SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam T    

ID / Description / Sequence
1 >lcl|NP_001003020.1|Plus1complement(3855169..3856251) NW_876276 C-C chemokine receptor type 4 CCR4 __SEG__ Chr23 {Canis lupus familiaris} MNPTDIADTTLDESIYNNYYLYENIPKPCTKEGIKAFGELFLPPLYSLVFLFGLLGNSVVVVVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLC
KIISWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVLASLPGLLFSTCYTERNHTYCKTKYSRNSTRWKVLSSLEINILGLVIPLGTMLF
CYSMIIRTLQHCKNEKKSKAVRMVFAVVALFLGFWAPYNVVLFLETLVELEVLQDCTFERHLDYAIQATETLAFVHCCLNPVIYFFLGEKFRKYLVQLFKTCRGPFMLCQ
YCRLLQMYSPDTPSSSYTQSTGDHDLHDAL*
2 >lcl|NP_001003118.1|Plus159624693..59626033 NW_876259 neuropeptide Y receptor type 5 NPY5R __SEG__ Chr15 {Canis lupus familiaris} MDLELQDFYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMRKRNQKTMVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFG
RVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFDSALLSSRYLCVESWPSDSYRIAFTISLLLVQY
ILPLVCLTVSHTSVCRSISCGLSNKENKLEENEMINLTLQPFKKSGPQVKLSSSHKWSYSFIRKHRRRYSKKTACVLPAPARPPQENHSRMLPENFGSVRSQHSSSSKFI
PGVPTCFEVKPEENSDVHDMRVNRSIMRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLISLI
QCLHMS*
3 >lcl|NP_001003151.1|Plus124842721..24843797 NW_876304 C-X-C chemokine receptor type 2 CXCR2 __SEG__ Chr37 {Canis lupus familiaris} MEYINWDNYSLEDLFGDIDNYTYNTEMPIIPADSAPCRPESLDINKYAVVVIYVLVFVLNLLGNSLVIMVVLYSRVSHSVTDVYLLNLAIADLLFALTLPIWAVSKVKGW
IFGTPLCKIVSLLKEVNFYSSILLLACISMDRYLAIVHATRTLTQKRHWVKFICLGIWALSLILSLPIFVFRRAINPPYSSPVCYEDMGANTTKLRIVMRALPQTFGFIV
PLMIMLFCYGLTLRTLFEAHMGQKHRAMRVIFAVVLVFLLCWLPYNLVLVADTLMRLQAIKETCQRRNDIGRALDATEILGFFHSCLNPLIYAFIGQKFRHGLLKIMAFH
GLISKEYLPKDSRPSFVGSSSANTSTTF*
4 >lcl|NP_001003234.1|Plus1complement(49759480..49760727) NW_876311 beta-2 adrenergic receptor ADRB2 __SEG__ Chr4 {Canis lupus familiaris} MGQPANRSVFLLAPNGSHAPDQGDSQERSEAWVVGMGIVMSLIVLAIVFGNVLVITAIARFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWT
SIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYS
RVFQVAQRQLQKIDRSEGRFHAQNLSQVEQDGRSGHGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIPKEVYILLNWVGYVNSAFNPLIYCRSP
DFRIAFQELLCLRRSSLKAYGNGYSNNSNSRSDYAGEHSGCHLGQEKDSELLCEDPPGTEDRQGTVPSDSVDSQGRNCSTNDSLL*
5 >lcl|NP_001003280.1|Plus141574331..41575464 NW_876292 5-hydroxytryptamine receptor 1D HTR1D __SEG__ Chr2 {Canis lupus familiaris} MSPPNQSLEGLLQEASNRSLNATETPEAWGPETLQALKISLALLLSIITMATALSNAFVLTTIFLTRKLHTPANYLIGSLAMTDLLVSILVMPISIAYTTTRTWSFGQIL
CDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGRAAVMIATVWVISICISIPPLFWRQAKAQEEMSDCQVNTSQISYTIYSTCGAFYIPSVLLIILYGRI
YVAARNRILNPPSLYGKRFTTAQLITGSAGSSLCSLSPSLQEERSHAAGPPLFFNHVQVKLAEGVLERKRISAARERKATKTLGIILGAFIVCWLPFFVASLVLPICRAS
CWLHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQRVVHVRKAS*
6 >lcl|NP_001003281.1|Plus11554247..1555335 NW_876280 C-X-C chemokine receptor type 7 CXCR7 __SEG__ Chr25 {Canis lupus familiaris} MDLHLFDYAEPGNFSDISWPCNSSDCIVVDTVLCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVVTIPVWVVSLVQHNQW
PMGELTCKITHLIFSINLFGSIFFLTCMSVDRYLSITYFASTSSRRKKVVRRAVCVLVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSVKEWLISMELVSVVLG
FAIPFCVIAVFYCLLARAISASSDQEKQSSRKIIFSYVVVFLVCWLPYHVVVLLDIFSILHYIPFTCQLENFLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAF
IFKYSAKTGLTKLIDASRVSETEYSALEQNAK*
7 >lcl|NP_001003365.1|Plus1complement(45962566..45963585) NW_876276 P2Y purinoceptor 12 P2RY12 __SEG__ Chr23 {Canis lupus familiaris} MDNLTSVAGNGSLCTRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVVFYFTMYISIS
FLGLITIDRYQKTTRPFKTSSPNNLLGAKILSVVIWAFMFLLSLPNMILTNRRPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRT
RGVGKVPKKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCSAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMNMLKCQNPATSLSHENRKKEQDG
GDPSEETPM*
8 >lcl|NP_001005261.1|Plus1complement(17198956..17200035) NW_876272 C-C chemokine receptor type 3 CCR3 __SEG__ Chr20 {Canis lupus familiaris} MEATTAEIKTMDESIQTTVFDYENSLPCEKVNIKHLGAQFLPPLYSLVFVIGLLGNVVVVVILTKYKRLWIMTNIFLLNLAISDLLFLFTLVFWIHYTGWNDWVFGRSMC
KLISGLYYLGLYGEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSVLTWGLAGLAALPEFIFHESQKESEQFVCTPLYPKDQEDNWKRFHALRMNILGLALPLLIMV
VCYSGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYNLVLLLSAFQTIFFETTCEQSKQLDVAMQITEVIAYTHCCINPIIYAFVGERFRKHLCHFFRRNVATYLGK
YIPFLPSEKLERSSSVSPSTGEQEFSFVF*
9 >lcl|NP_001005264.2|Plus151484414..51486771 NW_876259 toll-like receptor 2 precursor TLR2 __SEG__ Chr15 {Canis lupus familiaris} MSRVLWTLWVLGAVTNLSKEEAPDQSSSLSCDPTGVCDGRSRSLNSMPSGLTAAVRSLDLSNNEITYIGNSDLRDCVNLKALRLESNGINTIEEESFFSLWSLEHLDLSY
NLLSNLSSSWFRPLSSLKFLNLLGNPYKSLGETPLFSQLTNLRILKVGNIYSFTEIQDKDFAGLTFLEELEIDASNLQRYEPKSLKSIQNISYLALRMKQPVLLVEIFVD
LSSSLKHLELRDTHLDTFHFSEASINETHTLVKKWTFRNVKVTDRSFTEVVRLLNYVSGVLEVEFEDCTLYGLGDFDIPDVDKIKNIGQIETLTVRRLHIPHFYSFYDMS
SIYSLTEDVKRITVESSKVFLVPCSLSQHLKSLEYLDLSDNLMVEEYLRNSACQHAWPLLQTLILRQNRLKSLEKTGETLLTLKNLVNLDISKNNYLSMPETCQWPEKLK
CLNLSDTRMQSITRCIPQTLEILDVSNNNLESFSLILPQLKELSISRNKLKTLPDASFLPTLQIMRISRNTINAFSKEQLDSFHRLQTLEAGGNNFLCSCEFLSFTQEQQ
ALAGLLVGWPEDYLCHSPSYVRGQRVGTARLPASECHRTALVAAVCCVLLLLVLLTAGACHHFHGLWYLRMLWAWLQAKRKPRKAPSRDVCYDAFVSYSEHDSYWVENLL
VQKLEHFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPTDDA
QQEGFWLNLRTAIKS*
10 >lcl|NP_001006949.1|Plus1complement(<38662262..38662720) NW_876254 5-hydroxytryptamine receptor 1B HTR1B __SEG__ Chr12 {Canis lupus familiaris} MEAAGAPCAPPPPAGSQTGAPPANLSSAPHNCSAEGYIYQDSVALPWKVLLVILLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILAMPISTMYTV
TGRWTLGQVVCDLWLSSDITCCTASILHLCVIALDRYRTITDA
11 >lcl|NP_001012342.2|Plus1complement(17111051..17112109) NW_876272 C-C chemokine receptor type 5 CCR5 __SEG__ Chr20 {Canis lupus familiaris} MNYQTSTPYYDIDYGTSEPCQKVNVRQIAARLLPPLYSLVFIFGFVGNVLVVLILIDCKKLKSMTDIYLLNLAISDLLFLLTIPFWAHYAADQWTFGNKMCQLLTGLYYI
GFFTGNFFIILLTMDRYLAIVHAVSASKARTVTFGVVTSGIAWVVAVLASFPRIIFTRSQKEGSRFTCSPHFPPSQHHFWKNFQALKMSVLGLILPLLVMIIGYSAILKT
LLRCRNEKKRHKAERLIFVIMIVYFLFWAPYNIVLLLSTFQEFFGLNNCNSSNRLDQAMQITETLGMTHCCINPIIYAFVGEKFRRYLSLFFRKHIARRFCKCCPIFQGE
LPDRVSSVYTRSTGEQEISVAL*
12 >lcl|NP_001012397.1|Plus1complement(15359185..15360456) NW_876292 5-hydroxytryptamine receptor 1A HTR1A __SEG__ Chr2 {Canis lupus familiaris} MEGLSPRQGNNTTSSEGPFGTRGNATGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCD
LFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR
AARFRIRKTVKKAERKGADARSGVSPAPQPRKSVNGEPGGREWRQGPGSKAGGPLCTNGAVRRGDDGAALEVIEVHRVGSSKEHLPLPCEAGAIPCAPASFEKKNERNAE
AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIVRCKFCRRR*
13 >lcl|NP_001013438.1|Plus114710400..14711335 NW_876266 olfactory receptor-like protein OLF1 CfOLF1 __SEG__ Chr18 {Canis lupus familiaris} MDGNYTLVTEFILLGFPTRPELQIVLFLVFLTLYGIILTGNIGLMMLIRTDPHLQTPMYFFLSNLSFADLCFSSAIVPKMLVNFLSENKSISLYGCALQFYFSCAFADTE
SFILAAMAYDRYVAICNPLLYTVVMSRGICVWLIVLSYIGGNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTSVNEWLLSTYGSSVEIFCFIVIVISYYFI
LRSVLRIRSSSGRKKTFSTCASHLTSVAIYQGTLLFIYSRPTYLYTPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAAKRAVRLKVDSS*
14 >lcl|NP_001013440.1|Plus1complement(22320328..22321257) NW_876272 olfactory receptor-like protein OLF4 CfOLF4 __SEG__ Chr20 {Canis lupus familiaris} MELENDTRIPEFLLLGFSEEPKLQPFLFGLFLSMYLVTILGNLLLILAVSSDSHLHTPMYFFLANLSFVDICFTCTTIPKMLVNIQTQRKVITYESCIIQMYFFILFAGI
DNFLLTVMAYDRYMAICYPLHYMVIMNPQLCSLLLLVSWIMSALHSLLQTLMVLRLSFCTHFQIPHFFCELNQMIQLACSDTFLNNMMLYFAAILLGVAPLVGVLYSYFK
IVSSIRGISSAHSKYKAFSTCASHLSVVSLFYCTSLGVYLSSAAPQSTHTSSVASVMYTVVTPMLNPFIYSLRNKDIKGALNVFFRGKP*
15 >lcl|NP_001014304.1|Plus1complement(6730244..6731194) NW_876315 melanocyte-stimulating hormone receptor MC1R __SEG__ Chr5 {Canis lupus familiaris} SGQGPQRRLLGSLNGTSPATPHFELAANQTGPRCLEVSIPDGLFLSLGLVSVVENVLVVAAIAKNRNLHSPMYYFIGCLAVSDLLVSVSNVLETAVMLLVAAGALAAQAA
VVQQLDDIIDVLICGSMVSSLCFLGAIAVDRYLSIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFIAYYNHTAVLLCLVSFFVAMLVLMAVLYVHMLARACQHARGI
ARLHKRQHFIPQGFGLKGAATLTILLGIFFLCWGPFFLHLSLVVLCPQHPICGCVFQNFNLFLTLIICNSIIDPFIYAFRSQELRKTLQEVVLCSW*
16 >lcl|NP_001014306.1|Plus162906614..62907666 NW_876327 B1 bradykinin receptor BDKRB1 __SEG__ Chr8 {Canis lupus familiaris} MASRAPLELLPLNRSQLLPPNATTCDDAPEAWDLLHRVLPSVIIIICVCGLLGNLLVLAVLLRPRRRLNVAEMYLANLAASDLVFVLGLPFWAANISNQFRWPFGGLLCR
LVNGVIKANLFISIFLVVAISRDRYRALVHPMATRRRRQARATCVLIWVAGSLLSVPTFLFRSIEAVPELNNDSACVLLHPPGAWHVARMVELNVLGFLLPLAAIVFFNC
HILASLRGRPEVRGARCGGPPDGRTTALILTFVAAFLVCWTPYHFFAFLEFLTQVQVVRGCFWENFKDLGLQYASFFAFINSCLNPVIYVFVGRLFRTRVWDLFKQCAPR
RPPAVSWSHRKRVLQLFWQN*
17 >lcl|NP_001014309.1|Plus1complement(29138810..29139751) NW_876332 olfactory receptor-like protein DTMT OR1E2 __SEG__ Chr9 {Canis lupus familiaris} MTEKNQTVVSEFVLLGLPIDPDQRDLFYALFLAMYVTTILGNLLIIVLIQLDSHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLTQMYFFLFFGDL
ESFLLVAMAYDRYVAICFPLHYTTIMSPKLCFSLLVLSWVLTMFHAVLHTLLMARLCFCANTIPHFFCDMSALLKLACSDTQVNELVIFIMGGLILVIPFLLIITSYARI
VSSILKVPSAIGICKVFSTCGSHLSVVSLFYGTVIGLYLCPSANNSTVKETIMAMMYTVVTPMLNPFIYSLRNKDMKGALRRVICRKKITFSV*
18 >lcl|NP_001017439.1|Plus1complement(31681693..31682637) NW_876273 cOR10A3 olfactory receptor family 10 subfamily A-like cOR10A3 __SEG__ Chr21 {Canis lupus familiaris} MKRQNQSSVVEFILLGFSNFPELQEQLLGVFLAVYLVTLMGNAIIIVIIALEQTLHVPMYLFLQNLSVVDMSFSAVIMPEMLVVLTREKTSISFVSCFAQMYFILFFGGT
ECFLLGTMAYDRFVAICHPLSYPMIMNKRVFMKLVMFSWVSGIMVATVQTTWVFSFPFCGPNEINHLFCETPPVLELACADTFLFEIYAFTGTILIVMVPFVLILLSYIR
ILFAILRMPSATGRQKAFSTCASHLTSVTLFYGTASMTYLQPKSGYSPETKKLMSLAYTSLTPLLNPLIYSLRNSEMKKALMKLWRRRVDSHTF*
19 >lcl|NP_001017515.1|Plus1complement(51533323..51534264) NW_876253 cOR13F4 olfactory receptor family 13 subfamily F-like OR13F1 __SEG__ Chr11 {Canis lupus familiaris} MIKTNLTVISKFIFLGFTYYPKVEVIVFVLCLLMYLITLLGNIILISITILDSHLHKPMYFFLSNLSFLDIWYTSSALTPMLANFVLGKNTISFSGCAIQMYFSLAMGST
ECVLLSMMAYDRYVAICNPLRYPVIMNRRVCVQIAAGSWVTGCLTALVETMSVLHQSLCGNSIINHFTCEILAVLKLVCVDTSRVQLIMLLISVLLLPMPMLLICISYAF
ILSNILRISSVDGRSKAFSTCAAHLTVVVLFYGTALSMYLKPLAVDSQEIDKFIALVYAGLTPMLNPIIYSLRNKEVKAAVKKLLIRNPLCAF*
20 >lcl|NP_001017516.1|Plus1complement(5946959..5947912) NW_876260 olfactory receptor-like protein OLF3 cOR13M4 __SEG__ Chr16 {Canis lupus familiaris} MGTGNQTWVREFVLLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMYFFLTNLSLVDVSYATSIIPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGI
EFVLLAVMAYDRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCELLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQ
IISTILKIQSTEGRKKAFHTCASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYSVLTPMLNPMIYSVRNKEVKGAWQKLLGQLTGITSKLAT*
21 >lcl|NP_001017517.1|Plus130697728..30698672 NW_876273 cOR13N5 olfactory receptor family 13 subfamily N-like OR2D3 __SEG__ Chr21 {Canis lupus familiaris} MGKENQTFVTEFILLGLSQDLQTQILLFVLFLIIYLLTVLGNLLIIILIFMDSRLHTPMYFFLRNLSFADLCFSTSIVPQVLFHFLVKRKTISFLGCMTQIVVFLLAGCT
ECALLAVMSYDRYVAVCKPLHYSSIMTQKVCLQLAIGSWASGALVSLVDNTFTFQLPYQGQNIINHYFCELPALLKVASADTYSTEMAIFAMGVVMLLVPVCLILVSYWN
IISTVIQMQSGEGRLKAFSTCGSHLIVVVLFYGSGIFDYMRPNSKTTKEQDKMVSVFYTVVTPMLNPIIYSLRNKDVKGALRKLAGRKSFSQRQ*
22 >lcl|NP_001017518.1|Plus128980512..28981465 NW_876332 cOR1P2 olfactory receptor family 1 subfamily P-like cOR1P2 __SEG__ Chr9 {Canis lupus familiaris} MERGNQTSSFEFLLWGLSERPEQQNILFLLFLWIYVITVAGNLLIVLAIGTDARLHTPMYFFLASLSCADILFTSTTVPKALVNIQTQSRSISYTGCLVQLYFFLTFGDM
DIFLLATMAYDRYVAICHPLHYKMIMSRRRCTLLVTACWILTSLVAMTHTFLIFRLNFCSKKIIPDFFCDLGPLMKVSCSDTQVNELVLLFLGGAVILIPFILILVSYMH
IVSAILRVPSAQGRYKAFSTCGSHLAVVALFFGTVIRAYLCPSSSSSNSIEEDTAAAVMYTVVTPLLNPFIYSLRNKDMKCALGRFLRGKVFFSWGQ*
23 >lcl|NP_001017519.1|Plus116284144..16285160 NW_876266 cOR4S3 olfactory receptor family 4 subfamily S-like OR4S2 __SEG__ Chr18 {Canis lupus familiaris} MENNVTEFIFMGLSQNEKVQQLCFFLFLFFYMILMTGNFLIIMTIQRSSNLNSPMYFFLSFLSFVDICYSSVTAPKLIIDSYAKVKSISFVGCMAQLFFCHLFGCTEIFI
LTVMAYDRYVAICKPLRYMTIMDRKVCSILVATCWLGGFVHSFIQTILTVQLPFCGPNLIDHYFCDVHPLLKLACIDTKVVGLIVIANSGMISLSCFVILVGSYIVILLS
FKTRSSEGRRKALSTCASHIIVVILFFVPCLFIYLRPSTTFTEDKMVAVFYTIITPMLNPLIYTLRNMEVKNAMKRLWMEKLVVRNKRGSGVNLNGIDRASVVPVSKRIA
GNKSVIIP*
24 >lcl|NP_001017521.1|Plus129005254..29006234 NW_876273 cOR52P3 olfactory receptor family 52 subfamily P-like cOR52P3 __SEG__ Chr21 {Canis lupus familiaris} MPRAFVQSPNHTNLDPSVFFLLGIPGLEQFHLWLSLPVCCLGTATIVGNITILVVVATEPALHKPVYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHISASACLAQMFF
IHAFCMMESTVLLAMAFDRYVAICHPLRYATILTDTIIARIGVVAMVRGSMLMLPCPFLIGRLSFCQSHVIPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFC
IGLSYVFIARAVLRLSSHEARSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHIHILLANVYLLFPPALNPMVYGVKTKEIRERVIRVFQRGQGTGLKVPE*
