SEG__ Chr14 {Equus caballus} MAMERSTNDSSLTGFILLGFSDYPQLQEPLFVVILILYLLTIVGNTTIILVSHVEPKLHTPMYFFLSHLSFLDLCFTSSVIPQLLVNLWDPMKAITYGGCVVQLYVSLAL
GSTECVLLAVMSYDRYVAICRPLQYTALMHPCLCIALATLAWLSGVATTLIQSTFTLQLPFCGHRQVDHFICEVPVLIKLACVDTTFNEAELFVASVLFLIVPVSLILVS
YGYIAQAVLKIKSTTGRRKAFGTCSSHLMVVTIFYGTITFMYLQPAKSRSKDQGKFVSLCYTVVTPMLNPLIYTLRNKEVKGALRKVLGKILGENFT*
938 >lcl|XP_003363117.1|Plus1complement(60455161..60456180) NW_001867381 p2Y purinoceptor 12-like LOC100630046 __SEG__ Chr16 {Equus caballus} MDNLTSVARNSSLCTRDYKITQVLFPLLYTLLFFVGLIINSLAMRVFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVVFYFTMYISIS
FLGLITIDRYQKTTRPFKTSNPNNLLGAKILSVVIWAFMFLLSLPNMILTNKRPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRT
RGTGKAPRKRVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCPAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKHSLMAMLKCPNSATSPAPENRRKAQAG
GDPSEETPM*
939 >lcl|XP_003363175.1|Plus1complement(17372250..17373272) NW_001867381 c-X-C chemokine receptor type 6-like LOC100630558 __SEG__ Chr16 {Equus caballus} MDDYEYVVPGFLNTSNDSSQEHERFLQFKKFFLPCMYLVVFICGLMGNSLVLVIYIFYQKLKSLTDVFLMNLPLADLVFVCTLPFWAYASFHEWVFGNIMCKTLLGIYTL
NFYTSMLILTCITVDRFIAVGQATKAYNQQAKRRTWGKVICLSIWVTSLLVSLPQIIYGNVLYYDKLICGYQNEEISTVILATQMTLGFFLPLLAMIVCYSVIIKTLLHA
RGFQKHKSLKIIFLLVAVFLLTQTPFTLVKLILSTSWEYQAMISFQYAIIVTEVIAFLRACLNPVLYAFVGLKFRKNFWKLVKDIGCLPYLGVSSQWKSENTSKSCSASH
NMEATSMFQL*
940 >lcl|XP_003363272.1|Plus14860593..4861627 NW_001867383 lysophosphatidic acid receptor 6-like LOC100629781 __SEG__ Chr17 {Equus caballus} MVSSNSSGCVYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICTLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCI
SVDRFLAILYPFKSKTLRTKRNAKIVCIAVWLTVMGGSAPAVFFPSTHSQGNNTSEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRS
KINKTKVLKMIFVHLVIFCFCFVPYNINLILYSLMRTQTFVNCSAVTAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSARRIDSRFSEVQGTENFIQHNL
QNLKSKIFDNESTI*
941 >lcl|XP_003363276.1|Plus1complement(3408107..3409525) NW_001867384 serine/threonine-protein kinase MARK2-like LOC100050863 __SEG__ Chr18 {Equus caballus} MLPGLAATSAGRQPCPRDYQLRRTLGEGSFGIVKLALHVPSGTEVAVKIIQKKEQSAATAKRLLCETQGLARLRHPHILRLVEVMESKETLFIISEYVRGGNLLDHLMEH
GPLTEEEARGWFRQLVSALQYCHRRGVIHRDLKPENVLLDPAGSAKLADFGFCSLDPGGPLSTFCGTPGYMAPEVMRLQPYAGPPADVWSLGVLLHAMLAGSLPFWGEDF
DAIQRSTLRGAYSPPRLVSCQCAQLLRGLLTLDPGKRKTLEEVMGDPWVNWGQPRLRPYREPPADTRTAWGTDEMAKAQQPQGGGHARPLSSLPSNKAHSCRALQHCRAW