25 >lcl|NP_001017522.1|Plus129092244..29093203 NW_876273 cOR56B2 olfactory receptor family 56 subfamily B-like cOR56B2 __SEG__ Chr21 {Canis lupus familiaris} MFQDLRHSNISKFQVSEFILMGFPGIHTWQHWLSLPLALLYLLALTANILILIIIKQEATLHQPMYYFLGILAVVDMGLATTIMPKILAILWFSAKAISLPECFAQMYVI
HCFVAMESGIFVCMAIDRYVAICQPLRYPSIVTDSFVVKATVFMALRNSLATIPVPVLAAQRHYCSKNQIEHCLCSNLGVTRLSCDDRTINSIYQVLLAWTLMGSDLGLI
FLSYALILHSVLKLNSAEAASKALSTCTSHLILILFFYSVIIVISITHSATMTLPLIPVLLNVLHNVIPPALNPMVYALKNKDLRQGFYKVLNLYNKGN*
26 >lcl|NP_001017531.1|Plus1complement(14270006..14270965) NW_876266 cOR8U2 olfactory receptor family 8 subfamily U-like OR8U1 __SEG__ Chr18 {Canis lupus familiaris} MVQRNCTQVTEFILMGLTDRQELKMPLFVAFLSIYLFTVVGNLGLILVIRTDSRLNTPMYFFLSNLAFVDFCYASVITPKMLGNFLYKQNVISFNACAAQLGCFLAFMTA
ECLLLASMAYDRYVAICNPLLYMVVMSPGICIQLVAVPYSYSFLVALFHTILTFRLSYCHSNIINHFYCDDMPLLRLTCSDTHSKQLWIFACAGIMFISSLLIVFVSYTY
IISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDALKKVIISRNQAFMFMKLKK*
27 >lcl|NP_001017532.1|Plus1complement(14364034..14364975) NW_876266 cOR8V11 olfactory receptor family 8 subfamily V-like OR8K3 __SEG__ Chr18 {Canis lupus familiaris} MAKHNLTVLNEFILMGITDKPELQAPLFGLFLIIYLISVVGNLGMIVLTKVDARLQTPMYFFLRHLAFTDLGYSTTIGPKMLVSFFLEENTISYYLCATQGAFYMIFIIS
ELFILTAMSYDRYMAICNPLLYPVIMSQKVCQVLVAIPYLYSIFVSLFVTVKIFSSFFCGYNVVNHFYCDCLPLLSLLCSNTHEIELMILIFSVFDVSSSLLIVLVSYLL
ILVAIVRMNSAEGRLKAFSTCGSHLTVATVFYGTLIFMYVQPESSHSFDTDKVASIFYTLIIPMLNPLIYSLRNKDVKYALHRIWKKICNTFS*
28 >lcl|NP_001017533.1|Plus1203908..204870 NW_876284 cOR9K3 olfactory receptor family 9 subfamily K-like cOR9K3 __SEG__ Chr27 {Canis lupus familiaris} MGDRGTSNRSEVTDFILVGFRVRPELYILLFLLFLLVYAMILLGNVGMVAVILTDPRLNTPMYFLLGNLSFIDLFYSSVIAPKAMINFWSESKSISFAGCATQLFLFALF
IVAEGFLLAAMAYDRFIAICNPLLYSVQMSTRLCIQLVAGSYFCGCISSVLQTSMTFSMSFCASRAIDHFYCDDRPLQRISCSDLYFHKIVSFLLCSIIILPTIIVILVS
YMYIVSTVLKIRSTEGRKKAFSTCSSHLGVVSVLYGAIIFMYFIPDRFPELSKVASLCYTLVTPMLNPLIYSLRNKDVKEALRKILGKKIFLFNSILTVI*
29 >lcl|NP_001020791.1|Plus110855132..10856409 NW_876251 somatostatin receptor type 3 SSTR3 __SEG__ Chr10 {Canis lupus familiaris} MDTLGYPASVPTTLEPGNTSSAWPLDATVGNVSAAPSVAGLAVSGVLIPLVYLVVCVVGLLGNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYW
PFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSVAVWVASAVVVLPVVVFSGVPHGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPL
LVICLCYLLIVVKVRSAGRRVRAPSCQRRRHSERKVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLL
RPSRRVRSQEPAGGPPEKTVEEQGEDREGEDREGEDGAGKQGEGKGMNGRVSLITQPGTSGQERPPSGKASKDKQPLPLEASAADKPGALHISYL*
30 >lcl|NP_001026801.1|Plus12856589..2857266 NW_876329 suppressor of cytokine signaling 3 SOCS3 __SEG__ Chr9 {Canis lupus familiaris} MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRS
TQPVPRFDCVLKLVHHYMPPPGAPSFPAPPTEPSSEVSEQPPSQPLPGNPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQ
YDAPL*
31 >lcl|NP_001026986.1|Plus114421137..14422312 NW_876327 somatostatin receptor type 1 SSTR1 __SEG__ Chr8 {Canis lupus familiaris} MFPNGTASSPSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSV
PFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLV
GFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFK
RSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGAVFRNGTCTSRITTL*
32 >lcl|NP_001026987.1|Plus1complement(7000327..7001436) NW_876329 somatostatin receptor type 2 SSTR2 __SEG__ Chr9 {Canis lupus familiaris} MDMEYELLNESHTWVSPPFDLDGSVVAANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPF
GKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMVNVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVP
LTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLV
KVSGPDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI*
33 >lcl|NP_001033695.1|Plus117240703..17241770 NW_876272 C-C chemokine receptor type 1 CCR1 __SEG__ Chr20 {Canis lupus familiaris} METTAPSRDYDQSTMYDYEGITPCQKGEVRTFGAQLLPPLYSLVFIIGLVGNILVLLVLMQYRRLKSMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWIFGDGTCKLLS
GLYYTGLYSEILFIILLTVDRYLAIVHAVFALRVRTVIFGIISSIGAWVLALLASIPGFYFSKTQRELSHTTCSLHFPYEDLKAWKQFQALKLNLLGLVLPLSVMIICYT
AIIQILLKRPNEKKAKAVRLIFVIMIVFFLFWTPYNLTVLVSAFQDSLFTDECRQSKQLDLAMQVTEVIAYTHCCVNPVIYAFVGERFRRYLHQLFHRLVARHLAKRFPF
LSTDRLERASSMSPSTAEHELSAGF*
34 >lcl|NP_001041572.1|Plus130137420..30138622 NW_876266 G protein-coupled receptor 44 GPR44 __SEG__ Chr18 {Canis lupus familiaris} MSANATLKPLCPILEQMSRIQSHSNSSMRYMDHASVLLHGLASLLGLTENGLILFVVGCRMRQTVVTTWVLHLALSDLLATATLPFFTYFLAVGHSWELGTTFCKLHSSI
FFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAMAHRVCLGLWALAVLNTVPYFVFRDTIPRLDGRIMCYYNVLLLNPGPDRDATCNTRQAALAVSKFLVAFVVPLA
IIASSHFLVSAQLCHRGRRRPSRFVRLVAAVVAAFALCWGPYHVFSLLEARAHADPSLRPLVWRGLPFVTSLAFLNSVINPLLYVLTCPDVLRKLRRSLRSVLESVLLDD
SELGGPGSGRRRRSSGPRQAPGARAPPPPSGPARLLAWLQGGRGRSAQRARSRSQDERGPLNRALSTASG*
35 >lcl|NP_001074193.1|Plus116140844..16141842 NW_876269 melanocortin receptor 4 MC4R __SEG__ Chr1 {Canis lupus familiaris} MNSTLQHGMHTSLHFWNRSTYGQHGNATESLGKGYPDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNST
DTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVSGILFIIYSDSTAVIICLITMFFTMLALMASLYVHMFLMAR
LHIKRIAVLPGTGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSS
RY*
36 >lcl|NP_001077100.1|Plus129158411..29159373 NW_876273 cOR52N9 olfactory receptor family 52 subfamily N-like cOR52N9 __SEG__ Chr21 {Canis lupus familiaris} MCGENSSSLAPGFFVLNGIPGLEAAHTWIALPFCFMYIITVLGNCGLIYLISHEEALHQPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIHFNACLAQMFFVHMLT
GMESGVLMLMALDRYVAICHPLRYSTILTNPVITKAGLATFLRGVLLILPFTFLTKRLPYCRSNFIPHTYCDHMSVAKVSCGNFKVNAIYGLLAALLIGGFDMFCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPALFTIFTHRFGGQSIPHHVHILIANLYLMLPPTLNPIVYGVKTKQIQEGVIKLFFKEKDVLVMK*
37 >lcl|NP_001077101.1|Plus127573405..27574346 NW_876273 cOR51P3 olfactory receptor family 51 subfamily P-like cOR51P3 __SEG__ Chr21 {Canis lupus familiaris} MSVFNSSVLYPRFLLTGLSGLESRYSLISIPIFLVYATSIVGNITILVIIRTESSLHQPMYYFLSMLALTDLGLSTTTLPTMFSVFWFHAREISFNACLVQMYFIHVFSI
IESAVLLAMAFDRFVAIREPLRYVTILTNGVIIGIGLAIAGRALALVFPASFLLKRLQYRPVNILSYPFCLHQDLIKTTVSSRWVSSIYGLMVVICSMGLDSVLLLLSYI
LILGTVLSIASKTERIKALNTCISHICAVLTFYTPMIGLSMIRRYGQNASPIVHVLMANVYLLVPPLMNPIVYSVKTKQIRDRILRKFKQQKA*
38 >lcl|NP_001108208.1|Plus1926888..928231 NW_876320 selenophosphate synthetase 2 SEPHS2 __SEG__ Chr6 {Canis lupus familiaris} MAEAAATGAGGEVAAAAEGSGSAGLSLGRGFSSYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQETLLKLLAGLTRPEVRPPLGLGLVGSHEEAAQEGGLPAGADPNPT
FPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMTEEEREKITPLMIKGFRDAAEEGGTAVTGGQTVVNPWI
IVGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKINMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAK
QQRNEVSFVIHNLPIIAKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATATALAPDNSN
ASSEPSS*
39 >lcl|NP_001116803.1|Plus136822776..36824914 NW_876327 zinc finger and BTB domain-containing protein 1 isoform 1 ZBTB1 __SEG__ Chr8 {Canis lupus familiaris} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGSEANRWCAEPSSTVNTPHNREPDEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRSYHRIVDIRDGKDGSIKAEFGEKESSKAFSTQTDKYRGDTSQAADDSTSTTGSRKSTMESEVASEEKSRAADRKRIIIKMEP
EDIPTDELKDFNIIKVTDKDCNESTDNDELEDEPEEPFYRYYVEEDIGIKKSGRKMLKPRMSISADERGGLENMRPPNNSSPVQEDTENASCELCGLTITEEDLSSHYLA
KHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSIQKKQLFKHSACPFRCPNCGQRFETENLVVE
HMSSCLDQDVFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAGE
TICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
40 >lcl|NP_001121536.1|Plus1complement(2451870..>2452319) NW_876274 motilin receptor MLNR __SEG__ Chr22 {Canis lupus familiaris} RGPRAGGRWS*RWRPPCFAVAVVLAFLVCWLPFHVGRIIYINTEDSRMMHFSQYFNIVALQLFYLSASINPILYNLISKKYRAAARKLLLPRRPTRRRVCRSGAVEGGPG
RAAAGLAETGPHGHTAASPSAARQVASRHDPGTSGKTGV*
41 >lcl|NP_001128596.1|Plus141474179..41475150 NW_876277 melanocortin receptor 3 MC3R __SEG__ Chr24 {Canis lupus familiaris} MNASCCLLSAQPTLPNSSEHLAAASFGNQSGSGFCEQVFIKPEVFLALGIVSLLENILVILAVARNGNLHSPMYFFLCSLAVADMLVSVSNALETVMIAIVNSNYLTFED
RFVQHMDNVFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALAWIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMLLLMGTLYVHMFLFARLHVQR
IAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCVCYTAHFNTYLVLIMCNSIIDPLIYAFRSLELRNTFKEILCSCNGMNLG*
42 >lcl|NP_001138703.1|Plus16751276..6752364 NW_876282 G-protein coupled receptor 81 GPR81 __SEG__ Chr26 {Canis lupus familiaris} MDNGSCCLIEGDPISQVMPPLLILAFVLGALGNGMALCGFCFYMKTWKPSTIYLFNLAVADFLLMICLPFRTDYYWRHRQWAFEDIPCRVALFMLAMNRAGSIIFLTVVA
VDRYFKVVHPHHVLNTISNRTAAGIVCALWIMVILGTLYLLMENHLCVHEKTISCESFIMESANGWHDIMFQLEFFLPLGIILFCSFRIIWSLKQRRQLARQTRMKKATR
FIMVVAVVFITCYLPSVSARLYFLWTVPSSACDPSVHVALHITLSFTYMNSMLDPLVYYFSSPVFPKFYTKLKIRGLRPKSPGHSKTQRPEEMPIPKLCRKSCVRVASSF
QSQSNEQQDLQMCGMALKQADRQNPRRTDKQT*
43 >lcl|NP_001139615.1|Plus136290603..36292972 NW_876307 toll-like receptor 1 TLR1 __SEG__ Chr3 {Canis lupus familiaris} MKTNPSIFQFAIIFILILEIRIQLSEESDFLVNRSKAGLFHIPKDLSLKTTILDISQNYISELQTSDILSLSKLRILIVSYNRIQYLDISVFKFNQELEYLDLSHNELGR
ISCHPTVNLKHLDLSFNAFDDLPICKEFGNMSQLEFLGLSATQLQKSSMLPIASLHIRKVLLVLGDTYGKKEDPESLQKLNTESLHIVFPIRKEFSFTLDVSVSTAVSLE
LSNIKCVPDGHGWSYFQNVLSKLQKNSRLSSLTLNNIETTWNFFIMLLQLVWHTSIEYFSISNVKLQGYPDFRDFDYSDTSLKALSIHQVVSNAFNLPQSYIYKIFSNMN
IQNFTVSGTHMVHMVCPSQISPFLHLDFSNNLLTDIVFKNCRNLIKLETLSLQMNQLKELASIAQMTNEMKSLQQLDISQNSLRYDENEGNCSWTRSLLSLNMSSNILTD
SVFRCLPPKVKVLDLHDNRIRSIPKPIMKLEDLQELNVASNSLAHFPDCGTFNRLSVLIIDSNSISNPSADFLQSCHNIRSISAGNNPFQCTCELREFVQSLGQVASKVV
EGWPDSYKCDSPENYKGTLLKDFHVSPLSCNTTLLLVTIGVAVLVFTVTVTALCIYFDLPWYLRMVFQWTQTRRRARNTPLENLQRTIQFHAFISYSGHDSAWVKSELLP
NLEKEELRICLHERNFIPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHEGSNNLILILLEPIPQYSIPSSYHKLKNLMAQRTYLEWPKEKSKHGL
FWANLRASINIKLREQAKK*
44 >lcl|NP_001166015.2|Plus120074989..20076101 NW_876258 retrotransposon-derived protein PEG10 isoform 2 PEG10 __SEG__ Chr14 {Canis lupus familiaris} LGPDCPPPPPPPPPNGPSSSSSSCSSSSSSSSSSRSAPRGQYIPNLAERRRDDLSEEINNLREKVMKQSEENNNLQNQVQKLTEENTSLREQVEPAPQDEEDDLELRGAA
AAAAPPTPLEEECPDDLPEKFDGNPDMLVPFMAQCQLFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMTEMKHVFEDPQRREAAKRKIRRLR
QGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGLSDHIQAELSRLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHITSHHQVDPTEPVGGARMRLTQEE
KERRRKLNLCLYCGNGGHYADNCPAKASKASPAGNSPAPL*
45 >lcl|NP_001166598.1|Plus136316669..36319092 NW_876307 toll-like receptor 10 TLR10 __SEG__ Chr3 {Canis lupus familiaris} MKRIRSIYIFCSIAISVQGWASKLPEERELTTNCSNMSLRKIPADLTPTTTTLDLSYNLLSQLQSSDFRSVSKLKVLILCHNRIQELNIKIFEFNRELRYLDLSYNRLKI
VTWYSLAGLRHLDLSFNDFDTVPICEETGNMSHLEILGLSGAKIQKSNFQKIAHLHLKTVFLGLRSLSHYEEGSLPILNTTKLHIVLPMNTNFWVLLHDGIKTSKILEMT
NIDGKSQFASYGTQKNLTLENSKTSILLLNKVDLLWDDLLLIFQFVWHTSVECFQIQHLTFGGKVYLDHYSFDYSNTVMRTIKLEHVQFRIFYIPQERVYLLFTKMDIEN
LTISDAQMPYMLFPIYPTRFQYLNFANNILTDDLFKQPIQLPHLKTLILKGNKLETFSLVSFFANNTSLKHLDLSQNLLQHENGENCFWPETLITMNLSSNKFADSVFRC
LPRNIQILDLNNNKIQTVPKDIIHLKSLQELNLAFNFLTDLPGCSHFRKLSILNIEMNLILSPSLDFFQSCQEVKILNAGRNPFRCTCELRDFIQLEEYSEGMMIGWLDS
YICEYPLTLKGTLLKDVHLPELSCNTTLLIVTIVVIMLVLGMAVAFCCFYFDLPWYLRMLGQWTLQRIRKTTQEQLKRNVQFHVFIAYSEHDSTWVKHELIPNLEKKEKL
ICLHEGNFDPGKSIIENIMNCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHSLFHENSDYIIFILLEPIPLYCIPTKYPKLKALMEKKAYLEWPKDRRICGLFWANLRAA
INANLLETREMYELQTFVGLNEESQGSAISLIRTDCL*
46 >lcl|NP_001180602.1|Plus147302505..47303626 NW_876276 P2Y purinoceptor 1 P2RY1 __SEG__ Chr23 {Canis lupus familiaris} MSAEALWPPLPNGTAAFPGGQGGPWGNSTASAAAAAAAPFTCALTKTGFQFYYLPAVYILVFVTGFLGNSVAIWMFARHMRPWSGISVYMFNLALADFLYVLTLPALIFY
YFNKTDWTLGDAMCKLQRFIFHANLYGSILFLTCISAHRYSGVVYPLRSLGRLQKRTAVHVSLLVWLVVALAISPILFYSGTQVRRNGTVTCYDSTSDEYLRSYFVYSMC
TTVAMFCVPLVLILGCYGLIVRALIYKDLDDSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPDMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDT
FRRRLSRATRKASRRSEANLQSKSEDMTLNILSEFKQNGDTSL*
47 >lcl|NP_001182773.1|Plus1complement(27083713..27084792) NW_876311 histamine H2 receptor HRH2 __SEG__ Chr4 {Canis lupus familiaris} MISNGTGSSFCLDSPPCRITVSVVLTVLILITIAGNVVVCLAVGLNRRLRSLTNCFIVSLAITDLLLGLLVLPFSAFYQLSCRWSFGKVFCNIYTSLDVMLCTASILNLF
MISLDRYCAVTDPLRYPVLITPVRVAVSLVLIWVISITLSFLSIHLGWNSRNETSSFNHTIPKCKVQVNLVYGLVDGLVTFYLPLLVMCITYYRIFKIARDQAKRIHHMG
SWKAATIGEHKATVTLAAVMGAFIICWFPYFTVFVYRGLKGDDAINEAFEAVVLWLGYANSALNPILYATLNRDFRTAYQQLFRCRPASHNAQETSLRSNSSQLARNQSR
EPMRQEEKPLKLQVWSGTEVTAPRGATDR*
48 >lcl|NP_001184105.1|Plus123681552..23684128 NW_876305 toll-like receptor 5 TLR5 __SEG__ Chr38 {Canis lupus familiaris} MGRQLGRALGLLLVAGAVAAASCCVADGRRALYRSCNLSQVPPVPSTTEILLLSFNYIRAVTRASFPLLERLQLLELGTQQTPFSVDREAFRNLPNLRTLDLGNSRVDFL
HPDAFQGLPHLQELRLFACGLSDVVLTDGYFRNLGALLRLDLSKNQIGSLELHASFRELGSLRSVDFSLNRIPAACEQGLRPLQGKALSLLNLAANGLYSRAPVDWGRCG
NPFRNVVLETLDVSNNGWTADVTGNVTRAIGGSQISSLVLAHHIMGQGFGFRNIRDPDRSTFAGLAGSSVLRLDLSHGFVFSLNARLFEVLGDLKLLDLAHNKINRIAGE
AFHGLGSVQVLNLSHNLLGELYDSDFSGLAEVAYIDLQHNHIGIIQDQTFRFLGALRTLDLRDNALKTVSFVPSIDTIFLGNNKLETVSHMDLTASFLELSDNRLEDLGD
LYSLLRVPALQVLILNRNRLSACRGGHGPTGSVGPERLFLGSNMLQLAWETGRCWDVFRGLPRLRVLHLNHNYLAALPPGLLRDLTALRGLDLSANRLSTLSRGDLPAAL
EVLDVSRNQLLSLDPGLLAPLRAVDLTHNKFICGCELRPLVRWLNRTNVTVFGSRADVRCAYPSLLAGTPLSSVSMEGCDDEEALRTLTFSLFIFSTVGVTLFLLAVLVA
AKLRGLCFLCYKAARRLLPAGPAEDGAPDAYQYDAYLCFSGRDFEWVQRALLRHLDAQYSSRNRLNLCFEERDFVPGREHIANIQDAVWSSRKVVCLVSRHFLRDGWCLE
AFAAARSRCASHLDGALVLVVVGSLSQYQLRRHPAIGGFVRQRRYLRWPEDLQDVGWFLDTLSRHILQEQRGARGDGGIPLRTVAAVA*
49 >lcl|NP_001191931.1|Plus129105159..29105365 NW_876332 guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 GNG10 __SEG__ Chr9 {Canis lupus familiaris} MSSGASVNALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALF*
50 >lcl|XP_003431488.1|Plus116146469..16147407 NW_876250 olfactory receptor 6C68-like LOC100684655 __SEG__ Chr10 {Canis lupus familiaris} MRNQTALTTFILLGLTEDPQLKILLFMFLFLSYMLNVSGNLTIIILTLIDSHLKTPMYLFLQNFSFLEISFTTACVPRFLYSISSGDKSITYNACVSQLLFTDLFAVTEF
FLLATMSYDRYVAICKPLHYMTIMSRRVCKNFIVFCWVAALIIILPPISLGLGLEFCDSNIIDHFCCDASPILKISCSDTWLIEQMVIVCAVLTFIITLMCVVLSYIYII
GTILRFPSAQQRKKAFSTCSSHMIVVSITYGSCIFIYVKPSAKDEVAINKGISLLITSISPMLNPFIYTLRNKQVKKAFHDSIKKIAFLSKM*
51 >lcl|XP_003431489.1|Plus116179622..16180557 NW_876250 olfactory receptor 6C2-like LOC100684719 __SEG__ Chr10 {Canis lupus familiaris} MRNGTITTFILLGLTDDPELQVLIFIFLFLTYTLSITGNLTIIILTFVDPHLKTPMYFFLKNFSFLEISFTSAVIPRYLYSIATGDNVITYNACVIQVFFTDLCGVSEFF
LLAAMSYDRYVAICKPLHYVIIMSNSVCRILNICCWVAGLCIIIPPLSLGLNLKFCDSNIIDHFGCDAFPLVKISCSDTRFMEWTVIICAILTLNMTLTCVVLSYAYIIK
TIFRFPSVQQRKKAYSTCSSHMIVVSITYGTCIFIYMNPTAKEKVTINKVVSLLIFSISPTLNPFIYTLRNNQVKKAFEDSIKRIALLSTK*
52 >lcl|XP_003431652.1|Plus151435014..51435997 NW_876253 olfactory receptor 13F1-like LOC100685319 __SEG__ Chr11 {Canis lupus familiaris} MFQANLTYVTHFFLLGFSHYPKVEVIVFVLCLLMYLITLLGNIILISITILDSHLHKPMYFFLSNLSFLDIWYTSSAFTPMLANFVSGEYTISFLGCAAQMYFSLAMGST
ECVLLSMMAYDRYVAICNPLRYPIIMNKRVCVQIAAGSWVTGCLTTLVETVYVLQLSLCGNNTINHFACEILAVLKLVCVDTSMVELIMLVITIFLLPMPMLLICISYAF
ILSNILRISSVDGRSKAFSTCAAHLTVVVLFYGTALSMYLKPSAVDSQEIDKFIALVYGGLTPMLNPIIYSLRNKEVKAAVKKLLIRNPFGTVLISALNNIGASTLP*
53 >lcl|XP_003431653.1|Plus151499236..51500195 NW_876253 olfactory receptor 13C8-like LOC100685557 __SEG__ Chr11 {Canis lupus familiaris} MERTNDSMLTEFVLVGLSAHPKLQTVFFVLVLWMYLMILLGNGVLISVIIYDSHLHTPMYFFLCNLSFLDICYTSSSVPLILDNFLRVRKRVSFSGCMVQMFLSFAMGAT
ECVLLGMMALDRLVAICYPLRYPVIMSKNTYMLMAAGSWVTGFIDSVVQTSLAMQLPFCANNVINHFVCEILAILKLACADISINVISMAGSNLMGLVIPLLVISISYIF
ILTTILKISSTEGKRKAFSTCSAHLTVVIIFYGTLFFMYAKPKSKSSVGANNQDITEALISLFYGVMTPMLNPLIYSLRNKDVKAAVKNMLGRRNSDGI*
54 >lcl|XP_003431654.1|Plus151526149..51527087 NW_876253 olfactory receptor 2S2-like LOC100685645 __SEG__ Chr11 {Canis lupus familiaris} MDRTNWTEIEFILQGLSEYPRVEKLLFVMCLMMYLVILLGNSTLIILTLLDSRLHTPMYFFLGNLSFLDIWYTSSFIPSMLIHFLSQKKTISFARCVIQMSASYTMGSTE
CVLLAVMAYDRYVAICNPLRYSIIMSKALCIQMAALSWGLGFLNSLTETVLAIRLPFCGKNVINHFACEILAFVKLACTDISLNEITIMLGNVIFLFSPLLLICISYIFI
LSTVLRINSVEGRKKAFSICSAHLTVVTLFYGTILFMYMKPKSKDSAFNKLIALFYGVVTPMLNPIIYSLRNTEVHGAMRKLMTKHSYWRKG*
55 >lcl|XP_003431655.1|Plus1<51611653..51612606 NW_876253 olfactory receptor 13D1-like LOC100685888 __SEG__ Chr11 {Canis lupus familiaris} HGHLKMGNYSAVTEFFLVGLSQYPELQLFLFMLCLIMYVIILLGNSLLIISSILDSRLHTPMYFFLGNLSFLDICYTSSFIPTMLTIFRSEKKSISFIGCALQMVVSLGL
GCTECVLLAVMAYDRYVAICNPLRYPIVMNRVLYVHMAAWSWIIGCLNSLVQTVLIMLLPFCGNNVIDHLTCELLALLKLICSDISMNVLIMTVASILFLVVPLLLIFIS
YVFILSTILRLNSTEGRKKAFSTCSAHLAVVVLFYGSALFMYMKPKSKDTKTIDEIIGLSYGVVTPMLNPIIYSLRNKEVKEAMKKVLSRHFHSRKI*
56 >lcl|XP_003431694.1|Plus131762254..31764107 NW_876253 kelch-like protein 9-like LOC100688162 __SEG__ Chr11 {Canis lupus familiaris} MKVSLGTGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRVEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKKIIDFI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
57 >lcl|XP_003431707.1|Plus1complement(55211047..55212306) NW_876254 probable G-protein coupled receptor 63-like LOC100685057 __SEG__ Chr12 {Canis lupus familiaris} MVFSAVLTASHTGATNTTFVVYENTYVNITVPPPFQHPGIGPLLRYSMETMASTGMSSLTVNSTAVPPTPAVFKSLNLPLQIILSAIMIFILFVSFLGNLVVCLMVYQKA
AMRSAINILLASLAFADMLLAVLNMPFALVTILTTRWIFGKLFCRISAMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKILIAVSWAASFCIAFPLAVGNPDL
QIPSRAPQCVFGYTTNPGYQAYVILISLVSFFIPFLVILYSFMGILNTLRHNALRIHSYPEGICLSQASKLGLMSLQRPFQMSIDMGFKTRAFTTILILFAVFIVCWAPF
TTYSLVATFSKHFYYKHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKFLPRLPGHTRRRIRPSAVYVCGEHRTVV*
58 >lcl|XP_003431756.1|Plus13969165..>3969359 NW_876254 guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5-like LOC100685560 __SEG__ Chr12 {Canis lupus familiaris} MNGSSSIATMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVC
59 >lcl|XP_003431892.1|Plus1complement(1522335..1523279) NW_876258 olfactory receptor 2W3-like LOC100684725 __SEG__ Chr14 {Canis lupus familiaris} MGGTNESTQGNFILLGFSDRPYLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMYFFLTHLSFLDLGFTTSSIPQLLYNLNGHDKTISYTGCAIQLFLFLGLGGV
ECLLLAVMAYDRFVAVCKPLHYMVIMNPRLCVGLVSVAWSCGVANSLAMSPVTLHLPRCGHRSVDHFLCEVPALIRMACVNTAAIEGTIFVLAVGIVLSPLVFILVSYSY
IMRAVLHIQSVSGRQKAFNTCGSHLTVVSLFYGNIIYMYMQPGNSSSQDQGKFLTLFYNIVTPLLNPLIYTLRNKEVKVALQRLLLGKREVGKC*
60 >lcl|XP_003431894.1|Plus11909091..1910050 NW_876258 olfactory receptor 2AJ1-like LOC100685197 __SEG__ Chr14 {Canis lupus familiaris} MEIRNETLSTDFILLGLFSGMKHTRLLVSVVLLIYTIAITGNTTLIFLIWVDPHLHTSMYFLLSQLSLIDLAFISSIVPKMMVNFFSGKKNISLVGCGTQIFFTLTLGIA
ECLLLTLMAYDRYVAICNPLKYSIIISPRVSQRMAIGSWVGGTLASLAHTAYAMHFPLCGPRELHNFFCEVKAILKLSCEDISAYEKGVVVTSIVVVLLPVSFILTSYIL
IFLQVLRINSHEGRIKALATCSSHLTVVIFYYGPAMLIYMRPGSSHTPILNQALFMFDTVLTPMLNPIIYSLRNREVVDSMKKVMGKFSIQNRFARFNE*
61 >lcl|XP_003431895.1|Plus11945825..1946763 NW_876258 olfactory receptor 2T27-like LOC100685350 __SEG__ Chr14 {Canis lupus familiaris} MDKRNESSSTDFILLGLFPGIKHINLLVSVILLIYTVALTTNSILILLIWVDSHLHTPMYFLLSQLALMDLTLISSTVPKMASDFFSVKRTISQVACGTQIFFFLTVGIA
ECIIITLMAFDRYVAICKPLRYTLIMSQKVCLQMATVSWAGGALISLMHTAYAMHFPICGSREISHFLCEVMAILKLACEDISAYEKAVVMTSIVVLLIPLSFILSSYTL
IFLSVLRMNSLEGRNKALATCSSHLTVVSLYFGPAMLVYMRPSSYHSPKLDQVLFMLGAILTPMMNPLIYSLRNKEVVGVLRNMLGSCLTSH*
62 >lcl|XP_003431896.1|Plus12173711..2174655 NW_876258 olfactory receptor 2T33-like LOC100685834 __SEG__ Chr14 {Canis lupus familiaris} MEKSNTTIDFILLGLFNHTRSHLFLFIVVMTIAIASLNGNALILLLILLDSRFHTPMYFLLSQLSLMDMTLVSTIVPKMAADYLSGKKSISPAGCGLQIFVSLTLGGGES
FLLASMSYDRYVAVCHPLRYPVLMSWQLCLRMTVGSWFLGAADGLMQAAATLSFPFCRANEIDHFFCEAPILVRLACADTSVFENVMYICCVLMLLVPFSLILTSYSLIL
SSVLQMRTTEARKKAFSTCSSHLSVVGLFYGAAIFIYMRPKSYRSDNHDKVVSAFYTIFTPVLNPLIYSLRNSEVKGALKRWLRKCANVKPQYT*
63 >lcl|XP_003431897.1|Plus12222921..2223859 NW_876258 olfactory receptor 2T33-like LOC100686002 __SEG__ Chr14 {Canis lupus familiaris} MNIWNTTSDFILLGLFHHTEAHLFLFSMVLTIAFGSLMGNALMILLIHQDVRLHTPMYFLLSQLSLMDMMLISTIVPKMAADYLSGKKSISPAGCGLQIFFFITLEGSEC
FLLASMSYDRYVAVCHPLRYPVLMSWQLCLRMTVGSWSLGAADGLMQAAATLSFPFCGAHEINHFFCEAPTLVRLACADTFVFEYVMYICCVLMLLVPFSLILISYSLIL
AAVLQMHSREARKKAFATCSSHLSVVGLFYGAAIFIYMRPKSYRSANHDKIVSVFYTIFTPLLNPIIYSMRNSEVKGALRKCMGQCAALHHK*
64 >lcl|XP_003431899.1|Plus1complement(2662229..2663191) NW_876258 olfactory receptor 2T4-like LOC100686566 __SEG__ Chr14 {Canis lupus familiaris} MENTTWMANYTVRSDFELVGLFSQSKHPAVLCVVIFLAFLMALSGNTILILLIHCDAHLHTPMYFFITQLSLMDVMYISVTVPKMLMDQVMGVNKISAPECGMQMFFYLT
LGGSEFFLLAAMAYDRYVAICHPLRYPILMNHRVCLLLVSSSWILGSVDGFMLTPVTMTFPFCRSREIHHFFCEVPAVMKLSCSDTSLYETLMYLCCVLMLFITVTVILS
SYSFILFTIHRMNSAEGRKKAFATCSSHMMVVISFYGASVYTYMLPTSYHTPEKDMIVSVFYTILTPVLNPLIYSLRNKDVTRGLKKMLNVGSVFQETLK*
65 >lcl|XP_003431900.1|Plus1complement(2734204..2735148) NW_876258 olfactory receptor 14I1-like LOC100686790 __SEG__ Chr14 {Canis lupus familiaris} MDNLTEVTEFLLMGFSDICELQILHAGLFLLIYLTAVVWNVLIMIIITFDQYLHRPMYFFLKNLSFLDLCYVSVTVPKSIHSSLTHSNSISYLGCVAQVYFFFAFASAEL
AFLTVMSYDRYVAICHPLQYEAIMTSEKCHHIAAIAWLSCFIYASVHTGNIFWEPISRYRKIHQFFCDISHVLALVSHEVFFAEFVSLALSSCFVLVCFVLMIISYIQIF
STVLRIPSVESRAKAFSTCSPQLIVIMLFLTTGLFGALGPIAKTSSIQDLVIAVAYTVLPPFLNPIIYSLRNKEIKAAIWRIFEKINSLQIRNN*
66 >lcl|XP_003431901.1|Plus12433180..2434139 NW_876258 olfactory receptor 2T4-like LOC100687351 __SEG__ Chr14 {Canis lupus familiaris} MDNKTWMISDSGQSDFILVGIFSQSKHPTFLCVIIFIVFLLVLSGNSLLIFLIYSDAHLHTPMYFFISQLSLMDVMYISITVPKMLMNQVLSMNKISTLECGMQMFLYVT
LGGSECFLLATMAYDRYVAICHPLHYPVLMNHRLCLLLASGCWFLGSVDGFMLTSITMTFPFCRTREIHHFFCEVPAIVKLSCSDTSLYETVMYLCCVLMLLIPVAVISS
SYSFILFTIHRINSAKSQKSFATCSSHMTVVILFYGAGVYNYMLPSFYHTPEKDIMVSVFYTILTPLLNPLIYSLRNKDVTEALKKMVNVGPVFQEIIK*
67 >lcl|XP_003431933.1|Plus1complement(7801..8736) NW_876258 olfactory receptor 6C75-like LOC100683237 __SEG__ Chr14 {Canis lupus familiaris} MRNHTAITEFILLGLTNDPQWQVVLFIFLFVTYMLSVTGNLIIITLTLSDPHLQTPMYFFLRNFSFLEISFTSVCIPRFLVTIVTRDRTITYNGCVTQLFFFIFLGVTEF
YLLAAMSYDRYVAICKPLHYMTVMSSRVCILLVFSSWLAGFLIIFPPLILLLQLDFCASNIIDHFICDSSPILQLSCTNTHFLELMAFFLAVVTLMVTLTLVILSYTYII
RTILRIPSTSQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFKNMVQRMVFSNK*
68 >lcl|XP_003431948.1|Plus1complement(1291445..1292383) NW_876258 olfactory receptor 2L3-like LOC100683667 __SEG__ Chr14 {Canis lupus familiaris} MENYTQTSTDFILLGLFPSTRIGLFLFIVIVLVFLMALFGNLSMILLIFLDTHLHTPMYFLLSQLSLIDLNYISTIVPKMAYNFVFGNKSISFIGCGAQSFFFLTLGGAE
ALLLISMAYDRYVAICFPLHYSIRMNKKVCMLMITGSWIMGSINSCAHTAYAFHIPYCRSRTINHFFCDVPAMLTLACMDTWVYEYTVFVSTILFLVFPFICITFSYIRV
LLAICRMQSTEGRKKAYSTCSTHLTVVTFYYVPFAYTYLRPRSLRSPTEDKALAVFYTILTPMLNPIIYSLRNKEVMGAMRRSIQRACFVKM*
69 >lcl|XP_003431965.1|Plus1complement(1488468..1489403) NW_876258 olfactory receptor 2AJ1-like LOC100687578 __SEG__ Chr14 {Canis lupus familiaris} MGCENQNFTTDFILLGLFSSSQSSQIFFSFIFIIFMMTLTENTIMILLVLRDSRLHTPMYFLLSHLSFMDILHISNIVPKMIINFLSGSRTISFAGCGFQIFLSLTLLGG
ECLLLAAMSYDRYVAICHPLHYHILMNDYVRNLMAAGSWIVGTVNSIAHTVYALHFPFCGSRAIDHFFCEVPAMLKLSCEDTTLYEQGVYVSGLIFLLVPFSLIFVSYVQ
ILLTVLKMKSSEARKKSFSTCSFHMIVVTMYYGPFIFTYMRPKAYHTPGQDMYLAIFYTIITPTLNPIIYSFRNKDVLEAMKNMLKSKFLH*
70 >lcl|XP_003432014.1|Plus117403937..17405016 NW_876259 olfactory receptor 11H1-like LOC100686006 __SEG__ Chr15 {Canis lupus familiaris} MPCSLSSLLSEKGAHLKLVLITVCLLPLQMTDPVNVSEPYSSFASVREFILLGFSCEWKIQILLFSLFTTTYTLTVTGNGAIVCAIWCEGRLHSPMYMFLGNFSFLEIWY
VSSTVPNMLANFLSEKKTISFTGCFVQFYFFFSLGTSECLLLAIMAFDRYLAICRPLHYPNIMTRYLSTKLVIICWVCGFLLFLIPIAFISQMPFCGPNIIDHVVCDPGP
LFALACASAPTIQQLCYSLSSLVIFGNFLFILGSYTLVLLAVLHMPSTLGRHKAFSTCGSHLAVVSLFYGSLMIMYVSPGLGHSAGIQKVATLFYAMVTPLFNPLIYSLR
NKEIKAALRKVLGRCYMTQDVLCDCSRSV*
71 >lcl|XP_003432031.1|Plus1complement(32659640..32660080) NW_876259 protein BTG1-like LOC100684605 __SEG__ Chr15 {Canis lupus familiaris} MCNSNDLSVVSLFFSSSSSSCLPIEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQ
NSSNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG*
72 >lcl|XP_003432134.1|Plus1complement(5789732..5790664) NW_876260 olfactory receptor 2A12-like LOC100684453 __SEG__ Chr16 {Canis lupus familiaris} MGSNQTWITEVILLGFQVDPKLEIFLFGFFLLFYSLTLMGNGLILGLIWLDSRLHTPMYFFLSNLAIVDMSYASSIVPKMLASLIMQKKTISFVPCILQTFLYLALAVTE
CMSLVVMSYDRYVAICHPLHYTVVMSWRVCIILSATCWMFSFLLALVHITLILKLPFCGPQKINHFFCQIMSVFKLACADTRLNQIVLFAGSVFVLVAPLCLVLVSYIHI
LLAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYLAPKSSHSQEQRKILSLFYSLFNPMLNPLINSLRNTEVKSALRRFLGKKSSA*
73 >lcl|XP_003432138.1|Plus1complement(5996527..5997480) NW_876260 olfactory receptor-like protein OLF3-like LOC100687207 __SEG__ Chr16 {Canis lupus familiaris} MEIDNQTWAREFILLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMYFFLTNLSLVDVSYATSIVPQMLAHLLAAHKAIPFVKCAAQLFFSLGLGGI
EFVLLAVMAYDRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTAITFQLPMCTNKYIDHISCELLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQ
IISTILKIQSTEGRKKAFHTCASHLTVVVLCYGMTIFTYIQPHSGPSVLQEKLISLFYAILMPMLNPMIYSLRNKEVKGAWQKLLGQLSGLISKLAT*
74 >lcl|XP_003432248.1|Plus134529941..34531584 NW_876263 inositol 1,4,5-triphosphate receptor-interacting protein-like 1 isoform 1 ITPRIPL1 __SEG__ Chr17 {Canis lupus familiaris} MALISLVFLAVMYVVHHPLMVSDRMDLDTLARSRQLEKRMSEEMRQLEIEFEERKRAAEQKQKAENFWRGDTSSDQLVLGKKDMRWPFQADDQEGPLGWMLGNLWNAGLF
CLFLVFELLRQNMQHEPAFDSSSDEEEEEVRVVPVTSYNWLTDFPSREALESFYKHYVQNVTRDLPCTCEFVESFVDDLIEACRVLSRREAHPQLEDCLGIGAAFEKWGT
LHETQKFDILVPIVPPQGTMFVLEMRDPALGRRCGCVLVESECVCKREKLLGDVLCLVHHHRDHSAVLGKCSSSIKVALCTGSHLDVCKTVQWFRNMVGNAWALVAHKYD
FKLSLPPSTTSCKLRLDYRSGRFLSIQLVLGVQREDTLVYLVSQAPDHEQLTSVDWPESFAACEHLFLKLVGRFAPENTCHLKCLQIILSLRDLQSLPQGASRPILTSYH
FKTALMHLLLRLPLTDWQHSMLSQRLQDILWFLGRGLQQRSLHHFLIGNTFLPLTIPIPKTFRNAEPVNLFQHLVLNPTAHSQAVEEFHSLLTQVKMLPCAPLPGEH*
75 >lcl|XP_003432296.1|Plus1complement(845482..845829) NW_876264 cyclin-dependent kinase 2-associated protein 1 CDK2AP1 __SEG__ Chr17 {Canis lupus familiaris} MSYKPNLAAHMPAASLSAAGSVHPPSTSMATSSQYRQLLSDYRPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSPMERLKRGIIHARGLVRECLAETE