RRASEPRGRRAGSEPLLPTWLREAGRQRPSEKPQSGPKAAEPGGALPSLDSCPAAPSPAPPRDLGAVPSSDSARTTRGAQEESCQGDSRQAGQPHEVTPASPSGRSQGRG
GAARRLFKALRRLCCCLPIRIGSGKRNRVWPR*
942 >lcl|XP_003363278.1|Plus19527052..9527924 NW_001867384 serine/threonine-protein kinase MARK2-like LOC100629172 __SEG__ Chr18 {Equus caballus} MLPGLAATSAGRKICLRDYKLLRTIGEGSCAKVKLALHIPTRTKVAVKMIPKQEQSSSSAKRLLCEVHSLRTLRHPHIVKLLEVINGEETLFLVTEYIRGGNMLDHLLQH
GPLTEEEARGPSRQLVLALQYCHRKGIVHRDLKLENVLLDPEGNAKLADFGLSSVVPGRPLSTYCGTPCYTAPEVLRRQPYNGPPDDLWSLGVLLHVTLTGSLPFWGEDF
SDVRQRVLRGAYSMPQFLSQECIQLLRGLMTVNPRKRKTLEEAMGDPLVNQGRPRLRPYRELPEDKRDSG*
943 >lcl|XP_003363375.1|Plus1complement(12568151..12569020) NW_001867385 growth hormone secretagogue receptor type 1-like isoform 2 LOC100057865 __SEG__ Chr19 {Equus caballus} MWNATPSEEPGPNLTLPDLGWDASPDNDSLAEELLPLFPAPLLAGVTATCVALFVVGVAGNLLTMLVVSRFREMRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWN
FGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVILVIWAVAFCSAGPIFVLVGVEHENGTDPQDTNECRATEFAVRSGLLTVMVWVSSVF
FFLPVFCLTVLYSLISRKLWRRRRGEAAVGASLRDQNHKQTVKMLGGSQRALELSLPGSLLSPCLSPSP*
944 >lcl|XP_003363412.1|Plus1complement(31151181..31152824) NW_001867385 carboxypeptidase N subunit 2-like LOC100630228 __SEG__ Chr19 {Equus caballus} MLPGAWLCWACLLLVARLTQPCPVGCDCFDREVFCSDEELAAIPQDIPPHATDIVFVETSFTTVGARAFGGIPNLTKVVFLNTKLRHFGPDAFGGLPRLEDLEITGSGFS
NLSTDIFSNLTSLSKFTLNFNTLEALPESFFCHMDALESLQLQGNRLQTLPGRLFQPLKHLKTLNLAQNLLVQLPEKLFNPLSSLQTLRLSDNALSSLPQGVFGKLGSLR
ELFLDGNSIKELPSEVFSQLFRLEKLWLQQNTIGHLPLSIFSSLGNLTFLNLQGNALRMLPAGLFAHTPGLVGLSLSYNQLETVAEGAFANLSSLSSLTLSHNAITHLPA
GVFRDLGELIKLYLGSNNLTALHPALFQNLSKLELLSLSRNLLTMLPEGIFDTNYNLFNVALHGNPWQCDCHLAYLFSWLQQYSDLLFNIQTYCAGPAYLKGQVVPALKE
ELLVCPVTWDHLGFQAPNLEDREPGGSWDLAVEERAARSRCTYSNPEGTVVLACDEVQCRWLNIQLSPRQRSGSPGLMYNASQEWDLKSRCGSVRLTVSIEAWAGEP*
945 >lcl|XP_003363579.1|Plus1complement(87879371..87880309) NW_001867387 olfactory receptor 4F3/4F16/4F29-like LOC100071958 __SEG__ Chr1 {Equus caballus} MWGGNHSVVSEIVLVGLTNSLEMQLALFLVFSVFYVAGILGNLLIVLTVISDPHLHSPLYFLLANLSFIDIWVSSSTAPKMISDLFKERKVISFQGCIAQTFFIHIMGGT
EMVLLIAMALDRYVAIHRPLHYLNIMNFRTCILLLVASWTVGIIHSLIQLVFVVNLPFCGPNELDGFYCDLPRLISLACTDTYRLELMVTANSGFISLGTFCILIISYIF
ILLTVWQRSSDGLSKALSTLSAHITVVVLFFGPCIFVYSWPFPTVPVDKFLAIFYVIITPFLNPTIYTFRNKEMKVAMRRIFSQVLSFRKLF*