RKARS*
76 >lcl|XP_003432321.1|Plus16481057..6482001 NW_876264 olfactory receptor 5V1-like LOC100683523 __SEG__ Chr17 {Canis lupus familiaris} MNNQTDVTEFIFLGFSNHPKLQGLFFLVFLIIYLTTLLGNMLIITATKISLALHTPMYYFLSNLSFLDVCYTSTTIPVMLVNFFHRKKTISYEGCLSQIFFLVTCTGTEC
VLLAAMAYDRYVAICHPLQYPVLMSVKVCVFLVTGSWLCGLVNSVIHTVLAATLTLCGPNQISHFLCDIPLLLELSCSDTSLNESVLHVASATIGLSPCLFTGVSYILII
SAILRIPSAQGRNKAFSTCASHLTVVVIFYGMANFNYDKPREGYSLDIDILVSVLFCVVTPMLNPIIYSLRNKEVKGALRKLTGGYVIPGNISV*
77 >lcl|XP_003432330.1|Plus110057902..10059677 NW_876264 keratinocyte proline-rich protein-like LOC100686380 __SEG__ Chr17 {Canis lupus familiaris} MCDQQQIQCCLPLPQCCVKGSSFYSSKSPSANSQVVVQAPREMQIIECPAPCPVQVSQVKCQASSQSKTTQVKCQAPCPSKTAQVKCQAPCPSKTTQVKCQAPCQSQISS
VQSQALCQPEVSYVQCEGPCPVQTCYVECAPVCYTETCFVEYPVQNFVPCPAPQPVQTYVACPSVSQTQGKFSTQRQYQGSYGRYALQGQSPASYNNCTPQFQSRTAYSN
CAPQRQSRASFSTCAPQCQARGSYGSFSSQRSRSQSTSRCLPPGPLQPLYRSCSPPRRSEPFHSRCLPSACSSGSYNYCTPPRRSEPIYSSGCPRGPSSGCAGRCGPKCR
IEISSPCCPKQVPPQKCAVQIPPIRRCSESCAPRPSWGASCPELRPPAESRPLPSFCPSRRLDRSPESSLQRCPLAAPSPCPRPAPRRYQRPEPCARSGPRSCPPPRRLS
EPCLCPEPRPAPRAAPRPRPVQREFPEPRPCPQPCERPAAYPLPEPSPLPAPCPSPEPCAEPLRCPSPSSGPRPNPGPGDLGCHESSPCLLDTEAPSCGPTGCNQWQGSG
DNFRPCDGIPEPQGFGDCGDQGGTCVGLKGGSDAGTKGAYF*
78 >lcl|XP_003432406.1|Plus112147187..12148125 NW_876266 olfactory receptor 5AN1-like LOC100685512 __SEG__ Chr18 {Canis lupus familiaris} MTGGGNTTEITYFILLGFSDFPRILAVLFAVFLLIYILTLTWNLGLIILIRMDSHLHTPMYFFLSNLSFIDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGL
SESCLMTAMAYDRYTAICNPLLYSSVMSPTLCIQMVLGSYLAALSASISQLCAMFQLHFCGPNVINHFFCDMPQLLILSCTDTFFVHLLIAILATIFGMINAFIIMISYG
YIVMSIMKITSAKGRSKAFNTCASHLTAVSLFYTSSVFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLPKKTWYC*
79 >lcl|XP_003432408.1|Plus112236324..12237280 NW_876266 olfactory receptor 5AN1-like LOC100685932 __SEG__ Chr18 {Canis lupus familiaris} MAGGRNNTIVIRFILLGFSDYPKLKILLFAGFLGSYVLTVAWNLGLIILIKIDPYLHTPMYFFLSNLSFLDFCYVTSTTPKMLSDFFQKPKSISFLGCTMQYFFFSSLGL
TECCLLAAMAYDRYAAICNPLLYTTTMSPPFCVQMMVGAYITGLFGSLIQLCALLQLNFCGPNVINHFFCDLPQLLVLSCSETFFLKVMKFVIAVIFGVISVFVIMISYG
YIVATILKISSVEGRSKAFNTCTSHLTAVICFFGSGLFVYMHPSTGNSVGQDKIASVFYTVVIPMLNPLIYSLRNKEIKDALKRCKKRVIFPLLQLKV*
80 >lcl|XP_003432412.1|Plus113882616..13883566 NW_876266 olfactory receptor 5G3-like LOC100688997 __SEG__ Chr18 {Canis lupus familiaris} MEEKNQTGVTEFLFLGLTDHLHQQIVLFVMLLFVYLVTLGGNIGMIILIWTDPRFHTPMYFFLSHLSFVDLCSSSSIAPKMLCDIFAEKKDISFMGCAAQMWFFGLFVAT
ECFLLASMAYDRYMAICKPLLYTLIMSQRVCVQLVVGPYSMALISTMTHTILTFRLPFCGPNVINHFFCDISPLLSLACADTWINKLVLFIMAGSIGMLSGLIIMVSYVC
ILVAILKIQTADGRQKAFSTCSSHLAVVSVLYGTLFFIYVQPGSSPSLDINKVISLFYTVVIPMLNPLIYSLRNKEVKNAFRKKFEMKNSIMALAK*
81 >lcl|XP_003432414.1|Plus1complement(14129819..14130796) NW_876266 olfactory receptor 1030-like LOC100683327 __SEG__ Chr18 {Canis lupus familiaris} MDIFLPHNSTEATEFILLGLTSQQELQPILFVVFLLIYIITLTGNFGLIALIRFTPRLQTPMYFFLTHLACVDIFYSTNVSPQMLVNFLSEKKTISYTGCLAQCFVFVTL
LLTEYYMLGAMAYDRYMAICHPLHYNSRMSRPLCICLVTFPYLWGSMVGTMQVILTSRLSFCGPNIINHFYCADPPLLMLTCSDTYIKQTALFVSAGINLTGSLLIILIS
YVFIFITIMRIHSSEGQCKAFSTCGSHLTAVTMFYGSLFCMYLRPANEQSVEQGKIVAVVCIFVSPMLNPFIYSLRNKDVKQALRIVFTRKLGTVEKMSILTVSQ*
82 >lcl|XP_003432415.1|Plus114142035..14142970 NW_876266 olfactory receptor 1030-like LOC100683398 __SEG__ Chr18 {Canis lupus familiaris} MLKNNYTAVTEFILLGLTDQAELQPVLFVVFLVIYLITVLGNVSMILLIRSDSKLHTPMYFFLSHLSFVDLCYTTSVAPQMLVHFLSKRKAISFLGCLLQFHFFIALVIT
DYYMLTVMAYDRYVAICKPLLYGSKMSRCVCFSLVATPYIYGFVNGLAQTILMLRLSFCGPNEINHFYCADPPLIVLACSDTYVKETAMFVVAGFNLTCSLAIILISYIF
IFSTILRIHSAEGRRKAFSTCGSHLTAVTIFYGTLFCMHLRPPSETSVEQSKIVAVFYIFVSPMLNPFIYSLRNKDVKNAIRKVFQRKLLN*
83 >lcl|XP_003432416.1|Plus1complement(14219460..14220416) NW_876266 olfactory receptor 1038-like LOC100683985 __SEG__ Chr18 {Canis lupus familiaris} MAERNSTKVTEFILLGFSVHREIEIILFLLISVVYTLTLVGNLGMISLIRLDSRLHTPMYFFLSNLAFIDLCYSSSIAPKFLETLLTKHRSISFYACATQLGFFLNFLIS
EMFLLAVMAYDRYVAICNPLLYMMIMSRKVCMQLVIGPYLYSFSVALLHTVVTFQLMYCGPNIINHFYCDDVPLMALACSDTSLKEILIFIFAGFNMISSLTTVLISYLY
IVAAILKIQSTEGRCKAFSTCASHLTAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTIVIPMLNPIIYSLRNQEVKNALRKATDKCYVLFLTNLKK*
84 >lcl|XP_003432418.1|Plus1complement(14258461..14259402) NW_876266 olfactory receptor 5AL1-like LOC100684193 __SEG__ Chr18 {Canis lupus familiaris} MAKGNHSAVTEFILLGLTDNPEIQAVLFCVFLLIYLVTVLGNLGLIVLIQISPQLHTPMYFFLCHLAFVDFYGTSAITPNTLVNSLREIKSMPFYACATQVCCFITFSVW
ELLMLSVMAYDRYVAICSPLLYIILMSKKLCIQLVTSSYIYGFTVGLIQTMVTFHMSFCDSNVVNQFYCDDVPLIALACSDTQVKELMLLIIAGFNVFCSLIIVLISYGF
IVFAILKIHSAAGRQKAFSTCASHLFSITMYYGTLSFMYLRPKSSHSLDKDKFASVFYAVVIPMLNPLIYSLRNQEVKNAFKKIFEKVYSSNQ*
85 >lcl|XP_003432419.1|Plus1complement(14301924..14302883) NW_876266 olfactory receptor 8K1-like LOC100684411 __SEG__ Chr18 {Canis lupus familiaris} MNHMDKQNYTAVSEVTEFILMGITKNPRLQAPLFGIFFIIYLVTVTGNLGIIILTHLDSRLQTPMYFFLRHLSITDLGYSTVIGPKMMVNFVVHKNTISYHWCATQLAVF
EIFIITELFILSAMAYDRYVAICKPLLYAVIMAEKVRWALVLVPYLYSIFVSLFLTIKLFKLSFCGSNIISYFYCDCLPLISLLCSDTHELELIILIFSGCNLLSSLLIV
LVSYIFILVAIIRMNSTEGRYKAFSTCSSHLTVVTVFYGTLLFIYLQPKSSHTFDIDKMASVFYTLVIPMLNPLIYSLRNKEVKGALKRTLTNGCKIPT*
86 >lcl|XP_003432420.1|Plus1complement(14308787..14309731) NW_876266 olfactory receptor 8K5-like LOC100684477 __SEG__ Chr18 {Canis lupus familiaris} MGKQNLTSVTEFILMGVTRQPELQVPLFGVFLIIYMITVVGNLGMITLIQVDSRLHTPMYFFIKHLAFIDLGNSTVICPKMLVNFVVDQNIISYYACATQLAFFLMFIIS
EFFILSAMAYDRYLAICNPLLYNVIMSQRLCYMLVGIPYLYSTFQALLFTIKIFTLTFCGSNVINHFYCDDVPLLLILCSNAQEIGLLIILFSALNLISSFLVVLVSYIL
ILTCIFQIHSTESRKKAFSTCGSDLTVVVVFYGSLLFMYMQPKSAHSFETDKMASVFYTLVIPMLNPLIYSLRNKEVKNAFRRFFFFFFFPQVL*
87 >lcl|XP_003432421.1|Plus114320073..14321011 NW_876266 olfactory receptor 1052-like LOC100684560 __SEG__ Chr18 {Canis lupus familiaris} MAKENFTAVTEFILLGLTDHPDLKIILFVLFLVIYAITLLGNLGMIFIIQITPKLHTPMYFFLSCLSFVDACYSSVIAPKMLISFLVVKETISFSACIVQHLFFGVFITT
EGFLLSVMAYDRYVAIVNSLLYSAAMSKRKCVGWVNGSWICGIINSLIHTISLGRLSFCGSNVVNHFFCDIPSLLKLSCSDTTMNELLLLTFSGVIAMATFLIVIISYVF
IAVAILRIRSAAGGQKAFSTCASHLTVVTIFYGTLSFSYIQPSSQYSVEQEKVVSVFYTLVIPMLNPLIYSLRNKEVKDAVKRAIEMTHFPC*
88 >lcl|XP_003432423.1|Plus114474525..14475511 NW_876266 olfactory receptor 5T1-like LOC100685095 __SEG__ Chr18 {Canis lupus familiaris} MPGFPSDLDLYRIQMKNVTEATMFILMGFTDDFEMQVFLFLLFLAIYLFTLIGNLGLVILVMGESRLHNPMYYFLSVLSFLDACYSSVVTPKMLVNFLAEDKSISYLGCA
AQMLLFVTFGTTECFLLAAMAYDRYVAIYNPLLYSVSMSPRVYVPLIVASYVGGILHASVHTVATFSLSFCASNEIRHVFCDIPPLLAISCSDTHTNQLLLFYFVGSIEI
VTILIVLISYGFILLAILNIHSAEGRRKVFSTCGSHLTGVSIYHGTILFIYMRPSSSYALEHDMIVSIFYTIVIPMLNPIIYSLRNKDVKEAMKKLFMRNWFLSKTHN*
89 >lcl|XP_003432427.1|Plus1complement(14531467..14532405) NW_876266 olfactory receptor 1052-like LOC100685489 __SEG__ Chr18 {Canis lupus familiaris} MANRNVSVVTEFILLGLTDNPDLNTALFVLFLSIYLVTVVGNAWIIAVIWVSAQLHSPKYFFLCQLAFLDFCYSSVFIPKMLVNYITGQKSISYHGCLLQYSFVNMFLTT
ECFLLAAMAYDRYVAICCPLHYKGLMTHTFCVHLVTACYLVGSASSLTHLSSLLSLSFCGPNVINHYFCDIPLLFQLSCSDTQSSEILFIVFSGTTSVTTFLIVVSSYLG
ILRTVLKLHSTRSRYKAFSTCASHLTVVTLFYGTVIFTYLGSSSSYPRDRAKILSIFYTLLLPVLNFLIYSVRNREAKEAMKRIILRKVFAQ*
90 >lcl|XP_003432428.1|Plus1complement(14540576..14541514) NW_876266 olfactory receptor 1052-like LOC100685566 __SEG__ Chr18 {Canis lupus familiaris} MADVNFTLVTEFILLGLTDRAELKVVLFVLFLLIYTISLVGNLGMVFLIQVTPKLQTPMYHFLSCLSFVDACYSSVFAPKMLLNFFVERETISFSACIVQYFLFVSLLTT
EGFLLAAMAYDRYMAIVNPLFYTVAMTKIVCIVLVIGSCVGGLINSLTHTIGLVKLSFCGPNIISHFFCDLPPLLKLSCSDTSMNELLLLIFSGIIAMITFLIVMISYVF
IVAAILRIRSAAGRHKAFSTCASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSVFYTLVIPMLNPVIYSLRNKEVKDAVKRATEIKYCPC*
91 >lcl|XP_003432429.1|Plus1complement(14569739..14570677) NW_876266 olfactory receptor 5AS1-like LOC100685814 __SEG__ Chr18 {Canis lupus familiaris} MWESNYTMPTEFLLVGFTDYLPLRVTLFLVFLIVYTLTMVGNMSLIILVNISSSLQTPMYYLLSNLSFLDICYSTAIAPKMLVNFLASRKSISPYGCALQMFFFGCFADA
ECLILAAMAYDRYAAICNPLLYSAFMSRRVCICSIVLAYFSGSMTSMVHVCLTFRLPFCGSNIVNHFFCDIPPLLALSCADTYINELLLFALCGFIQTSTFVVIFISYFC
ILLTVLSIKSSGGRSKTFSTCSSHFIAVTLFYGTLLFTYLRPTTSYSLDTDKVVAVFYTVVFPMFNPIIYSFRNKDVKNALKKLLERNWTFK*
92 >lcl|XP_003432430.1|Plus114602069..14603025 NW_876266 olfactory receptor 10AG1-like LOC100685982 __SEG__ Chr18 {Canis lupus familiaris} MESTGQNPLQANHTTLMDFILVGFSDVPNLRGLLFGVFLIIYVIILMGNSLIIIITKVNPSLQTPMYFFLGNFSSLEICYVSVTVPRLLTDLCRQNRNISFLACATQMYF
FLIFGASECFILTAMAYDRYVAICNPLLYPLIMNNRLCIQLATGCWITGIPVHIGFTYLIFSLHFCGSNKLNHFFCDIPPVLKLACGDTFMIEMLVYEVAVLVVTIPFLL
ILASYVKIISTILKLPSAAGRAKAFSTCSSHLMVVALFFGSGIITYLRPKSSHSTGMDKFLSLFYTIVTPMFNPIIYCLRNKEVMVAFKKSLPKWIVL*
93 >lcl|XP_003432431.1|Plus1complement(14608625..14609599) NW_876266 olfactory receptor 5T1-like LOC100686059 __SEG__ Chr18 {Canis lupus familiaris} MSAVLSDSDLCRVQMENVTEVTTFILTGFTDDFKLQVFLFLLFLAIYLFTMIGNLGMVLLVLGDSRLHNPMYYFLSVLSFLDACYSSAVTPKMLVNFLAEDKTISFLGCA
AQMFLFISFGTTECFILAAMAYDRYEAIYNPLLYSVRMSPRVYVPLIISCYVCGFLHATLHTVATFTLSFCASNEIRHVFCDIPPLLAISCSDTHTNQLLVFYFAGSIEI
STILIVLVSYGFILVAIMRVHSAEGRRKVFSTCGSHLTGVSIFHGTVLFMYVRPNSSYALDHDMIVSVFYTIVIPMLNPIIYSLRNKDVKDAVKRVFGKNWFAN*
94 >lcl|XP_003432432.1|Plus114627392..14628324 NW_876266 olfactory receptor 10AG1-like LOC100686139 __SEG__ Chr18 {Canis lupus familiaris} MEKKTAEVNLTSMTEFILLGFSDIPNLQMFLFVVFFFVYVIILMGNGIIVLITKTDQALQTPMYFFLSNFSFLEICFVSATLPKMLTNLWTQKRNISLFACATQMCFVLM
LGNIECLLLMVMAYDRYVAICDPLHYPLIMNHKVCVQLVTACWITGVPVEIGQTCQIFSLPFCGSSQINHFFCDIPPLLKLACGDTFLNEMLVFTVAVLFVMIPFLLILG
SYSKIISTILRLPSATGRTKAFSTCSSHVIVVAMFFGSAVITYLRPKSKHSSRTDKFLSLFYTIVTPMFNPMIYTLRNKDAMMALRKLLP*
95 >lcl|XP_003432433.1|Plus114636762..14637712 NW_876266 olfactory receptor 10AG1-like LOC100686203 __SEG__ Chr18 {Canis lupus familiaris} MENTLKTENFNVTTIVEFVLLGFSDIPNLQWILFGIFLVIYLTILMCNSIIILIIRIDPALQTPMYFFLSNFSFLEICYVTVTIPRMLMDLLTQKGNISFFACAAQMCFV
LMFGGSECLLLTVMAYDRYVAICNPLHYPLVMNHKVCVQLVTVAWISGVPVVIGQTCQIFSLPFCGSNTINHFFCDLPPVLKLACGDTFLNEIAVYVVAVVFVMIPFLLI
VVSYGKIISNILKLSTAKGRAKAFSTCSSHLIVVVLFYGTATITYLQPKPNQSEGVGKLISLFYTILIPTLNPLIYTLRNKDIMVALRKLLTKLLP*
96 >lcl|XP_003432434.1|Plus1complement(14666434..14667384) NW_876266 olfactory receptor 10AG1-like LOC100686456 __SEG__ Chr18 {Canis lupus familiaris} MLPRDQTTEGNLSSVVAFVLLGFSDLPNIQGFLFGIFFLIYMSILIGNGLIIIITRVDSVLQTPMYFFIANFSSLEICYVSVTLPRILVNLWTQDRSISWLGCATQMCFF
LMLGATECFLLAVMAYDRYVAICNPLHYPLIMNHKMCVQLAVGAWLSGIPVQIGQTCQVFSLPFCGSNQINHFFCDIPPLIKLACGDTSLNEMCVFVVAILFVMIPFLFI
LGSYVKIISTILKLSSARGRSKAFSTCSSHIIVVLLFFGSATITYLRPKSNHSARTDKMLSLFYTIVTPMFNPLIYSLRNKDVKTALKKLLLKKTV*
97 >lcl|XP_003432438.1|Plus114759035..14759970 NW_876266 olfactory receptor-like protein OLF2-like LOC100686934 __SEG__ Chr18 {Canis lupus familiaris} MDGKNCSSVNEFLLVGISNKPGVKVTLFITFLIVYLIILVANLGMIILIRMDSQLHTPMYFFLSHLSFSDVCYSTAVGPRMLVGFIAKNKSIPFYSCAMQWLVFCTFVDS
ECLLLAVMAFDRYKAISHPLLYTVSMSSRMCSLLMAGVYLVGIMDASVNTILTFRLCFCESNVINHFFCDVPPLLLLSCSDTQVNELVIFTIFGFIELITLSGLFVSYCY
IILAVRKINSAEGRFKAFSTCTSHLTAVAIFQGTLLFIYFRPSSSYSLDQDKIISLFYSLVIPMLNPLIYSLRNKDVKEALKKLKNKKWFH*
98 >lcl|XP_003432439.1|Plus114918668..14919600 NW_876266 olfactory receptor 4P4-like LOC100687650 __SEG__ Chr18 {Canis lupus familiaris} MENRNNITEFILLGLSQKKEIEVLCFLLFLLCYIAILIGNLLVMISIICSQLINHPMYFFLSFLSLADLCYTSTVTPKLIIDLLSEKKVISYNGCMTQLFTMHFFGGIEV
FILTGMAYDRYVAICKPLHYTLLMSRWKCDAILAASCIGGFLHSFGQFLLAIVLPYCGPNEIDHFFCDVYPLLKLACKDTSRIGLLVVANSGLMGLVTFVVLLVSYAVIL
YTIRSYSAENRHKALSTCSSHITVVVLFFAPLLFIYIRPATTLPEDKVFALFYTVFAPMLNPLIYTLRNMEMKNAIRKFWCHVMGSKDIN*
99 >lcl|XP_003432440.1|Plus114934141..14935079 NW_876266 olfactory receptor 4P4-like LOC100687724 __SEG__ Chr18 {Canis lupus familiaris} MENRNNVTEFILLGLSKNKKVQILCFLFFLLCYLAIWLGNLIIMASITCSQLINQPMYFFLNYLALSDLLYTSTVTPKLMTDLLTENKVISYKNCMTQLFTTHFFGGVEV
FIITGMAYDRYVAICKPLHYAILMNRQRCNSILRASCAGGFLHSLGLFLLTIFLPFCGPNEIDHYFCDVYPLLKLACIDTHKIGFLVIANSGLMGLVIFVVLMASYFMIL
YNVRAYSAENRHKALSTCSSHITVVILFFAPVIFVYIRPATTLPEDKVFTLFYTIIVPMLNPLIYTLRNTEMKNAIRKVWCTERFWKGKPMI*
100 >lcl|XP_003432441.1|Plus1complement(14938547..14939488) NW_876266 olfactory receptor 4P4-like LOC100687811 __SEG__ Chr18 {Canis lupus familiaris} MENINNVTEFVLLGLSQNKKVKNLCFLLFLFCYIAIWMGNLLIMISITCSQLIDQPMYFFLNNLALSDLCYTSTVTPKLVTDLLVESNMISYTNCMAQLFVMHFFGGIEV
FILTGMAYDRYVAICKPLHYTVIMNRKRCYGIVIASCTGAFLHSFVQCLLTITLPFCGPNEIDHYFCDVYPLLKLACTDTYRVGILVVANSGMMGLVTFVVLVLSYLLIL
YTIKSYPAESRTKALSTCSSHITVVVLFFVPVLFIYIRPATTFPEDKVFALFYTIIAPMFNPLIYTLRNMEMKNTLRKVWCQKPCLIGKQIII*
101 >lcl|XP_003432442.1|Plus1complement(14963382..14964338) NW_876266 olfactory receptor 4P4-like LOC100688033 __SEG__ Chr18 {Canis lupus familiaris} MESQRNISEFILLGLSYNQNIQIFCFIFFLFCYVSILVGNLLILVSILCSGLFYQPMYYFLNHLSFMDICYTSCVIPKLIGDLLLVRKTISYDNCMSQVFSLHFLGMIEI
FILTVMAFDRYAAICKPLHYMIIMNRTRCNLLVMAAWVGGAVHSFSQFSMIICLPFCGPNEINHYYCDIFPLLKIACTDTYVIGVIVVANSGMVALVTFVLLFGSYVVIL
FTLRNYSAEGRRKALSTCGSHITVVILFFGPSIFAYLRPPTTFPEDKIFALFYTVIVPMFNPLIYTLRNTEKSHEKGLVSKDIFRRQTQLICPTQYAE*