946 >lcl|XP_003363803.1|Plus1complement(27498357..27499301) NW_001867389 olfactory receptor 2W1-like LOC100629501 __SEG__ Chr20 {Equus caballus} METSNGSSETDFILLGFSDRPQLERIISVLVFIFYTATLVGNTTIILVSYLDTQLHIPMYFLLSNLSFLDICYTTSIIPQMLVNLWGPKKSITYGGCVLQFFFALDLGAT
ECLLLAVMAYDRYAAVCQPLHYTVIMHPQLCQKMVLTVWLGGLGSALILCPLTLKLPKCGHREVDNFFCEMPALIKMACVYSKVTEIAVFALGVILLLVPLSLILISYGV
ITHAVVRIKSAARWHKVLNTCGSHLTVVTLFYGTVIYMYMKPQNHTSQDEGKFLTLFYTIVTPSLNPLIYTLRNKDVKSAIKRILCVEKWSAKS*
947 >lcl|XP_003363821.1|Plus136614537..36615571 NW_001867389 allatostatin-A receptor-like LOC100064060 __SEG__ Chr20 {Equus caballus} MEPNVTFTARLTATPEQRLRLVFAGACGLILLVGLLANGLMLLVVGQGPGTPRPLLALTTSLMVNITLSDLLFLSCVVPVLLLSFLRHDWWLGQAVCTTSQATNNATMFC
TFYSMVATALLRHVAVARPDVALPCSQGARLLLCGAMWILGLTASLPNWLFQRVVVEEAVRARACLLLLSPAWTSCYFTLLGALAFLPCVLGLGCSFSHVGWLLWTRPRG
PVGESIQEHRENTGLILIVLLVFVLMWGPCSVLGYVAAMGGLPATPTAFVTSSLCTILAYSNCAVSPILCFCLSRAFRAGLRKVFCRPMAARHPRGVGGAGMVMEPVQPG
HDRAPGGLWGLAGV*
948 >lcl|XP_003364072.1|Plus111327535..11329676 NW_001867395 zinc finger and BTB domain-containing protein 1 isoform 2 ZBTB1 __SEG__ Chr24 {Equus caballus} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGNEANRWCAEPSSTVNTPHNREPDEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRSYHRIVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSTSTTGSRKSSTVESELASEEKSRAAERKRIIIKME
PEDIPTDELKDFNIIKVTDKDCNDSTDNDELEDEPEEPFYRYYVEEDVSIKKSGRKTLKPRMSINADERGGLENLRPPNNSSPVQEDTENASCELCGLTITEEDLSSHYL
AKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDMEENPDEQSEIRDMFVEMLDDFRDSHFQINSIQKKQLFKHSACPFRCPNCGQRFETENLVV
EHMSSCLDQDMFKSAILEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
949 >lcl|XP_003364126.1|Plus146142177..46143448 NW_001867395 zinc finger and BTB domain-containing protein 42-like LOC100147235 __SEG__ Chr24 {Equus caballus} MEFPEHGGRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDRPAGSRDTVRLNGDIVTAPAFGRLLNFMYEGRLDLRSLPVEDVLAAASYLHMYDI
VKVCKGRLREKDHALQPETPAPGAEPPGQSPYSLPTWTPKLCPAAQKARLPQAGVKAALPPRALGPPPWQAPGESDLALDLSVKPSPRPELVHPPFVLQTPPCGRMQPGA
QQLVKDEPDSVSEREDSSSPQSPHSPLQPPCVPAAECQAGGLEPLPVGMADSGQLELDAQRGASRAELGPAGHLCLCPLCSRLFPSAHVLQLHLSGHFRERDGTRARVSP
DGAVPTCPLCGKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHVRKFHCGLVKSLLV*
950 >lcl|XP_003364176.1|Plus1complement(24798710..24799120) NW_001867396 hypothetical protein LOC100067633 LOC100067633 __SEG__ Chr25 {Equus caballus} MWNPNAGHPGPSPYPPHTGGPNPAHPPPVNPAFPPGPPPPGPPPGNPAFPPCGPAHPVPPPGYPGCPPSGPYPPPCPPPAPGMPPVNPLAPGLVGPGMVMDKKMQKKMKK