102 >lcl|XP_003432443.1|Plus1complement(15005142..15006071) NW_876266 olfactory receptor 4P4-like LOC100688263 __SEG__ Chr18 {Canis lupus familiaris} MENQNNVTEFVFMGLWGNKQLELLFFFLFLLCYLAVLMGNFIILLTITCSHLIEHPMYYFLCHLSLMDLCYTSTVVPRLIRDLGAARKNISYNNCMTQLFTAHLLAGVEI
FILVSMALDRYVAIVKPLHYMVIMNRRRCNLLIFMAWGVGFWHSVALLLMVLNLPFCGPNQIDHYICDVKPLLKLVCRDIRVVSILVIANSGMVVVVIFLVLVASYILIL
YNLRTHSSVGRLKALSTCSSHVMVVILFFVPCIYTYVLPAGSENKDKEISVFYTVIAPMLNPLIYTLRNMEMKIAMRKVWSKVAHSEFK*
103 >lcl|XP_003432444.1|Plus1complement(15044849..15045760) NW_876266 olfactory receptor 4P4-like LOC100688466 __SEG__ Chr18 {Canis lupus familiaris} MESQRNVSEFILLGLSHDQNMQIFCFVLFLFCYAALLVGNLLILVSIRCSPLFHQPMYYFLSHLSTLDICYTSSVTPKLIADLLVERKAISYGNCMLQVFAMHFFGTIEV
LILTVMAFDRYAAICKPLHYLLIMNRTRCNLLVLAAWAGGAVHSFPQFCMVIRLPFCGPNEIDHYFCDIFPLLKVACTDTYITGVLMVVNSGMVTLVTFVVLFFSYVIIL
FTLRNHSAEGRRKALSTCGSHITVIVLFFGPSIFAYLRPPTNFPEDKVFALFYTIIAPMFNPLIYTLRNSEMKNAMRKFWCQT*
104 >lcl|XP_003432445.1|Plus1complement(15054717..15055646) NW_876266 olfactory receptor 4P4-like LOC100688536 __SEG__ Chr18 {Canis lupus familiaris} MENQNNVTEFVFMGLWGNKQMELLFFFLFLLCFLAILMGNFIILLTIICSHLIEQPMYYFLCHLSLMDLCYTSTVVPRLIRDLGAARKNISYNNCMTQLFTAHLLAGVEI
FILVSMALDRYVAIVKPLHYMVIMSRRRCNLLIFMAWSVGFWHSVALLLLVLNLPFCGPNQINHYICDVKPLLKLVCRDIRVVNILVISNSGMVAVVVFLVLVASYILIL
YNLRTHSSVGRRKALSTCSSHVMVVILFFVPCIYIYVLPAGSENKDKEISVFYTVIAPLLNPLIYTLRNMEMRNAMWKVWSKMAHTKFR*
105 >lcl|XP_003432446.1|Plus1complement(15180957..15181868) NW_876266 olfactory receptor 4P4-like LOC100688752 __SEG__ Chr18 {Canis lupus familiaris} MESQRNVSEFILLGLSHDQNMQIFCFVLFLFCYAALLVGNLLILVSIRCSPLFHQPMYYFLSHLSTLDICYTSSVTPKLIADLLVERKAISYGNCMLQVFAMHFFGTIEV
LILTVMAFDRYAAICKPLHYLLIMNRTRCNLLVLAAWAGGAVHSFPQFCMVIRLPFCGPNEIDHYFCDIFPLLKVACTDTYITGVLMVANSGMVTLVTFVVLFFSYVIIL
FTLRNHSAEGRRKALSTCGSHITVIVLFFGPSIFAYLRPPTNFPEDKIFALFYTIIAPMFNPLIYTLRNSEMKNAMRKFWCQT*
106 >lcl|XP_003432447.1|Plus1complement(15189840..15190769) NW_876266 olfactory receptor 4P4-like LOC100688817 __SEG__ Chr18 {Canis lupus familiaris} MENQNNVTEFVFMGLWGNKQMELLFFFLFLLCYLAILMGNFIILLTIICSHLIEQPMYYFLCHLSLMDLCYTSTVVPRLIRDLGAARKNISYNNCMTQLFTAHLLAGVEI
FILVSMALDRYVAIVKPLHYMVIMSRRRCNLLIFMAWSVGFWHSVALLLLVLNLPFCGPNQINHYICDVKPLLKLVCRDIRVVNILVISNSGMVVVAVFLVLVASYILIL
YNLRTHSSVGRRKALSTCSSHVMVVILFFVPCIYIYVLPAGSENKDKEISVFYTVIAPLLNPLIYTLRNMEMRNAMWKVWSKMAHTKFR*
107 >lcl|XP_003432448.1|Plus115255196..15256128 NW_876266 olfactory receptor 4C11-like LOC100688970 __SEG__ Chr18 {Canis lupus familiaris} MQQNNSTTEFILLGLTQDPMKKKMVFVIFFIFYLGTVVGNLLIIVTIKSSRTLGSPMYYFLFYLSLADSCFSTSTAPRLIVDSLSAKNIITYNECMTQVFALHFFGCMEV
LVLILMAFDRYVAICKPLHYPTIMSRRVCTILIVLAWIGSFIHSTAQIILALRLPFCGPNLIDHYCCDLQPLLKLACMDTFVINLLLVSNSGGISSSSFVILMISYIVIL
HSLRNHSAEGRKKALSTCTTHIIVVIIFFGPCIFIYTRPPTTYPMDKMVTVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHINITSESRR*
108 >lcl|XP_003432449.1|Plus1complement(15269464..15270396) NW_876266 olfactory receptor 4C11-like LOC100682575 __SEG__ Chr18 {Canis lupus familiaris} MQQNNRTTEFILLGLTQDPMKKKMVFVIFFIFYLGTVVGNLLIIVTIKSSRTLGSPMYYFLFYLSLADSCFSTSTAPRLIVDSLSAKNIITYNECMTQVFALHFFGCMEV
LVLILMAFDRYVAICKPLHYPTIMSRRVCTILIVLAWIGSFIHSTAQIILALRLPFCGPNLIDHYCCDLQPLLKLACMDTFVINLLLVSNSGGISSSSFVILMISYIVIL
HSLRNHSAEGRKKALSTCTTHIIVVIIFFGPCIFIYTRPPTTYPMDKMVTVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWHINITSESRR*
109 >lcl|XP_003432450.1|Plus115402454..15403389 NW_876266 olfactory receptor 4S2-like LOC100682721 __SEG__ Chr18 {Canis lupus familiaris} MEKRNNVTEFIFWGLSQNLEVEEVCFVVFSFFYTVILLGNLLIMLTVYMGNLFKFPMYFFLNYLSFVDICYSSVTAPKMIVDLLAKSKTISYVGCMLQLFGVHFFGCTEI
FILTVMAYDRYVAICKPLHYTTIMDRNRCNKMLLGTWIGGFLHSIIQVALVVQLPFCGPSEIDHYFCDVHPVLKLACTDTYIVGVVVTANSGTIALGSFVILIISYTVIL
VSLRKHSAEGRRKALSTCGSHIAVVIIFFGPCTFMYMRPDTTFSEDKMVAVFYTIITPMLNPLIYTLRNAEIKNTIKRLWGRKVFSEANDK*
110 >lcl|XP_003432452.1|Plus1complement(15813617..15814546) NW_876266 olfactory receptor 4A47-like LOC100683879 __SEG__ Chr18 {Canis lupus familiaris} MEPRNNVTYFVLLGLTQDPKEQKVLFIMFLLFYILTVVGNLLIVVTVTVSKTLGSPMYFFLANLSFMDVIYSSCISPRLISEFFFQKSTISFQSCMTQLFIDHLFGGSEV
FLLLVMAYDRYVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVIQVSTIYGLPFCGPNVIDHFFCDMYPLLKLVCTETYVAGLLVAANGGVICSIVFVLLLISYGVIL
HSLKNLSPEGRRKALQTCGSHITVVVFFFVPCIFMYARPAKTFPIDKSLTVFYTVITPMLNPLIYTLRNSEMINAMKKLWRRNVISSSQ*
111 >lcl|XP_003432454.1|Plus1complement(15845924..15846853) NW_876266 olfactory receptor 4A47-like LOC100684032 __SEG__ Chr18 {Canis lupus familiaris} MEPRNNVTYFVLLGLTQDPKEQKVLCVMFLLFYILTVVGNLLIVLTIALSKTLGSPMYLFLANLSFMDVTYSSCISPRLISTLFFGENTISFHSCMTQLFTEHLFGGSEV
FLLLVMAYDRYVAICKPLHYLVIMRQWVCVVLLVVSWIGGFLHSVIQVSTIYGLPFCGPNVVDHFICEMYPLLELVCTDTYVIGLLVVANGGMICTIVFAFLLISYGVIL
HSLKNLSPEGKRKALQTCGSHITVVVFFFVPCIFMYVRPAKTFPIDKSLSVFFTVITPMLNPLIYTLRNSEMTNAMKKLWRRNVISFSR*
112 >lcl|XP_003432455.1|Plus1complement(15865394..15866332) NW_876266 olfactory receptor 4A47-like LOC100684105 __SEG__ Chr18 {Canis lupus familiaris} MQKMELRNNVTYFVLLGLTQNPKEQKVLFVIFLLFYILTVVGNLLILVTISLSKTLGSPMYLFLANLSFMDVIYSSSISPRLISDLFFAKNTISFHSCMIQLFTEHLFGG
TEIFLLLVMAYDRYVAICKPLHYLVIMKQWVCVVLLVVSWVGGFLHSVIQLSTIHGLPFCGPNVIDHFFCDMYPLLKLVCTDTYVIGLLVVANGGMICTIVFSFLLISYG
IILHSLKNLSPEGKRKALQTCGSHITVVVFFFVPCIFMYARPAKTFPIDKSLSVFYTVITPMLNPLIYTLRNSEMTNAMKKLWRRNTISFSR*
113 >lcl|XP_003432478.1|Plus1complement(14018278..14019210) NW_876266 olfactory receptor 10A7-like LOC100684339 __SEG__ Chr18 {Canis lupus familiaris} MDMIKTNFTVTEFVFLGLSSQPKMQLILFIMFLFFYLLTVVGNIIIITIIQIEPRLQTPMYFFLTNLSFLDICYTSTNVPQMLSNMMGKKTIPFSSCATQMYFSLSFGMI
ECVLLGVMAYDRYVAICHPLHYTVIMNQSICVQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFCEVPSVLRLACTDTSFTELVVFIFSIIIVFIPFLLIVVSYAR
ILLSVLRIRSASGRHKALSTCASHLTVVALFYGTAIFMYMRPQSKSSRAGGKIIAVFYTVITPMLNPLIYSLRNQDVKGALRRAIAKRRT*
114 >lcl|XP_003432479.1|Plus114069889..14070821 NW_876266 olfactory receptor 10A7-like LOC100684478 __SEG__ Chr18 {Canis lupus familiaris} MHMIKTNFTVTEFVFLGLSSQPKMQLILFIMFLFFYLLTVVGNIIIITIIQIEPRLQTPMYFFLTNLSFLDICYTSTNVPQMLSNMMGKKTIPFSSCATQMYFSLSFGMI
ECVLLGVMAYDRYVAICHPLHYIVIMNQSICVQLAAISWSSSFLSSMVINVLTLSLPYCGPNVLNHFFCEVPSVLRLACTDTSFTELVVFIFSIIIVFIPFLLIVVSYAR
ILLSVLRIRSASGRHKALSTCVSHLTVVALFYGTAIFIYMRPQSKSSRAGGKIIAVFYTVITPMLNPLIYSLRNQDVKGALRRAIAKRRT*
115 >lcl|XP_003432480.1|Plus114125543..14126490 NW_876266 olfactory receptor 5M10-like LOC100684561 __SEG__ Chr18 {Canis lupus familiaris} MSSSNHTSVTGFILLGLTDDPVLEKILFGVFLVIYLVTLAGNLCMIVLIGTNSHLQTPMYFFLSHLSFVDICYSSNITPNMLYNFLSDQKTISYAGCFTQCLLFIALVIT
EFYILASMALDRYVAICSPLHYSTRMSKNICISLVVISYTCGYLNGLSQTLLTFHLSFCDSLEINHFYCADPPLILLACSDTHVKKMAMLVVAGLTLSSSLFIIVLSYLF
IIVAILRIRSAEGRHKAFSTCASHLTTVTLFYGTLFCMYLRSPSEKSIEESKIIAVFYTFLSPMLNPLIYSLRNKDVIHAMQQIIQGNIFHKIAV*
116 >lcl|XP_003432481.1|Plus114241160..14242119 NW_876266 olfactory receptor 1038-like LOC100684702 __SEG__ Chr18 {Canis lupus familiaris} MADVNITYVTEFILKGITDRPELQAPCFVVFFIIYLVTVVGNLGLITLIRIDSRLHTPMYYFLSHLAFVDLCYSSAITPKMMVNFVVELNIIPFHACATQLGCFLTFMIT
ECFLLASMAYDRYVAICSPLHYSTLMSRRLCIQLVAVPYIYSFLVALFHTIITFRLSYCGPNVINHFYCDDLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYIF
IIAAILRIRSTQGRRKAISTCGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDASKKALDKGCETLNLLKLRK*
117 >lcl|XP_003432482.1|Plus1complement(14337371..14338312) NW_876266 olfactory receptor 8K3-like LOC100684857 __SEG__ Chr18 {Canis lupus familiaris} METQNLTVLNEFILMGITDKPELQAPLFGLFLIIYLISVVGNLGMIVLTKVDARLQTPMYFFLRHLAFTDLGYSTTIGPKMLVSFFLEENTISYYLCATQGAFYMIFIIS
ELFILTAMSYDRYMAICNPLLYPVIMSQKVCQVLVAIPYLYSTFVSLIVTIKIFSSFFCGYNVVNHFYCDCLPLLSLLCSNTHETEMIILILAGFDLISSLLVVLVSYLL
ILVAIIKMNSAEGRLKAFSTCGSHLTVATVFYGTLIFMYVQPESSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVKYARQRMWKKICNIFS*
118 >lcl|XP_003432483.1|Plus1complement(14348687..14349628) NW_876266 olfactory receptor 8K3-like LOC100685096 __SEG__ Chr18 {Canis lupus familiaris} MEKHNLTMLNEFILMGITHRPELQAPLFGLFFIIYLISVVGNLGMIILTKVDARLQTPMYFFLKHLAFTDLGYSTTVGPKMLVNFIVDQNTISYYFCAMQLAFFLVFIIS
ELFILTAMSYDRYVAICNPLLYPVIMSQRVCQVLVAIPYLYSTFVSLLVTIKIFSSFFCGYNVVNHFYCDCLPLLSLLCSNSHETEMIILILAGFDLISSLLVVLVSYLL
ILVAIIRMSSAEGRLKAFSTCGSHLTVATVFYGTLIFMYVQPESSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVKYAVQTMWKKLCNNFS*
119 >lcl|XP_003432484.1|Plus114749414..14750346 NW_876266 olfactory receptor 5W2-like LOC100685567 __SEG__ Chr18 {Canis lupus familiaris} MDKGNCSSLTEFIFLGITNNPGMKVTLFATFLVVYLINLFANLGMIILIIIDSQLHTPMYFFLSQLSFCDLCYSTAVGPKMLVDLLAKNKSIPFFGCALQFLIFCMFADS
ECLLLAVMAFDRYKAIGNPLLYTVNMSNRVCSLLMAGVYLLGMADALIHTTLTFRLCFCGSNEINHFFCDLPPLYLLSCSDTEINELALFIFFGFIELSTISGVLISYCY
ITLSVLKIRSAEGRFKAFSTCTSHLTAVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPTLNPLIYSLRNKDVKEALKKLKIKKWF*
120 >lcl|XP_003432485.1|Plus114779908..>14780822 NW_876266 olfactory receptor-like protein OLF2-like LOC100685651 __SEG__ Chr18 {Canis lupus familiaris} MDGKNCSSVNEFLLVGISNKPGVKVTLFITFLIIYLIILVANLGMIILIRMDSQLHTPMYFFLSHLSFSDVCYSTAVGPRMLVGFIAKNKSISFYSCALQFLIFCIFADS
ECLLLAVMAFDRYKAISHPLLYTVSMSSRVCSLLMAGVYMVGIMDASVNTILTFRLCFCESNVINHFFCDVPPLLLLSCSDTQVNELVIFTIFGFIELITLSGLFVSYCY
IILAVRKINSAEGRFKAFSTCTSHLTAVAIFQGTLLFMYFRPSSSYSLDQDKITSLFYSLVIPMLNPLIYSLRNKDVKEALKKLK
121 >lcl|XP_003432486.1|Plus115090460..15091392 NW_876266 olfactory receptor 4C11-like LOC100686060 __SEG__ Chr18 {Canis lupus familiaris} MQQNNSVTEFILLGLTQDPMRQKMVFVIFSILYVGTVVGNLLIIVTIKSSRTLGSPMYFFLFYLSLADSCFSTSTAPRLIVDSLSAKKIITYNECMTQVFALHLFGSMEI
FVLILMAFDRYVAICMPLRYPTIMRRQVCTILIVLAWIGSFIHSTAQIILALRLPFCGPNLIDHYCCDLQPLLKLACMDTYVINLLLVSNSGAICSSSFVILMISYIVIL
HSLRNHSAEGKKKALSTCTSHIIVVILFFGPCIFIYTRPPTTFPMDKMVTVFYTIGTPFLNPLIYTLRNAEVKNAMKNLWHVKITSESKR*
122 >lcl|XP_003432487.1|Plus115116192..15117124 NW_876266 olfactory receptor 4C11-like LOC100686140 __SEG__ Chr18 {Canis lupus familiaris} MKQNISITEFILLGLTQDPMKKKVVFVIFFILYVGTLAGNLLIIVTIKSSRTLGSPMYYFLFYLSLADSCFSTSTAPRLIVDSLSTKNIITYNECMTQVFALHFFGCMEI
FVVIFMAVDRYVAICKPLRYLNIMNWQVCTILIVLAWIGSFIHSIAQIILALRLPFCGPNLIDHYCCDLQPLLKLACMDTYVINLLLVSNSGAICSSSFVILMISYIVIL
HSLRNHSAEGRKKALSTCTSHIIVVVLCFGPCIFIYTRPPTTFFMDKMVTVFYTIGTPFLNPLIYALRNAEVKNAMKKLWHIKITSESRR*
123 >lcl|XP_003432488.1|Plus1complement(15317594..15318526) NW_876266 olfactory receptor 4C11-like LOC100686285 __SEG__ Chr18 {Canis lupus familiaris} MQQNNSTTEFILLGLTQDPMKKKTVFVIFFIFYLGTVVGNLLIIVTIKSSRTLGSPMYYFLFYLSLADSCFSTSTAPRLIVDSLSAKNIITYNECMTQVFALHFFGCMEV
FVLLLMAFDRYVAICKPLHYPTIMSRRVCTILIVLAWVGSFIHSIAQIILALRLPFCGPNLIDHYCCDLQPLLKLACMDTYKINLLLVSNSGAICSSSFVILMISYIVIL
HSLRNHSAEGRKKALSTCTSHIIVVVLCFGPCIFTYTRPPTTYPMDKMMAVFYTIGTPLVNPLIYTLRNAEVKNAMQKLWHIKITSESRR*
124 >lcl|XP_003432489.1|Plus115383096..15384028 NW_876266 olfactory receptor 4C11-like LOC100686381 __SEG__ Chr18 {Canis lupus familiaris} MQQNNSVTEFILLGLTQDPMKKKMVFIIFFILYMGTVVGNLLIIVTIRFSRTLGTPMYYFLFYLSLADSCFSTSTAPRLIVDSLSAKKIITYNECMTQVFALHFFGCMEV
FVLILMAIDRYVAICKPLRYPTIMSRQVCTIMIVLAWIGSFFHSIAEVVPALRLPFCGPNLIDHYCCDLQPLLKLACMDTYLINLEWVSNSGAICTGSFVILMISYIVIL
HSLRNYSAEGKKKALSTCTSHIIVVIIFFGPCIFTYTRPPTTYPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLWRVKITSESRR*
125 >lcl|XP_003432490.1|Plus1complement(15438250..15439182) NW_876266 olfactory receptor 4C16-like LOC100686543 __SEG__ Chr18 {Canis lupus familiaris} MHLNNNVTEFILLGLTQDPVRKKIVFVTFLFFYLGTLLGNFLIITTIKTSQTLGSPMYFFLFHLSLSDTCFCTSIAPRMIVDALLKRATISFRECMIQVFSFHFFGCLEI
FILILMAADRYVAICKPLHYTTIMSRQVCAVLVAIAWVGSCVHSLAQIFLALSLPFCGPNVIDHYHCDLQPLLKLACADTHVINLLLVSNSGAICTLSFVMLMCSYVVIL
YSLRNHSAEGRRKALSTCMSHIIVVVLFFGPCIFLYTRPATTFPMDKMIAVFYTLGTPLINPLIYTLRNAEVKNAMKKLWRKKLISDDKR*
126 >lcl|XP_003432491.1|Plus1complement(15522362..15523294) NW_876266 olfactory receptor 4C16-like LOC100686691 __SEG__ Chr18 {Canis lupus familiaris} MHLNNNVTEFILLGLTQDPVRKKIVFVTFLFFYLGTLLGNFLIITTIKTSQTLGSPMYFFLFHLSLSDTCFCTSIAPRMIVDALLKRATISFRECMIQVFSFHFFGCLEI
FILILMAADRYVAICKPLHYTTIMSRQVCAVLVAIAWVGSCVHSLAQIFLALSLPFCGPNVIDHYLCDLQPLLKLACADTYVINLLLISNSGAICTLSFVMLMCSYVVIL
YSLRNHSAEGRRKALSTCISHIIVVVLFFGPCIFIYTRPATTFPMDKMIAVFYTLGTPLINPLIYTLRNAEVKNAMKKLWRKKLISDDKR*
127 >lcl|XP_003432492.1|Plus1complement(15724255..15725169) NW_876266 olfactory receptor 4C11-like LOC100687011 __SEG__ Chr18 {Canis lupus familiaris} MELNSSVNEFILFGLTQDVLKEKVVLVVFVFLYLATLLANLLIVITIRYSQTLGSPMYFFLFYLSFADACFSTTTAPRLIVDSVSKKKVISYNECMTQIFAFHFFGCMEI
LVLVLMSLDRYVAICKPLRYTTIMSRRVCGTLVNLAWVVSCIHSSAQIFLALKLPFCGPNVIDHYFCDMPPLLKLACMDTHATNLLIVFNSGAICTVSFMVLLTSYIFIL
HSLNNQSAEGRKKALSTCTSHIIVVILFFVPCIFTYTRPVTSFPADKMVAVFYTIVTPLLNPLIYTLRNAEVKNAMRKLWCNKL*
128 >lcl|XP_003432493.1|Plus1complement(15733548..15734483) NW_876266 olfactory receptor 4C15-like LOC100687099 __SEG__ Chr18 {Canis lupus familiaris} MQNQSFVTEFVLLGLSQNPNVQKIVFVVFLFGYIATVGGNLLIVVTISSSPALLGSPMYFFLAFLSFLDACFSTVIAPKMIVDSLYERKTISFGGCMTQLFAEHFFAGVE