AHKKAHRHHKHGKHSSSSSSSSSDSD*
951 >lcl|XP_003364179.1|Plus126900294..26901229 NW_001867396 olfactory receptor 1L4-like LOC100067520 __SEG__ Chr25 {Equus caballus} MEIKNYSSSTSDFILLGLSSNPQLQKPLFAIFLIIYLVTLVGNVLIILAIHSDSRLHTPMYFFLSNLSCMDICFTTDIVPKMLVSFLSETKSISYVGCLIQMYFFMAFGN
TDSYLLASMAIDRLVAICNPFHYDVVMNPQRCLLMLLGSCTISHVHSMLHVLLISRLSFCASHVIKHFFCDTQPVLKLSCSDTSSNQIVLMTESLAVIATPFLCVLFSYL
RIIITVLRIPSAAGKWKTFSTCGSHLTVVVLFYGSIIYVYFRPLSMYSVVKDRVATLMYTVVTPMLNPFIYSLKNKDMKMGMRKLRFRIHS*
952 >lcl|XP_003364180.1|Plus126913880..26914815 NW_001867396 olfactory receptor 1L4-like LOC100071251 __SEG__ Chr25 {Equus caballus} MEIMNYSSSTSGFILLGISSNPHLQKPLFAIFLNMYLVTLVGNVLIILAIHSDSRLHTPMYFFLSNLSFMDICFTTVVVPKMLVNFLSETKSISYVGCLIQMYFFMAFGN
TDSYLLASMAIDRLVAICSPLHYDVVMNPQRCLLMLLVSCTISHLHSMLHVLLISRLSFCASHVIKHFFCDTQPVLKLSCSDTSSNQILLMTETLAVIVSPFLCILFSYL
RIIITVLRIPSAVGKWKAFSTCGSHLTVVVLFYGSVIYVYFRPLSVYSVVKDRVATLMYTVVTPMLNPFIYSLRNKTMKTSLRKLRLKIHS*
953 >lcl|XP_003364181.1|Plus126934000..26934935 NW_001867396 olfactory receptor 1L4-like LOC100071244 __SEG__ Chr25 {Equus caballus} METKNDSSSTSGFILLGISSNPHLQKPLFAIFLIIYLVTLVGSVLIILTIHSDSQLHTPMYFFLSNLSFMDICFTTDIVPKMLVNFLLETKSISYVGCLIQMYFFIAFGN
TDSYLLASMAIDRLVAICNPLHYCVVMNPRRCLLMLLVSCTISHVHSMLHVLLISRMSFCASHVIKHFFCDTQPVVKLSCSDTSSTQIVVMTESLAVIATPFLCILFSYL
RIIITVLRIPSAAAKWKAFSTCGSHLTVVVLFYGSIIYVYFRPLSLYSVMKDRVATLMYTVVTPMLNPFIYSLRNQDMKMGMRKLRFRIHS*
954 >lcl|XP_003364187.1|Plus130447756..30449270 NW_001867396 zinc finger and BTB domain-containing protein 34 ZBTB34 __SEG__ Chr25 {Equus caballus} MSVEMDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAA
SFLQMQCVIDKCTQILESIHSKISVGDVDSVTVGAEETPESRNGVKDSSFFANPVEISPPYCSQVRQPTTSGDLRMETTSSKALRSRLQEEGHSDRGSSGSVSEYEIQIE
GDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAASQPSSVSEAFGSLSNSSPSRSMLSCFRGGRARQKRAL
SVHLHSDLQGLVQGSDSEALMNNPGYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEICGKC
FPFQGTLNQHLRKNHPGVAEVRSRMESPERTDVYVEQKLENDASASEMALDSRMEIHTVSDAPD*
955 >lcl|XP_003364909.1|Plus1complement(11533876..11534781) NW_001867414 olfactory receptor 2F1-like LOC100056743 __SEG__ Chr4 {Equus caballus} MRDNLTWVSEFVLMGLSSDRRIQAGLFVLFGVAYLLTLLGNGLIVLLIWLDPRLHLPMYFFLCNLAVLDICYTSSGVPQMLVHFLLEKKIISFTRCATQLFFSLALGGTE
FLLLATMAYDRYVAVCDPLHYAAMMGPRRCAVLAGVSWLVGLANSAVETAVTMRLPTCGHYMVNHVSCETLALVRLACVDVTLNQLVILASSVVVLLVPCCLVSLSYAHI
VVTILQIRSRGGRRKAFGTCASHLIVVSMSYGMALVTHMQPSSTNLTEQDKLVVLFYAVLTPMLNPLIYSLRNKDMKAALS*
956 >lcl|XP_003365070.1|Plus1complement(7667192..7667512) NW_001867419 hypothetical protein LOC100630233 LOC100630233 __SEG__ Chr5 {Equus caballus} MSSDDKNKSSESKNEPKNCEPRCEQKCENKCQPSCLKKLLQRCSEKCPRERCPAPPKCSLCPPPCPPPCPPPCPPTCPPPCSAPCPPKPCVKPCPPKCPPPCPPPE*
957 >lcl|XP_003365200.1|Plus118269947..18270897 NW_001867422 olfactory receptor 12-like LOC100067218 __SEG__ Chr6 {Equus caballus} MPPRRNGSLSVASLQEFVLEGFEGGLETQALLFAVFLALYLGTVLGNLTMIVVITQDARLHSPMYFFLKNLSFLDLCYSSVIAPNALANFFSSSKVITFQGCATQLFFFS
LLGTTEAFLLTVMAYDRFMAICSPLRYPITMCPSACTRLVLGTFCAGCLNSIVQTASTFSLPFCSSNHIDHFFCDVPPLLRLACASTAINELLLFGLCGLIVVGTTLLVL
VSYGYITVTILRMQSGAGRHKVFSTCGSHMMAVSLFYGTGFVMYAQPGAVESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEALWKLSQKHTAL*
958 >lcl|XP_003365262.1|Plus114090157..14091128 NW_001867424 olfactory receptor 6C2-like LOC100057025 __SEG__ Chr6 {Equus caballus} MKNHTITTFILLGLTDDPRLQIPIFMFLFLSYVVSITGNLTIMSLTLVDCHLKTPMYFFLQNFAFLETAFTSACIPRYLYNIATGDRTIKYNICILQASFTDVFAVTEFF
LLATMSYDRYVAICKPLHYQTIMSSRVCRRLILCCWMSGLLIIIPPLILFLNLKFCDSNVIDHYLCDSSPILKISCSDTWLIEQLVVACAVLTFIVTLVCVIVSYIFIIK
TILRFPSALQRKRAFSTCSSHMIVVSITYGSCIFIYIKPSAKESAVINKGVTVLITSIAPMLNPFIYTLRNKQVRQAFSNSLKKIALSQRNWRMFMSRNKILS*
959 >lcl|XP_003365426.1|Plus125584228..25585169 NW_001867427 olfactory receptor 51V1-like LOC100629187 __SEG__ Chr7 {Equus caballus} MSVLPDSKISNSTFLLTGFPGLEGKYPWLSIPFSCVYAMVLSGNCLVLHVIRTEPSLHEPMFYFLAMLALTDLCMGLSTVHTVLGVLWGLSQEIGLDACIAQTFFVHGLS
CMESGVLLAMAFDRFTAICNPLRYTSILTNTRIINIGVAILGRSFLFITAPIVRLKFFHYCRPHILSHSFCLHQDLLRLSCSDIHFNSFYALALVICTLLADSVLILISY
ILILHSVLTIASQEERLKSLQTCVSHICAVLVFYIPIIGLTMVHRFGKHLSPVVHVLMGNIYILFPPLMNPIIYSVKTQQIRRRIQRWFTKQN*
960 >lcl|XP_003365448.1|Plus1complement(38825401..38826384) NW_001867427 mas-related G-protein coupled receptor member X3-like isoform 2 LOC100071946 __SEG__ Chr7 {Equus caballus} MNPNVTAWGTKLTMTDNHESLPKCDTKTVIQALLTFTIALVGLAGNAIVLWILGFHMRRNPFTVYILNLAGADFIFLCSQIVLNLEGLIALFHSLSFSIASIFITVWNFA
YFAGLSILTAISTERCLSVLCPIWYRCGRPKHTSTVICALLWALSLVLSVLNRYYCGFLYSTFEDGWCPISHFSNATWLTFLFVVFSASSIALLVKIFCSSRRVKVTRLG
VTILLTMLVFLLCGLPFSIHWFLAIRIQNGFNTFLCYLYMVTIVLSGINSSANPIIYFFVGSFRQWRLKQNLKLVLQRALQDTPEAEEGDGSTPQETLDMSTSKLEQ*