VIVLTAMAYDRYVAICKPLHYTTIMNWRLCSILMGIAWMGGFLHSMIQILFTFQLPFCGPNVIDHFMCDLYPLLELACTDTHIFGLLVVANSGSICIIIFSLLLVSYVVI
LLSLRTHSPEGQRKALSTCGSHIAIVVLFFVPCIFVYARPPSAFSFDKMVAIFYTILTPLLNPLIYTFRNKEMKNAIKKVWSRVMMVCSDK*
129 >lcl|XP_003432494.1|Plus116112448..16113377 NW_876266 olfactory receptor 4C45-like LOC100687696 __SEG__ Chr18 {Canis lupus familiaris} MERMNNVTEFVLLGLTQNPELQKFLFAVFLITYLITLAGNLLISVTIFISPALGSPMYFFLSYLSIIDGLYSSSIAPKMIFDLISEQNTISFNGCMTQLFAEHFFAGAEI
ILLIAMAYDRYVAICKPLHYMTIMSRPVCGFLVGMAGILGFVHGGIQVLFMIQLPFCGPNVIDHFLCDLIPLLELACADTHTLGPLVSANSGSLCLLTFSMLVASYIVIL
RSLRTHSSEGRRKALSTCASHVTVVILFFVPCSFLYLRPTTSFPADKAVTVFCTLVTPMLNPLIYTLRNSEVKNVMKKLWGQIMKTGDK*
130 >lcl|XP_003432517.1|Plus1complement(22980029..22981048) NW_876267 uracil nucleotide/cysteinyl leukotriene receptor-like LOC100688664 __SEG__ Chr19 {Canis lupus familiaris} MNGIEVASSGLTANSSLATAQQCGQETPLENILFASFYLLDFILAFVGNALALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIPCRLTGFL
FYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVICLQLYREKASHHALVSLAVAFTFPFVTTVTCYLLIIRSLR
QGPRVEKRLKNKAVRMIAMVLTIFLVCFVPYHVHRAVYVLHYHGGGTSCATQRILALGNRITSCLTSLNGALDPVMYFFVAEKFRDALCNLICGKRLSGPPPSFEGKTNE
SSLSARSEL*
131 >lcl|XP_003432671.1|Plus1complement(30013395..30014396) NW_876270 hypothetical protein LOC100684457 LOC100684457 __SEG__ Chr1 {Canis lupus familiaris} MPCPRPPWLPRPRTPQGSSPSSPSSLSATRSPSREGGEDDDGEEEEGDSSPVLGPILPSASPVECLICVSPFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGDAVACP
VCRAPTRLAPRRGLPALPTQPGLLPRDAHVAPPRQGSVRFDRRRGLLYLRPPPPPPGPRKFRAARPPPPPPPLRLGRPLSRRLSWTSPAWAFNAAVALAVLVAAGLVVSG
VYIFFLIPHATSSGPARPQLVALAPASGFSWFPPQPASGTPWTPAWTPRPVGPDQDTALPGAAEDVLEPEGVSEDTAEVEGTLDRPPDGLWGAEGEPGRAPRGWSRRRVW
GPQ*
132 >lcl|XP_003432798.1|Plus1complement(13619044..13621194) NW_876271 leucine-rich repeat neuronal protein 1 LRRN1 __SEG__ Chr20 {Canis lupus familiaris} MARMSFVLAACQLVLGLLMTSLTVSSLQNSECPQLCVCEIRPWFTPQSTYREATTVDCNDLRLTKIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNI
KEVGLANLTQLTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISANAFSGLKNLLRLHLNSNKLKVIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLSNLRSL
VLAGMYLTDIPGNALVGLDSLESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGELVSVDRYALDNLPELTKLEATNNPKLSYIHR
LAFRSVPALESLMLNNNALNAVYQKTVESLPNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYRGQQVKEVLIQDSSEQCLPMISHDTFPNHLNMDIG
TTVFLDCRAMAEPEPEIYWVTPLGNKITVDTLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVEGADTRVVTIKVNGTLLDGTQVLKIYVKQTESHSILVSWKVNSNVM
TSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSNIHQQTQKSCVNVTTKNAAFALDISDQETSTALAAVMGSMFAVISLASIAVYIAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW*
133 >lcl|XP_003432888.1|Plus122276031..22276963 NW_876272 olfactory receptor-like protein OLF4-like LOC100686014 __SEG__ Chr20 {Canis lupus familiaris} MESDNDTRISEFLLLGFSGESELQPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLTNLSFVDICFISTTVPKMLQNIQTGSKVITYPGCITQIYFFLLFAGC
DDFLLSMMAYDRFVAICHPLHYTVIMNPWFCVLLVLVAWITSVLNSLLQSLMVLQLSFCAGMEIPHFFCDLNQVIGHACSDRFLNEVVMYFATVLLGVAPLPGILFSYSK
IVSSICGISSIQGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAVPQGSHASVVASVMYTVVTPMLNPFIYSLRNRDIKRALKRIIGVPVM*
134 >lcl|XP_003432890.1|Plus122454199..22455167 NW_876272 olfactory receptor-like protein OLF4-like LOC100686724 __SEG__ Chr20 {Canis lupus familiaris} MEKGNDTQISAFLLLGLSEEPEIQPLLFGLFLSMYLITVFGNLLLILAISSDSHLHTPMYFFLANLSFVDICFTSTTVPKMLQNIQTHSKVITYAGCITQMYFFILFVVL
DAFLLTVMAYDRHVAICQPLHYMVIMKTQLCALLVLLSWIVSVLYSLLQTSMVLRLSFCTEMAIPHFFCELNQVIQLACSDTFLSNMVMYFAAMFMATGTFFGILYSYSK
IASSIHRISSALGKSKAFSTCASHLSVVSLFFCTSLGVYLSSAAPQSSHSTAVASVMYTVVTPMLNPFIYSLRNKDIKKALMRFSGMAGLKVTTILELKNHP*
135 >lcl|XP_003432891.1|Plus122547895..22548827 NW_876272 olfactory receptor 7A17-like LOC100687134 __SEG__ Chr20 {Canis lupus familiaris} MKPGNDTQISEFLLLGLSEEPELQPLIFGFFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLANLSFVDICFTSTTVPKMLWNIQTQSKVITYAGCITQIYFLIVFAVL
DVFLLSMMAYDRYVAICHPLQYTVIMNPRVCGLLVLVSWIICVLQSLLQTSMVLRLSFCAVVEIPHFSCELNQMIQVACSDTFLNNLMVYFAAVLLVGGSLAGILYSYSR
IVSSILGISSARGKYKAFSTCASHLSVVCLFFCTSLGVYLSSAVSQSSHSTAVASVMYTVVTPMLNPFIYSLRNKDIKRALKRTVGIPVM*
136 >lcl|XP_003432892.1|Plus122559118..22560086 NW_876272 olfactory receptor-like protein OLF4-like LOC100687211 __SEG__ Chr20 {Canis lupus familiaris} MQPNNDTWISEFFLLGFSEGPDWQPLVFGLFLSMYLITVFGNLLIILAISSDSHLHTPMYFFLANLSFVDICFTSTTVPKMLLNIQTQSKVITYAGCITQMYFFIIFSGL
DIYLLAVMAYDRFVAICHPLHYMVIMNPRLCGLLVLVSWIISVLHSFLQTSMVLQLSFCTEVEIPHFFCELNHMIQLACSDIFLNNMMIYFAAVLLGGVPLAGVLYSYSK
IVSCIHRISSAQGKHKAFSTCASHLSVVSLFYCTALGVYLSSAAPQSSYTSAVASVMYTVVTPMLNPFIYSLRNRNIKRALMKFSGLEAIKRPVVLLLKNFP*
137 >lcl|XP_003432904.1|Plus126093730..26094665 NW_876272 olfactory receptor 7D4-like LOC100684808 __SEG__ Chr20 {Canis lupus familiaris} MEAGNHTRVSEFFLQGLSDDPELQPFLFGLFLFMYLVTMLGNLLIILAILSDSHLHTPMYFFLSNLSSVDICFISTTVPKMLVNIQTHSKDISYTGCLIQVYFFMIFAGM
DGFLLTVMAYDRFVAICHPLRYTIIMNPRLCGLLVLMCWFIIFWVSLIHVLLVRQLTFCPGTEIPHFFCEVVQILKVACSDTLINNIFLYVSTVILGVFPLSGIFFSYSL
IVSSLMKMSSAAGKYKAFSTCGSHLSVVSLYYGTSLGLYFSPSATHSSQSSIGSVMYTVVTPMLNPFIYSLRNKDVKGALARLHSRGTLCM*
138 >lcl|XP_003432905.1|Plus126215036..26216028 NW_876272 olfactory receptor 18 TPCR62 __SEG__ Chr20 {Canis lupus familiaris} MLIYLFHFSNPLFFFKRCPSYIEPQNLTSVSEFFLMGLSDDPELQPLLFGLFLSMYLVTVLGNLLIILAVSSDSHLHIPMYFLLSNLSLADIGFTSTTVPKMIMDIQTQS
RVISYVGCLTQMSFFMLFGCLDSLLLAVMAYDRFVAICHPLHYLIIMNPRLCGLLVLASFLISLLVSQMHNSIVLQLTYFKDVEISHFFCDPSQLLNLACSDTFINNIVM
YFVGAISGFLPISGIFFSYYKIVSSILRVPSTGGRYKAFSTCGSHLSVVCLFYGTGLGVYLSSAVSLSPRKDAVASVVYTVVTPMLNPFIYSLRNRDIKRAMWRLFSKTI
*
139 >lcl|XP_003432906.1|Plus126224672..26225661 NW_876272 olfactory receptor 18-like LOC100685285 __SEG__ Chr20 {Canis lupus familiaris} MLIYLFHFSNPFFFFERCLGYKEQNLTSVSEFFLTRFSDDLELQPLFFGLFLSMYLLTVLGNLLIILTVSSDSHLHTPMYFFLSNLSLADIGFTSTTVPKMIMDIQTQSR
VISYVGCLTQMSFLILFGCMDGMLLTVMAYDRFVAICHPLHYSIIMNPRLCGLLVLVSFLVSLLDSQLHSLIVLQLTCFKDVEISNFFCDPSQLLNLACSDTFTNNIVMY
FVGAISGFLPISGIFFSYYKIVSSILRVPSTGGRYKAFSTCGSHLSVVCLFYGTAIGVYLGSALLPSPRKDIVASVMYTVVTPMLNPFIYSLRNRDIKSALWRFLRRTA*
140 >lcl|XP_003432907.1|Plus126235678..26236715 NW_876272 olfactory receptor 7E24-like LOC100685360 __SEG__ Chr20 {Canis lupus familiaris} MNCLNSKYRHTDRSQYTCFLYLNSHLFLKSCLCYTEPQNLTDVLEFFLLGFSEDPELQPVIFSLFLSMYLVTMLGNLLILLAVSSDSCLHTPMYFFLSILSLADIGFIST
TVPKVILDIETHNRVISHVGCLIQLSFFNLFGCLDSVLLTVMAYDRFVAICYPLHYPVIMNPRLCSLLILISFLISLLDSQLHCLMMSQLTFCINVEIPHFFCDPPQLLK
LSCNDTSTTKIFMCFLGAIFGGIPVSGILFSYTRIVSSILRVPSTGGKYKAFSTCGSHLSVVILFYGTGLGVYLSSTISHSPRKDAVASVMYAFIVPMLNPFIYSLRNKD
IKSALQRLLNRKAQS*
141 >lcl|XP_003432908.1|Plus126396292..26397230 NW_876272 olfactory receptor 7G3-like LOC100685759 __SEG__ Chr20 {Canis lupus familiaris} MTSGNLSDPTEFLLLGLSEDPELQPLLFFLFLSMYLVSVLGNLLIILAILYDFHLHTPMYFFLSNLSFVDICFTTTTIPKMLVNIRTHSKSITYTGCLTQICFVLTFAGL
ENGILVMMAFDRFVAICHPLRYNVIMNPKLCRLLVLLSFLISVLDALLHTLMALRLSFCTDLEIPHFFCELAHILKLACSDILINNILVYLVTSLLGVIPLSGIIISYTQ
IVSSVLKIPSAGGKYKAFSICGSHLIVVSLFYGTGFRVYLSSAATHSSRKSAIVSVMYTVVTPMMNPFIYSLRNKDMMGALRKLISRISYFH*
142 >lcl|XP_003432909.1|Plus126399350..26400384 NW_876272 olfactory receptor 7G1-like LOC100685848 __SEG__ Chr20 {Canis lupus familiaris} MVLVLGDILATCPGANISLSCYHIISIRFINNMEPRNETVIIEFLLMEVTDNPELQSLIFILFLFMYLVTVLGNLLIILAVISDSHLHIPMYFFLFILSFTDICLSTTTI
PKILVNIHTQNQSITYAGCLTQICFVMVFASLDSCILSVMAYDRYVAICHPLRYTVIMNSHLCGLLILLSLFISIVDALIHNLMVLHLSFCTELEIPLFFCEVIQVIKIA
CSDTLINNILIYFATSIFGGIPLCGIIFSYTQVVSSVLRMSSAGTKYKAFSTCGSHLSVVSLFYGTAFGVYISSALTSSSRNTAVVSMMYTVVPQMMNPFIYSLRNRDMK
GALRKLISRMPSLL*
143 >lcl|XP_003432936.1|Plus118550662..18551483 NW_876272 testis-specific serine/threonine-protein kinase 6 TSSK6 __SEG__ Chr20 {Canis lupus familiaris} MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGS
QARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGL
PRRQKRGVLYPDGLEVSERCRALIAELLQFSPSARPSAGQVARNGWLRAGDSG*
144 >lcl|XP_003432987.1|Plus146788467..46788787 NW_876273 28S ribosomal protein S33, mitochondrial-like LOC100687135 __SEG__ Chr21 {Canis lupus familiaris} MSSLSEYALHMTGLSAWLFGEIARPTDSKSMKVVKLFSEQPLAKRKETSDWYPNHNTYFALMGTLRFLGLYRDEHQDFKDEQLCLKKLHGKGKPRKGEGKRATKKK*
145 >lcl|XP_003432998.1|Plus1complement(13111117..13111638) NW_876273 protein tyrosine phosphatase type IVA 1-like LOC100686097 __SEG__ Chr21 {Canis lupus familiaris} MAPASRPGPVQVPIRNMRFLTTHGPTGATLNTFIAELKKYGVTTIVRVCGATYDTALVEKEGIQVLDWPFGDGSSPSNQIVDDGLSLVNVRFREEPGCCIAVHCVAGLGR
TPVLVALALTEGGMKNEDAVQFIRPKRRGAFNSKQLLDLEKCRSQMRLRYKDPSGHRNNCCIQ*
146 >lcl|XP_003433004.1|Plus127110614..27111558 NW_876273 olfactory receptor 51F2-like LOC100683965 __SEG__ Chr21 {Canis lupus familiaris} MPFFNQSIFHPAVFLLTGIPGFESYHAWLSIPFCCLYAIAISGNGMILFVILTESSLHEPMYYFLSMLSFTDLGLCLSTLVTMLRIFWFNAQEISFDACISQMFFIHGFT
FMESSVLLVMAFDRFIAICNPLRYATILTNSRIIKVGFAIVIRGTTALVPLLLLLKRLSFCRSHVLHHSYCFHPDVMKLSCTDTKINSAFGLAIVISTAGIDSVLILLSY
VLIIHSVLSIASPKERKKAFGTCVSHISAVAIFYIPMISLSLVHRFGKHAPPLVHTLIANVYLLIPPVMNPIIYSVKTKQIRKAVLKIFLSKLI*
147 >lcl|XP_003433005.1|Plus1complement(27153567..27154544) NW_876273 olfactory receptor 51F1-like LOC100684107 __SEG__ Chr21 {Canis lupus familiaris} MLQIQENMQILSNLTSKFPTFLLAGIPGLESAHVWISIPFCCLYTTALSGNSMILFVIITQKSLHEPMYYFLSMLSAADLGLTVSTMSTTLSILWFDAIEINLDTCIIQM
FFLHGFTFIESGVLVAMAFDRYVAICDPLRYTTLLTNSRIIQMGLLMTIRTLVLVVPPLLLLKPLYFCRTNVLSHSYCYHPDVIKLACSDTWANSICGLIDLILTTGIDT
PCIILSYILIIHSVLSIASPEERHKVFNTCISHIGAVAVFYIPMMSLSLVHRYGPSAPKIVHLMMANIYLLLPPVLNPIIYSVKTKQIRKAIYSVFSLQNKQMIA*
148 >lcl|XP_003433010.1|Plus1complement(27385917..27386882) NW_876273 olfactory receptor 51S1-like LOC100684755 __SEG__ Chr21 {Canis lupus familiaris} MSTFNQAVHNNTSMAPTFLLVGMPGLSAVPSWWTIPLITIYLLSALGNGTILWIIALDPTLHRPMYFFLFLLSVSDVGLATALMPTLLGLALAGVHAVPASACLLQMFFV
HVFSVMESSVLLAMALDRALAICRPLHYPTLLTNDVISKIGLAIAFRCLGLHLPLPFLLAHMPYCHPQVLTHSYCLHPDIAHLACPGAWGAFYSLFVVLSAMGLDPLLIF
FSYGLIGRVLQGLGSSEDRWKAGQTCAAHLSAVLLFYMPMIFLALIDRLRVPIPQPAHTLLSYIHFLLPPLINPILYSVKMKEIRERILKKLQPRKVGCVQ*
149 >lcl|XP_003433011.1|Plus127584245..27585186 NW_876273 olfactory receptor 51A7-like LOC100685464 __SEG__ Chr21 {Canis lupus familiaris} MSAFNTSEVEISTFFLIGIPGMKHAHIWVSIPICLMYLLAILGNCTILFFIKTETSLHEPMYYFLSMLAFSDLGLSISSLPTMLRIFLFNATGISPDACFAQEFFIHGFS
AMESSVLFIMSIDRLIAICNPLKYTSILNSVRVFKIGLVSAIKSLLLVFPFPFILKRLRFCKKSLLSHSYCLHQDVMKLACSDNRVNVIYGLLVALTAMLDLVCIAVSYM
LIMKIVLGITSHKGCLKVLNTCISHICAVLIFYVPIITLAIIHRFAKNVSPVVRVVIADTFLLVPPLMNPLVYSVKSHQIRNLILMKLCEIKG*
150 >lcl|XP_003433017.1|Plus1complement(27738090..27739037) NW_876273 olfactory receptor 52E2-like LOC100686385 __SEG__ Chr21 {Canis lupus familiaris} MVDFNSTTFTNPSTFFLMGIPGLEDLHIWISIPFCSMYIVALLGNIFILFIIKTETALHEPMFYFLSMLAITDLTLSTSTLPKMLGIFWFSDHEISFHACLTQMFFIHAF
SGVESGLLVAMALDRYVAICNPLRHSSILTNSVVAHVGMVALLRGLVLMTPHPFLVRRWPYCQSNVVPHTYCEHMAVVKLACADISINSLYSLAVIILIVGTDVTCISLS
YVQILRTVFNLPSNDARLKTLSTCGSHVCVILTFYIPALFSFLTHRFSKHIPLHTHTLLANMYLLVPPMLNPIIYGVRTRHIRECVLQLFMTKIN*
151 >lcl|XP_003433020.1|Plus1complement(27879074..27880042) NW_876273 olfactory receptor 51G1-like LOC100687101 __SEG__ Chr21 {Canis lupus familiaris} MTGSNSSTEQSVLFYLTGIPGYENINHFISIPFCMCYLIGVVGNCTILYIIRTDKSLHKPMYYFLAMLSLTDMGMSFSTLPTVLKIFWFDAREIEVNACVAQMYFIHTFS
LMESAVLLAMAFDRYVAICHPLRYSSKLTPQCIIYIGVFIIFRCSIVLPVVLVRIPTFSFCHSHILYHSFCLHQEVIHLACADISFNILYGLFVIAFYWGVDSLGILLSY
AFIFHSVLGIASQGGKLKALNTCASHICAVLILYVPMIGLSLVHRFAKHSSPIVHITMANIYLLIPPVLNPIIYSIKTKQIRQGFLRILAPKKVGFSHTWKG*
152 >lcl|XP_003433021.1|Plus127894233..27895192 NW_876273 olfactory receptor 51L1-like LOC100687182 __SEG__ Chr21 {Canis lupus familiaris} MATLNSSNSLSSTFYLTGIPGYEEFHHWISIPFCLLYLVGIMGNCTILHIVRTDPRLHEPMYYFLAMLSLTDMGMSMPTMISLFRVLWSISREIQFNICVVQMFFIHTFS
FTESSVLLAMAFDRYVAICHPLRYATILTPRLIIKIGLAALLRSAFAMIPLLARLAFFPFCHSHILSHSYCLHQDMIRLACADTMFNIIYGLILVIVLWGMDSLGIFVSY
MYILHSILRIASREGRLKALNTCASHICVVLILYVPMIGLSIVHRFAKHSSPLIHIFMAHIYLLVPPVLNPIIYSVKTKQIRQGVLHLLFPTKISSTMM*
153 >lcl|XP_003433023.1|Plus1complement(27995217..27996185) NW_876273 olfactory receptor 51G2-like LOC100687815 __SEG__ Chr21 {Canis lupus familiaris} MLSINSTKAVFSTFLVTGIPGLEAVHIWISIPFSTMFFITLVGNVTILTVICRERTLHVPMYLFLAMLAVSDLGLSLFTFPTMLRIFWLDTRELTFSACFTQMFFIHTFQ
DFESAIILAMAFDRYVAISHPLRYSSILTSSAISRIGLAIVVRTLTVQVPLPILLRRLCFCHSNVLSHSYCLHPDIIKLSCSNTRINSIFGLFVVLSTMGLDFLLILFSY
ILILKTVLSIASSGGRLKALNTCISHICAVILFFTPMICLSILHRFGPKLPSHIYVTMANMHFLIPPVMNPIVYVAKTKQIRDKILKVFIKKEPESQVTFIT*
154 >lcl|XP_003433026.1|Plus1complement(28380136..28381074) NW_876273 olfactory receptor 51B5-like LOC100683161 __SEG__ Chr21 {Canis lupus familiaris} MWPNSSSSSFLLTGFPGLEAVHHWISTPFFFIYVSILLGNSTLLLLIKEDHNLHEPMYYFLAMLAATDLGLTLTTMPTVLGVLWLDHREIGKVACFSQAYFIHSLAFVES
GVLLAMAYDRFIAICNPLRYSSILTNNQVLKIGLGVLMRGFISVVPPILPLYFFPYCHSHILSHAFCLHQDVIKLACADTTFNRLYPVVLVVLIFVLDSLIILISYVLIL
KRVLSIASKEERAKTLNTCVSHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLTMSYIYFIFPPLMNPIIYSVKTKQIQIGIFRLFTTHRIKV*
155 >lcl|XP_003433027.1|Plus128406110..28407048 NW_876273 olfactory receptor 51B6-like LOC100683227 __SEG__ Chr21 {Canis lupus familiaris} MELNTSATPFLLTGFVGLEKAHHWISIPLSVVYISILLGNGILLFLIRVDHNLHEPMYYFLALLATTDLGMTLVTMPTVLCVMWINHREVSHGICFLQAYFIHSLSMIES
GILLAMAYDRFIAIRNPLRYTSIITNIQVLKIGVGVFMRGFVLILPPILPLYWFSYCRSHVLSHAFCLHQDVIKLACADITFNRLYPVVVVFSMVLMDCLIIFCSYILIL
QTVMSIASEEERSKALNTCVSHICCILVFYVTVFGLTFIHRFGKNVPHLVHIIMSYIYFLFPPFMNPIIYSIKTKQIRGSILQLFSLSPPRT*
156 >lcl|XP_003433028.1|Plus128709588..28710532 NW_876273 olfactory receptor 51I2-like LOC100684033 __SEG__ Chr21 {Canis lupus familiaris} MGSFGTNISSTTSFSLTGFPEMEGLQHSLAALLLLLYAISILGNILILVIIKEEQSLHQPMYYFLSLLSVNDLGVSFSTLPTVLAALCFHAPEIAFDACLTQMFFIHFFS
WTESGILLAMSFDRYVAICNPLRYSSVLTDIRVAHMGISIIIRSFCMVFPLPFLLKRLPFCKANVLTHSYCLHPDLIRLPCGDTTINSMYGLFIVISAFGVDSVLILLSY
VLILHSILAIASQEERLKTLNTCVSHICAVLIFYVPMVSVSMVHRFGKHAPEYMHKFMSLVYLFVPPMLNPIIYSIKTKEIRKRLYKMFLKPNI*
157 >lcl|XP_003433031.1|Plus1complement(29229066..29230019) NW_876273 olfactory receptor 52E8-like LOC100685391 __SEG__ Chr21 {Canis lupus familiaris} MPERMATPNDTQFHPSSFLLLGIPELEDVQFWIGFPFFFVYLVALLGNAAVLFVIQTEHSLHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFSLRDISFESCLSQMFFI
HFFTVMESIVLVAMAFDRYIAICKPLRYTMILTSKIIIIIAGIAILRSLCMVIPLVFLLLRLPFCGHHIIPHTYCEHMGIARLACASIKVNILFGLGNISLLLLDVLLII
LSYVRILHAVFCLPSREARLKALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIFLANLYVVVPPAFNPVIYGVRTKQIRERVLRVFFRTES*
158 >lcl|XP_003433033.1|Plus1complement(29325753..29326700) NW_876273 olfactory receptor 56A3-like LOC100686119 __SEG__ Chr21 {Canis lupus familiaris} MTAHQNGTISTGASEFLLNCFVRSPTWQLWLSLPLGLLFLVAMGANGVLLITIWLEASLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLKSISFDACFLQMFIMNF
FYAMESCTFMVMAYDRYVAICHPLRYPSIITEQFVAKAAIFILARNAISTLPIPILSSRLHYCGRNVIENCICANMSVSKLSCDDVTINRLYQFAGGWTLLGSDLVLIFI
SYSLILQTVMGLKAEGAMAKALSTCGSHFILILFFSTVLLVFVLTHMVTKNVSPDVPVLLNVLHHVIPAALNPIVYGVRTQEIKQGIQRLLKKGW*
159 >lcl|XP_003433040.1|Plus1complement(30432722..30433666) NW_876273 olfactory receptor 6-like LOC100688668 __SEG__ Chr21 {Canis lupus familiaris} MLEKNITLVSEFILVGFPTAPWIQVLLFFLFLVVYLLVVVENLIIMLTVWITASLHKPKYYFLSSLSFLEVWYVSVTVPKMLDGFLLQRRHISFTGCMTQLYFFISLACT
ECVLLAAMAYDRYVAICHPLQYPIIMTTGYCVQLVAFSYVSGFMVSVIKVYFISHVAFCGSNVMNHFFCDISPILKLACKDMSTAELVDFALAIIILVLPLFTTILSYVY
IVSTILRIPSTQGRKKAFSTCASHLTVVIIYYTAMIFMYVRPRAIASFNSNKLISAVYAVLTPMLNPFIYCLRNQEVKNAIKKTMGVGQCLLFS*
160 >lcl|XP_003433041.1|Plus130500937..30501890 NW_876273 olfactory receptor 10A5-like LOC100688800 __SEG__ Chr21 {Canis lupus familiaris} MAGGNWTRVEEFILMSFSSLPTEIQSLLFLTFLIIYLVTLMGNTLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFFFFFGV
DECFLLATMAYDRYVAICSPLHYPVIMNQRTRAKLAVASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTALFEIYAIVGTILFVMTPCLLILCSYT
RIAAAILKIPSAKGKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNNEVKNAFGRTFRKALGLRNCIS*
161 >lcl|XP_003433042.1|Plus1complement(30536550..30537497) NW_876273 olfactory receptor 2D2-like LOC100688871 __SEG__ Chr21 {Canis lupus familiaris} MREANQTKVTEFLLLGLSDDPHTQKLLFILFLGVYLVTVLANLLLMHLVQADSRLHTPMYFFLCNLSLADLCFSTNIVPQALVHLLSRKKIISFTRCAAQLLLFLIFGGT
QCALLAVMSYDRYVAICNPLHYPRIMTWRVCVQLAVGSWTSGILVSVVDSTFTLRLPYRGSNSIAHFFCEAPALLMLASTDTHTSEMAIFLMGVVILLIPVSLILVSYGH
IIVTVFRMKSAIGRRKAFSTCGSHLMVVILFYGSAIFTYMIPKSSKEQEKLVSVFYAMMTPMLNPLIYSLRNKDVKGALRKVATRNFPCRLEICH*
162 >lcl|XP_003433043.1|Plus1complement(30803020..30803967) NW_876273 olfactory receptor 2D2-like LOC100682782 __SEG__ Chr21 {Canis lupus familiaris} MRAANQTQVTEFLLLGLSDDPHTQKLLFILFLGVYLVTVLANLLLMRLVQADSRLHTPMYFFLCNLSLADLCFSTNIVPQALVHLLSRKKIISFTRCAAQLLLFLIFGGT
QCALLAVMSYDRYVAICNPLHYPSIMTWRVCVQLAAGSWTSGILVSVVDTTFILRLPYRESNSIAHFFCEAPALLILASTDTHTSEMAIFLMGVIILLIPVSLILVSYGH
IIVTVVRMKSSVRRLKAFSTCGSHLMVVILFYGSGIVTYMTPKSSKEQKKLVSVFYAMVTPMLNPLIYSLRNKDVKGALRKVATRNFPCRLEICH*
163 >lcl|XP_003433045.1|Plus1complement(31594094..31595038) NW_876273 olfactory receptor 478-like LOC100683576 __SEG__ Chr21 {Canis lupus familiaris} MDSLVDGNHTAVTGFILLGLTEDPVLRVILFMTILCIYLVTVSGNLSTIILIRFSSQLHHPMYFFLSHLALADLGYSSSVTPNMLINFLVERNMISYLGCAIQLGSVVFF
GSSECFLLAAMAYDRFMAICNPLLYSTKMCTQVYVRLLTVTYLGGFLNACSFTISFSFLLFCGPNQVNHFFCDFAPLVKLSCSDSRIPAVVPSFTAGSIIVVTMCVIVIS
YICILITILKMSSTEGRHKAFSTCTSHLTVVTLFFGTITFIYVMPKSCYSTDQNKVVSLFYMVVVPMLNPLIYSLRNNEMKGALKRELGRKIFP*
164 >lcl|XP_003433062.1|Plus1complement(27050016..27050978) NW_876273 olfactory receptor 51I2-like LOC100688470 __SEG__ Chr21 {Canis lupus familiaris} MLLSHSYVNISFFQPHAFLMIGIPGLEAVHGWISIPFSFMYTVALTGNCLILLAVRRTPSLHQPMYYFLSMLALTDVGLTLSTLPTTLAVLWFNYRHIGFNACLVQMFFL
HSFSVVESSVLLAMSFDRFVAISNPLHYAAILTNNVIIRIGLAIVARATLSLFPVPFLLKRLNFCPDKILLSHSFCFHPDVMRRACADITINIHYGLYVVLSTGGIDSLF
IILSYVLILHTVLGLASPRERIRAFNTCVSHILAVFVFFIPGITMSMIHRFGRHLPTVVHALVAYVYLVVPPVLNPIIYSVKSKPIREAMIRMLKRKGQG*
165 >lcl|XP_003433063.1|Plus1complement(27093876..27094820) NW_876273 olfactory receptor 51F2 cOR51C4 __SEG__ Chr21 {Canis lupus familiaris} MPNFQNTTSTSIIFLLTGVPGLEAFHTWISIPFCFLYITALSGNSLILFAIVTQPSLHEPMYYFLSMLSTTDLGLSISTLVTMLGIFWFNAREISFNACLSQMFFIKLFT
VMESSVLLAMAFDRFVAISNPLRYATILTDSRIAQIGVTIVIRGTLMLTPMVALLKRLSFCRSHVLHHSYCFHPDVMKLSCTDTRINNAVGLTAMISTVGVDSILILLSY
ILIIKTVLSIASPEERKKAFSTCISHIGAVAIFYFPLISLSFVHRFGKRAPAYVHTMIANTYLLIPPVMNPIIYSVKTKQIRRAVIKILYSKDM*
166 >lcl|XP_003433064.1|Plus127379692..27380633 NW_876273 olfactory receptor 51A7-like LOC100688692 __SEG__ Chr21 {Canis lupus familiaris} MFALNTSEVEISTFLLIGIPGLEHVHIWISIPICFMYLLAILGNCTILFVIRTEPSLHEPMYYFLSMLALSDLGLSFSSLPSMMRIFLFNAMEISADACIAQEFFIHGFT
DMESSVLLIMSFDRFLAIRNPLRYSSILTSSRVLHIGLTFAIKSILLVLPLPFTLKRLQYCNKRLLSHSYCLHQDVMKLACSDNRVNFYYGLFVALCMMSDSVFIAVSYV
FILKTVLGIASHGERLKALNTCVSHICAVLIFYVPIITLATMHRFAKHKSPLAMILIADAFLLVPPLMNPIVYCVKTRQIRVKVLEKLSLKSK*
167 >lcl|XP_003433065.1|Plus1complement(27453069..27454004) NW_876273 olfactory receptor 51A7-like LOC100688896 __SEG__ Chr21 {Canis lupus familiaris} MYALNSSKIEITTFFLIGIPGLEHVHVWISVPICFMYLVAILGNCTILFVIRTEPSLHAPMYYFLSMLAVSDLGLSLSSFPTMLRIFVFNATGISPNACFAQEFFIHGFT
DMESSVLLVMSFDRFLAIRNPLRYSSILTNARVAKMGLVFLIKSMLLVLPFPFTLKKLTYCRKSLLSHSYCLHQDVMKLACSDNTINFFYGFFVALCMMSDSVFIAVSYI
FILKTVMGIGSHKERLKALNTCVSHICAVLIFYVPIIALASMHRFGKHKSPVAMILIADIFLLVPPLMNPIVYCVKTRQIREKVWGKLGLK*
168 >lcl|XP_003433069.1|Plus1complement(28346123..28347058) NW_876273 olfactory receptor 51B4-like LOC100684060 __SEG__ Chr21 {Canis lupus familiaris} MWSNNSAAPFLLTGFLGSEAIHHWISIPFFMIYFFILLGNGTLFFLIWNDSSLHEPMYYFLAMLAGTDLGMTLTTMPTVLGVLLLDQREISQGACFTQSYFIHTLAIVES
GVLLAMAYDRFIAIRTPLRYNSILTNSRVMKVGLGVLMRGFMSIVPPIMPLYWFPYCRSHVLSHAFCLHQDVMKLACADITFNRVYPVILVALTFFLDALIILFSYILIL
KTVMGIASREERAKALNTCVSHISSVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSMKTKQIQRGFIRLFSLHNRA*
169 >lcl|XP_003433070.1|Plus1complement(28372207..28373139) NW_876273 olfactory receptor 51B2-like LOC100684132 __SEG__ Chr21 {Canis lupus familiaris} MWPNISAAPFLLTGFPGLEIFHPWISISFFVIYVSILLSNGTLLFLIREDHTLHEPMYYFLAILAATDLGVTLTTMPTVLGVLWLDHRAISHEACYFQAYLIHSLSIVES
GVLLIMAYDRFIAIRNPLRYTSILTNAKVVKIGLGILMRGFILIVPIIITLSGFPYCKSHVLSHAFCLHQDVIKLACADITFNRIYPIVLVSLTGFLDSILILISYILIL
NTIMGIASGKERAKALNTCVSHISCVLVFYVTVTGLTLIHRFGKYVPHIVHIIMSYIYFLFPPFMNPIIYSIKTKQIRNGINHLLSFHRI*
170 >lcl|XP_003433071.1|Plus128605196..28606152 NW_876273 olfactory receptor 52H1-like LOC100684706 __SEG__ Chr21 {Canis lupus familiaris} MSAMIIFNLSNYNPGPFILVGIPGLEHCYVWIGIPFCIIYVVALVGNCTLLYLITVERSLHEPMFFFLSMLAMTDLILSTAGVPKSLSIFWLGAREITFPGCLTQMFFHH
CSFVLDSAILMAMAFDRYVAICSPLRYTTILTPRTITKIAVGISFRSFCIILPDVFLLTRLPFCRTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIA
VSYTLILCAVFRLPSRDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYIVIPPALNPIVYGVKTTQIRHKVILLFSTKGSE*
171 >lcl|XP_003433074.1|Plus128935292..28936242 NW_876273 olfactory receptor 52D1-like LOC100685491 __SEG__ Chr21 {Canis lupus familiaris} MLSASVTNDTAFHPSTFILLGIPGMQDQHMWAAIPFCSMYILALVGNGTILYIIMTDRTLHEPMYLFLCLLSITDLILCSTTLPKMLTIFWLRSHIISYHGCLTQMFFVH
TIFATESAVLLAMAFDRYVAICRPLHYTSILNATVIGKIGLACVVRGLLFVFPFVILIERLPFCGHHIIPHTYCEHMGIAKLACASIKPNTIYGLTVALSVTGMDVVLIA
TSYGLILRAVLRLPSKDAQFRAFSTCGAHICVILVFYVPAFFSFFTHRFGHQVPPHVHIVLANLYLLVPPVLNPLVYGINTKQIRLRIFGFFMGRR*
172 >lcl|XP_003433076.1|Plus129111796..29112755 NW_876273 putative olfactory receptor 56B2-like LOC100685902 __SEG__ Chr21 {Canis lupus familiaris} MLQDLGHSNISKSQVSEFILMGFPGIHTWQHWLSLPLALLYLLALTANILILIIIKQEATLHQPMYYFLGILAVVDMGLATTIMPKILAILWFSAKAIGLPECFAQMYVI
HCFVLMESGIFVCMAIDRYVAICQPLRYPSIVTDSFVAKATVFMALRNSLATIPVPVLAAERHYCSKNQIEHCLCSNLGVTRLSCDDRTINSIYQLFLAWTLMGSDLGLI
FLSYALILHSVLKLNSAEAASKALSTCTSHLILILFFYTVIVVISITHSATMTLPLIPVLLNVLHNVIPPALNPIVYAFKNKELRQGFYKALKLNIKGN*
173 >lcl|XP_003433079.1|Plus130272507..30273430 NW_876273 olfactory receptor 2D3-like LOC100688194 __SEG__ Chr21 {Canis lupus familiaris} MGEGNQTTVAEFILLGLSQDPKIQILLFCVFLIIYLLSMFGNLLIIILIQTDSRLHTPMYFFLKNLSFADLCFSTSIVPQMLVHFLVKRKSISFAGCSLQIIVFLLAGCT
ECALLAVMSYDRYVAVCKPLHYSTVMTQKVCVQFAIVSWVSGAFVCSVDSAFTLCLPYQGQNVISHYFCEPPALLKLASADTYKAEMALFSMGVIILLAPLSLILVSYWH
IISTVIQMQSVEGRLKVFSTCGSHLTVVVLYYGSGIFAYMRPNSKTMNEKDQVISVFYSVMTSMLNPIIYSLRNKDVKGALRNLFRR*
174 >lcl|XP_003433080.1|Plus1complement(30371229..30372152) NW_876273 olfactory receptor 2D3-like LOC100688267 __SEG__ Chr21 {Canis lupus familiaris} MGTENRTYLTEFILLGLSSDWQIQILLFVVFLIIYLLTLFGNLIIIVLIHIDSRLHTPMYFFLKNLSFTDLCFSTTIIPQMLFHLLVIRKTISFAGCSIQMIFFLVAGCT
ESSLLAVMSYDRYVAVCKPLHYSTLMTQKVCVQLTIGSWATGIFVSLVDTSFTLCLSYHGQNIINHYFCEPPALLKLASEETYRAEMAIFAMGVVILLGPVSLILFSYWN
IISTVIQIQSGEGRLKVFSTCGSHLIVVVFFYGSTIFTYMRPNSKKINEGDKVISVFYSVITSMMNPFIYSLRNKDVKKAFRKVFGR*
175 >lcl|XP_003433107.1|Plus1complement(33316970..33317917) NW_876274 protein sprouty homolog 2 SPRY2 __SEG__ Chr22 {Canis lupus familiaris} MEARAQSGSGSQSLLQAPRDVGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRFQHPQAHSSARVPLSRS
ISTVSSGSRSSTRTSTSSSSSEQRLLGPSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVC
CVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT*
176 >lcl|XP_003433123.1|Plus13053158..3054192 NW_876274 lysophosphatidic acid receptor 6-like LOC100683989 __SEG__ Chr22 {Canis lupus familiaris} MVSSNSSSCSYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICTLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATQNWPFGDPLCKISVMLFYTNMYGSILFLTCI
SVDRFLAIVHPFKSKTLRTKRNAKLVCIAVWLTVIGGSAPAVFFQSTHIQENNSTAACFEKFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRS
KINKTKVLKMIFVHLAIFCFCFVPYNINLILYSLMRTQTFVNCSAVAAVRTMYPITLCIAVSNCCFDPIIYYFTSDTIQNSIKMKNWSAKRSDFRFSEVQSTENFIQHSL
QTLKCKISDNESTI*
177 >lcl|XP_003433209.1|Plus143666882..43667961 NW_876276 angiotensin II receptor, type 1 AGTR1 __SEG__ Chr23 {Canis lupus familiaris} MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSF
NLYASVFLLTCLSIDRYVAIVHPMKSRLRRTMLMAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWK
TLKRAYEIQKNKPRNDDIFKIIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSSL
STKMSTLSYRPSDHGNASTKKSASCVEVE*
178 >lcl|XP_003433236.1|Plus1complement(3330295..3330876) NW_876277 proline-rich protein 3-like LOC100687912 __SEG__ Chr24 {Canis lupus familiaris} MPLKYLPVGKKQNQQPPPPPQQPLLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHRGPPGSRGPMIPPVLSVPPPPRGRGPIWGGLGPRCSPYGHGWWGAN
TEPPFPGPGHGGPSRGGFHKEQRNPQRLKRWSLIKNTCPPDDGPQVMEDKSNLPVCRHFAKKGHRRYEDLCAFYHPGVNGPPL*
179 >lcl|XP_003433243.1|Plus117211066..17212184 NW_876277 alpha-1D adrenergic receptor ADRA1D __SEG__ Chr24 {Canis lupus familiaris} MTFRDLLIVSFEGPRPDGSAGGSSAGGCGGGAGGAAASEGPAVGGVPGAALGGGGGVMGACVGQDNRSSAGEPGGAGTGGEVNGTAAVWGLVVSAQGVGVGVFLAAFILT
AVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILAL
LWAVALVVSVGPLLGWKEPVPPDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASEVVLRIHCRGASAADGAHGPRSAKGHTFR
SSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGE*
180 >lcl|XP_003433392.1|Plus1complement(2234167..2235087) NW_876279 microfibrillar-associated protein 3-like isoform 1 MFAP3L __SEG__ Chr25 {Canis lupus familiaris} MHDSGLLNITKVSFSDRGKYTCVASNVHGTVNNTVTLRVIFTSGDMGVYYMVVCLVAFTVVMILNITRLCMMSSHLKKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITS
AKTLELAKVTQFKTMEFARYIEELARSVPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEASDRDEVYTIPNSLKRSDSPTADSDASSLHEQPQQIAIKVSVHP
QSKKDHMGDQEAVQFEVKDEEETEPSAEHSPETAEPSTDITSTELTSEEPTPVEVLDRVLPPAHLETPEPAVAHDRNTCIIYESHV*
181 >lcl|XP_003433414.1|Plus14285342..4286292 NW_876280 olfactory receptor 12-like LOC100687076 __SEG__ Chr25 {Canis lupus familiaris} MLSHRNGNLSMVYFQDFVLEGFESGLETQALLFAVFLALYMVTVLGNFLMIIVITLDSHLHSPMYFFLKNLSFVDLCYSSVIAPNALANYFSSSKVITFAGCATQLFFFS
LLGTTECFLLGVMAYDRFMAICSPLRYPITMCQSVCTCLVLGAYCGGCFNSVVQTSFTFHLPFCSSNRINHFFCDVPPLLQIACGNTAINELLLFGICGLIIVGVTFVIL