961 >lcl|XP_003365466.1|Plus1complement(24577500..24578444) NW_001867427 olfactory receptor 52R1-like LOC100067462 __SEG__ Chr7 {Equus caballus} MLASENSSSHPVFFILLGIPGLKNAQFWIAFPLGVMYVVATVGNITILHIIRTDHTLHEPMYLFLAMLAITDLVLSSSTQPKMLAILWFHAHEIEYHACLIQVFFIHAFS
SVESGVLMAMALDRYVAICFPLRHPSILTPSLVGKLGAVVMVRGLLWVSPFCFMISRMPFCPNQVIPQSYCEHMAVLKLVCADTTINRAYGLFVAFSVAGFDMSVSSISY
VMILRTVLGLPSGEARLKAFGTCASHICVILALYVPALFTFLTHRFGHHVPQVVHIMLANLYLLVPPMLNPIIYGVRTKQIRDRVVQGCCGKDP*
962 >lcl|XP_003365467.1|Plus124815239..24816246 NW_001867427 olfactory receptor 51L1-like LOC100630586 __SEG__ Chr7 {Equus caballus} MTMVVWNNNDTVEPIFILKGFPGLEYVHFWLSIPFCLAYLVAFIGNITVLSVIRIESSLHQPMYYFLSILALTDLGMSLSTLPTVLAVLWLDAPEIQASACYAQLFFIHT
FTFLESSVLLAMAFDRFVAICRPLHYTTILTNSVIGKIGLACLLRSMGVVLPTPLLLRQYHYSHVNALSHTFCLHQDVLRLSCSDARINSVYGLCVVITTLGMDSIFILL
SYVLILNAVLGIASREERLKALNTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPVVHILMADIYLLLPPVLNPIVYSVKTKQIRLRILRTFGLGRLQTLSSSFLTEKCCN
SCLSR*
963 >lcl|XP_003365469.1|Plus1complement(25042576..25043511) NW_001867427 olfactory receptor 52A5-like LOC100068025 __SEG__ Chr7 {Equus caballus} MALTNGTFFKPSLFTLVGVPGLESVQHWIGIPFFISFILAVIGNGLLITIIHTERSLHEPMYIFLAVLAATDLGLTLCITPKMLVIFWLHSREIQFDCCLIQMYFTHTFQ
CMESGILLAMAFDRYVAICEPLRHSAIFTKKVLISIITVVTIRASLTIIMCPLLMKLHFRTTVISHSYCAHVAVVTLAAENVRINKAYGLLVAFSVLGFDVIFIFLSYAF
IFQAVFKLSQKEARLKAFNTCTAHIFVFLQFYILTFFTSFIHRFGFNVAPYVHILLSNLYLLVPPLLNPIVYGVKTKQIRETVIKMFTPKN*
964 >lcl|XP_003365472.1|Plus1complement(25534889..25535842) NW_001867427 putative olfactory receptor 52P1-like LOC100629661 __SEG__ Chr7 {Equus caballus} MADNSTHHYISSFFLVGIPGLQDFHCWIGLPVCLLFVLTLLGNSVITITIKLEPSLHQPMYFFLCMLAMNDMALASSTAPKMLGIFWLDAHRFDFNICLAQMYFIHTFCI
IESALLVAMAFDRYVAICIPLRYTTVLTTTMVIKMGLAGTIRAILMVLPCPLLIKRLPYYTKHVINHAYCEHMAVVKLASANTLINRAYGISVALSVMVLDLGLIATSYI
KILQSVFRLSSQNARSKALSTCAAHVCTILVSYTPALFSFLTHRIGKKVPPSVHIIFASFYLLVPPTVNPLVYGVKTKQIRDRVVGLFFPNKEISEN*
965 >lcl|XP_003365473.1|Plus1complement(25548633..25549586) NW_001867427 putative olfactory receptor 52P1-like LOC100068669 __SEG__ Chr7 {Equus caballus} MTENATHHSISSFFLVGIPGLQDFHCWIGLPVCLLFALTLLGNSVIIIIIKLEPSLRKPMYFFLCMLARNDLALASSSAPKMLDIFWLDAHWINFNICLVQLYFIHTFCI
IESALLVAMAFDHYVAICIPLRYPTILTTSMGIKMSLAGLTRATLLVFPGPLLIKRLPYYTKYVINHAYCEHMAVVKLASANTHVNRVYGISVALSVMVLDLGLIAISYI
KILQAVFRLSSQNARSKAPSTCAAHVCTILVSYTPALFRFLTHRIGKKVPPSIHIIFASLYLLVPPTVNPLVYGVKTKQIRDRVVDLFFPNKKISES*