ISYGYITVTILRMRTGAGRRKVFSTCGSHMTAVTLFFGTAFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEALGRLGQKHMAI*
182 >lcl|XP_003433415.1|Plus14324263..4325213 NW_876280 olfactory receptor 12-like LOC608334 __SEG__ Chr25 {Canis lupus familiaris} MLSHSNENLSKVYFQDFVLEGFGGGLETQAMLFTVFLALYMVTVLGNILMIIVITLDARLHSPMYFFLKNLSFLDLCYSSVITPNALANFFSSSKIITFAGCATQLFFFS
LLATTEAFLLGVMAYDRFMAICSPLRYPITMCQSACTRLVLGAYCGGCLNSVVQTSFTFHLPFCSSNRINHFFCDVPPLLQIACGNTTINELLLFGICGLIIVGVTFVIL
ISYGYIIVTILRMSSGAGRRKVFSTCGSHMTAVTLFFGTVFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEALWRLGQKHMAM*
183 >lcl|XP_003433416.1|Plus14416691..4417659 NW_876280 olfactory receptor 12-like LOC100687633 __SEG__ Chr25 {Canis lupus familiaris} MPSHSNENLSMVYFQDFVLEGFGGGLETQALLFTLFLALYMVTLLGNILMIIIITLDARLHSPMYFFLKNLSFVDLCYSSVIAPNALANFFSSSKVITFAGCATQFFFIS
LLATTECFFLGVMAYDRFMAICSPLRYPSTMCQSACTRLVLGAYCGGCFNSVVQTSFTFHLPFCSSNRINHFFCDVPPLLQIACGNTAINELLLFGICGLIIVGVMFVIL
ISYGYITVTILRMRSGTGRHKIFSTCGSHMTVVTLFFGTAFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEAVQRLGQKHMAIRRMCCW*
184 >lcl|XP_003433536.1|Plus1complement(8823..9761) NW_876284 olfactory receptor 6C70-like LOC100686389 __SEG__ Chr27 {Canis lupus familiaris} MRNQSTKIEFFLLGLTDDPQLQIVIFTFLFINYVLSMTGNLTIILLTLLHPSLKTPMYFFLRNFSFMEASMTTVCIPRFLISLITKNKVISYNCCASQLFFFLQLEIAEF
YLLAAMSFDRYVAICKPLHYLIIMNNKMCYQLLFSSWAVGFLLSFSPLAVGLTLDFCVSGIIDHFMCDISPVLQLSCTDTRFLELLSFALAIVTLLVTLLLVILSYTYII
KTILKIPSAQKRTKAFSTCSSHMIVVSLTYGSCIFNYIKPTAKERVTLSKGVSVIYTSVAPLLNPFIYSLRNQQVKQAFKDTLQKIFSLSRK*
185 >lcl|XP_003433537.1|Plus1complement(40537..41475) NW_876284 olfactory receptor 6C70-like LOC100686465 __SEG__ Chr27 {Canis lupus familiaris} MRNQSTKIEFILLGLTDDPQLQIVIFTFLFINYVLSMTGNLTIILLTLLHPSLKTPMYFFLRNFSFMEASLTTVCIPRFLISLITKNKVISYNCCASQLFFFLQLEIAEF
YLLAAMSFDRYVAICKPLHYLIIMNNKMCYQLLFSSWAVGFLLSFPPLAVGLTLDFCASRVIDHFMCDISPVLQLSCTDTRFLELLSFVLSLVTLLITLLLLILSYTYII
KTILKIPSAQKRTKAFSTCSSHMIVVSLTYGSCIFNYLKPTAKERVTLSKGVSVIYTSVAPLLNPFIYSLRNQQVKQAFKDARQKICSFSKK*
186 >lcl|XP_003433538.1|Plus159647..60591 NW_876284 olfactory receptor 6C6-like LOC100686555 __SEG__ Chr27 {Canis lupus familiaris} MKNHSTEIEFILLGLTDDPQLQVVIFVFLFLNYTLSLMGNLTIILLTLLDPRLKMPMYFFLRNFSFLEIIFTTVCIPRYLKTIVTKEKTISYNNCAAQLFFILLLGVTEF
YLLAAMSYDRYVAICKPLHYPIIMNSRVCYQLVLASWLTGFLIIFPPLLMGLKLDFCASKTIDHFMCETSPILQISCTDTHVLELMSFIFAVVTLVVTLVLVVLSYTCIM
KTIMKFPSAQQRAKAFSTCTSHMIVVSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFWDMLQKRLYFSKKKL*
187 >lcl|XP_003433542.1|Plus1953380..954561 NW_876284 G-protein coupled receptor 84-like LOC100687941 __SEG__ Chr27 {Canis lupus familiaris} MWNTSDANFSCYHESVLGYRYAAVVWGVVVAVTGTAGNALTLLALAIQPKLRTRFNLLIANLTVADLLYCTLLQPFSVDTYLHLRWRTGATFCRVFGLLLFASNSVSILT
LCLIALARYLLIAHPKLFPRVFSAKGMLLALVSTWVVAVGSFAPLWSVYVLVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGVFYCLIHRQVKRAAQALDRYKQASV
RSNHVAGIEATPGRFQELDSGLASERPSEGTSSEPASSATAQTLEWAPSELGDQHGREEAQQRAEKGRPGAPARTRPAQRAPRTQDSPSEFGKVTRMCFAVFLCFSLSYI
PFLLLNILDAKAEAPRVVHMLAANLTWLNGCINPLLYAAMNRHFRQAYASLLRRGPQSFRRFH*
188 >lcl|XP_003433557.1|Plus1complement(6071428..6072363) NW_876284 olfactory receptor 8S1-like LOC100686490 __SEG__ Chr27 {Canis lupus familiaris} MALRNHSTITEFILLGLSVDSHIQVLLFVLFLGIYLLTILGNLLMLLVIKADSHLHTPMYFFLSHLSLTDFCFSTAIVPRLLENLLSQRKTISVEGCLAQVFFLFDFGGT
EVCLLSAMAYDRYAAICHPLLYGQVMNNQLYMQLVWGSWSLGFLDALINITLVTNLDFCKAHTIPHYSCELPSLFPLSCSDVSTNLTVLLCSTLLHGFGTFFLIFFSYAR
IVSTILSISSSSGRSKAFSTCSSHLTAVSFFYGSAFLRHLMPTSGSPLELIFSIQYSVVTPLVNPFIYSLKNREIKNALRRTLGKFLQQYR*
189 >lcl|XP_003433558.1|Plus1complement(6086219..6087154) NW_876284 olfactory receptor 8S1-like LOC100686576 __SEG__ Chr27 {Canis lupus familiaris} MALGNHSTITEFLLLGLPADHHTQALIFVLFLVIYLLTLSGNLLMILVIRANSHFHTPMYFFLNHLSFLDLCYSSVTVPKMLENLLSEKKTISVEDCLTQAFFVLASGGT
ELCLLAVMAYDRYAAICYPLLYGQMMNNELCVGLVWGSWGLAFLDAFINTLLAWNLDFCETQVISNFICEIPSLFPLSCSNSSVNFVVLLCSALLHAFGTFILVFFSYTR
IVATILSISSTSGRHKAFSTCSSHLTTVSLFYGSGFLRYLMPTSGSPWELVFSMQYSVVTPLVNPLVYSLKNKEVKAALKNMLQKHLKRLR*
190 >lcl|XP_003433578.1|Plus1complement(<24885..25811) NW_876284 olfactory receptor 6C3-like LOC100682606 __SEG__ Chr27 {Canis lupus familiaris} MRNHTMITEFVLLGISDDPQLQVVIFIFLFMAYVLSVTGNLTIIILTLIDCHLKTPIYYFLQNFSFLEITFTSVCIPRFLGTIVTKIKTVSYNSCVAQLFFIILTGVTEF
PLLTVMAFDRYVAICKPLHYIIIMNKKICTLLVFGSWLLGFLTIFPPLILILQLDFCASNVIDHFCCDYFPILQLSCSDTWLLEMIGFYFAFVILFFTLALVIQSYVSIL
STILRLPSASQRKKALSTCSSHLIVISISYGSCIFMYVKPSAKERASLTKGVAILNTSIAPMLNPFIYTLRNQQVKQALKNLLHKVAFS
191 >lcl|XP_003433621.1|Plus133688859..33690106 NW_876284 probable G-protein coupled receptor 19-like LOC100686071 __SEG__ Chr27 {Canis lupus familiaris} MVFAHRMDNSKPPLVIPTLLVPLQNHSCTETTTPLPSHDLTELQEEHSWMNNRTGLQPGLKPGEVATASIFFGTLWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACA
DLLISVASTPFVLLQFATGRWTLGSVMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWIFDAAFVSPVFFFFGSSWDSHCNYFFPSSWEG
TTYTIIHFLVSFVIPSILIILFYQKVVKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHPHERDSKKSSLVFTAITWISFSSSASKPTLY
SIYNANFRRGMKETFCMSSMKCYRSNAYTITTSSRMAKKNYVGISEIPPTAKTITKDSIYDSFDREAKEKKLAWPINSNPPNTFV*
192 >lcl|XP_003433692.1|Plus12279941..2280894 NW_876285 olfactory receptor 6C2-like LOC100686860 __SEG__ Chr28 {Canis lupus familiaris} MEKSVMEDARNHTEVQEFTLEGFPGVQHPGKILFLVHLLAYLASIMGNILIITITWADHHLQTPMYFFLSSFSFSECCFITTVIPKLLAIFLVGRQSIYFAACLTQDFIF
LFLGITVFFLMAILSLDRYLAICKPLYYPTIMNPRMCFLLVIACLALGFILMVVPVVMLSHSSFCGSHIISHFCNFGPLVYLSCSDTRFTEMLAFVLDLFILLTSLIITI
ITYSNIVITIVQLLSAKEKKKAFSTCSSHLIVLSLMYGSCVFIYMKPKQTKGLDSNREATLVNMVVTTLLNPVISTLQNKQVHWAVRDTLSRVRLKK*
193 >lcl|XP_003433703.1|Plus17190963..7191628 NW_876288 ras-related protein Rab-28-like LOC100686651 __SEG__ Chr29 {Canis lupus familiaris} MWDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGPDFFLRRITLPGNLNVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVCDITNYQSFENLEDWYSV
MKKVSEESETQPLVALVGNKIDLEHMRMVKLEKHLRLCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPMSRTVNPPRSSMCAV
Q*
194 >lcl|XP_003433728.1|Plus11613157..1613669 NW_876288 islet cell autoantigen 1-like LOC100684758 __SEG__ Chr29 {Canis lupus familiaris} MDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLIEKEERKKITQQESAEATMEEPSQLISLEDENQHKESSSFKT
EDGKSVLSALDKSSIHNACSDELLDMKPEGGACMGPMAGTSEPESADKDDLLLLSTVECC*
195 >lcl|XP_003433734.1|Plus1complement(40659101..>40659448) NW_876288 growth/differentiation factor 6-like LOC100686579 __SEG__ Chr29 {Canis lupus familiaris} IHGKRHGKKSRLRCGKKPLHVNFKELGWDDWIIAPLEYEAFHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTRLTPISILYIDAGNNVVYKQYEDMVVE
SCGCR*
196 >lcl|XP_003433735.1|Plus1complement(41755123..41756061) NW_876288 olfactory receptor 6C75-like LOC100686973 __SEG__ Chr29 {Canis lupus familiaris} MRNHTKVTEFILLGLTDDPKWQVVLFIFLLVTYMFSVTGNLVIIILTLTDPHLKTPMYFFLRNFSFLEMSFTSVAIPRFLVTVVTGDRTISYNDCLAQVFFFILLGATEF
YLLTAMSYDRYIAICKPLHYMTIMSSRVCILLVFSSWLAGFLIIFPPVILALKLDFCASNIIDHFICDSSPILQLSCTNTHFLELMAFILAVVTLMVTLTLVMLSYIYII
RTILRIPSRSQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSAKERVSLNKGVAVIITSVTPLLNPFIYTLRNQQVKQAFKNMVHRMAFSSYK*
197 >lcl|XP_003433736.1|Plus1complement(41811145..41812077) NW_876288 olfactory receptor 6C2-like LOC100687215 __SEG__ Chr29 {Canis lupus familiaris} MKNHSAITFILLGLTDDPRLQVFLSLFLFFTYIFTVAGNLIIILLTLVDSHLKTPMYFFLRNFSILEIIFTTVCVPRFLYSLTTGDKSVTYNACVIQLFFVILIGATEFF
LLTAMCYDRYVAICKPLHYTIIMNERVCTILVLCCWLIGLIVILPPLSLGVQLDFCNSNLIDHFGCDASPLLKIVCSDTQFVEQLVLIMAVLTLIVTLVCVFVSYTYIVK
TILRLPSVQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPAKEGVALNKVVSLLNTSIIPLMNPFIYTLRNKQVKQAFKDSIKKMAFLSKD*
198 >lcl|XP_003433805.1|Plus11700995..1703424 NW_876292 LOW QUALITY PROTEIN: protocadherin gamma-B4 PCDHGB4 __SEG__ Chr2 {Canis lupus familiaris} MGSGAGERGWAERWPVLFPFLLSLFCWALSEQIRYRIPEEMPEGSVVGNLAKDLGLSVHELPTRQLRISLEKPYFTVSAKSGELLVSSRLDREQMCGKKSACTLEFEAVA
ENPLNFYHVSVDVEDINDHTPKFTQTSFDLQISESTKPGARFILGSAHDGDIGTNSLQSYQLNPNDHFSLVNKDKLDGSKYPELVLQTPLDREEQKSYRLTLTALDCGDP
PLSSTAQIQVLVTDANDNPPVFSQELYKVGLPENVLPGTTVLQVMATDQDEGVNAQITFSFTEAGQITQFDLNANTGEITILNTLDFEEVKEYSIVLEARDGGGMIAQCT
VEIEVQDINDNFPEVVFQSLPDLIMEDTKLGTHVALLKIRDKDSGHNGEVTCKLEGDVPFKILSSSMNTYKLVTDAVLDREQTTEYNVTITATDRGKPPLSSSSSFTLHI
GDVNDNAPVFQQASYVVHVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLW
ATATTTRRGCCTRRWGPTARRSSTRCRAPRSPATWSPRWWRWTPTRDTMPGCHTTCCRPASRDSSAWGCARARCARRVLWATGTRPASACWSLCGMGDSRPSRPQPRCSW
FSLTACRRRCQTSASARRPLIPRLSCSSTWWWLWP*SPCSSSSR*FWRLPCACDAPPAPPPGAAFRPMFAPRLNLELSPVTAKGLCLIPTICVLPILERQSLIF*NVMSS
*VQNKTYILMIHLGPYFHFANPVSQPPIR*VFF*A*PASY
199 >lcl|XP_003433807.1|Plus11790830..1793400 NW_876292 protocadherin gamma-C4-like LOC100685766 __SEG__ Chr2 {Canis lupus familiaris} MLRKVGSWVEICWGATLLFLICHLGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTESLSARRLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSASCIVPLEFVT
EGPLEMYRAEVEIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNP
PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMLLIQLNASDPDLGPSGNVTFSFSGHTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDIRARDGGSPAM
EQHCSLRVDLLDVNDNAPHITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDHLPFALKSAFRNQFSLVTAGPLDREAKSSYDIMVTASDAGNPPLSTQRT
IFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVT
VRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAVPIPADLPPQKLVIVVKDSGSPPLSTSVT
LLVSLEEDTHPVVPDLRESSAPREGESRLTLYLAVSLVAICFVSFGSFVALLSKCLRGAACGVTCFPAGTCACLTRSRRREGLPPSNGILRIQLGSDDPIKFVDVGGHSH
GCTPLASAPTRSDSFMMVKSPSAPMAGEPVRPSCPPSDLLYGLEVRPLQAQPTLEGYSDPGIWLGHVLVSLHEPLVNGNYVVDGVL*
200 >lcl|XP_003433915.1|Plus1complement(688011..688952) NW_876294 olfactory receptor 4F21-like LOC100686102 __SEG__ Chr30 {Canis lupus familiaris} MGGGNNSVVSEIVLVGLTSSLEMQLVLFLVFSVFYVTGILGNLLIVLTVISDSHLHSPMYLLLANLSFIDIWVSSIAAPKMISDFFKERKVISFQGCIAQMFFIHVIGGT
EMVLLIFMALDRYVAICRPLHYLAIMNFRTCISLLVVAWAIGIIHSLIQLVFVVNLPFCGPNEVDSFYCDLPRFIRLACTDTYRLELMVTANSGFISLGTFSILVISYIF
ILVIVWQRSSGGLSKALSTLSAHITVVVLFFGPCIFVYSWPFPTVPVDKFLAIFDVIITPFLNPAIYTFRNKEMKVAMRRIFSQVLSFQKLFK*
201 >lcl|XP_003433952.1|Plus1418373..419308 NW_876294 olfactory receptor 4K1-like LOC100687258 __SEG__ Chr30 {Canis lupus familiaris} MAHTNESVVSEFVLLGLSNSWELQLFFFAIFSLVYVTSVLGNIMIIVIISSDSHLNSPMYFLLGNLSFIDICQSNFATPKMLMDFFVEHKTISFEGCMAQIFLLHSFVGS
EMLLLVGMAYDRFIAICKPLHYSTIMNRSLCIIFVFISWAVGILHSISHLAFTVDLPFCGPNEVNSFFCDLPLVIELACMDTYEMEIMTLTNSSLISLGCFLALVISYTI
ILITVRHRSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTVCTPLLNPIIYSLRNEDVKSAMRRLRNHHVNSWKN*
202 >lcl|XP_003433968.1|Plus1complement(619740..620681) NW_876294 olfactory receptor 4Q2-like LOC100685733 __SEG__ Chr30 {Canis lupus familiaris} MDENQTEMVRNFVLAGFSQTPSIEAGLFVLFLFFYMSTWVGNVLIMVTVASDNYLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADLLNNEKLIRYDQCIVQLFFLHFVGA
AEMFLLTVMAYDRYVAICRPLHYTTIMSRGLCCMLVAASWMGGFVHSTVQMILTIHLPFCGPNHVDNFFCDVPPVIKLACADTFVIELLMVSNSGLISTSSFVVLLSSYS
TILVKIRSKEGRRKALATCGSHLMVVTLFFGPCIFIYARPFSTFSVDKMVSVLYNVITPMLNPLIYTLRNKEVKSAMRKLWDRSELTWKKQET*
203 >lcl|XP_003433971.1|Plus178611..79582 NW_876294 olfactory receptor 4K5-like LOC100688383 __SEG__ Chr30 {Canis lupus familiaris} MDKVNSSVVSEFVLLGLSSSQELQLFFFVFFSVLYVIIVLGNLLIIITVTSDNSLHSPMYFLLGNLSFVDICQASFATPKMIVDFLSEHKTISFNGCIAQIFFIHLFTGG
EMVLLVSMAYDRYVAICKPLHYVVIMSQRTCTVLVIVSWAVGLVHTLSQLSFTVTLPFCGPNVVDSFFCDLPRVTKLACLDSYIIEILIVVNSGILSVSTFSLLVGSDII
ILVTVWFKSSAAMAKAFSTLAAHITVVILFFGPCIFIYVWPFTTYPVDKLLAIFYTVFTPILNPIIYTLRNRDMKAAMRNIMTYYLRPKKISEIPLAVRSSLY*
204 >lcl|XP_003433990.1|Plus194400..95335 NW_876294 olfactory receptor 4K1-like LOC100687593 __SEG__ Chr30 {Canis lupus familiaris} MAHTNESVVSEFVLLGLSNSWELQLFFFAIFSLVYVTSVLGNIMIIVIISSDSHLNSPMYFLLGNLSFIDICQSNFATPKMLMDFFVEHKTISFEGCMAQIFLLHSFVGS
EMLLLVAMAYDRFIAICKPLHYSTIMNRSLCIIFVFISWAVGILHSISHLAFTVDLPFCGPNEVNSFFCDLPLVIELACMDTYEMEIMTLTNSSLISLGCFLALVISYTI
ILITVRHRSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLSVDKFLSVFYTVCTPLLNPIIYSLRNEDVKSAMRRLRNHHVNSWKN*
205 >lcl|XP_003433992.1|Plus160300..61250 NW_876294 olfactory receptor 4K2-like LOC100683454 __SEG__ Chr30 {Canis lupus familiaris} MDAANKSVSEFVLLGLSKSWELQLFFFMVFSLFYVATIIGNSLIVITVIADSHLHSPMYFLLTNLSVLDMSLASFATPKMVTDYLTGHKTISFDGCITQIFFLHLFTGTE
IILLMAMSFDRYIAICKPLRYASVISPWVCVALVVASWIVGVMHSMSQVIFALTLPFCGPNEVDSFFCDLPVVFQLACVDTYVLGLFMISTSGIIALSCFIILFNSYVIV
LVTIKHHSSKGSSKALTTCTAHFIVVLMFFGPCILIYMWPLNSFLIDKILSVFYTIFTPILNPVIYTLRNQEVKTAMRKLKNRLLNPNKTTPLHYF*
206 >lcl|XP_003433995.1|Plus1complement(374721..375659) NW_876294 olfactory receptor 4F15-like LOC100684042 __SEG__ Chr30 {Canis lupus familiaris} MDAANDSVVSEFVLIGLSNSWDMHLFLFLFFSVFYVGIILGNLFIVFTVIIDCHLHTPMYFLLANLSLLDLGLSSTTVPKMISDLFTDHNIISFPKCMIQIFFIHVMGGA
EMVLLIAMAYDRYTAICKPLHYLTIMSSKMCVSFVAAAWIVGIVHAVSQFVFVINLPFCGPNEVDSFYCDFPRVMKLACVDTYKLEFVIIANSGFISMATFFSLIISYIF
ILVTVWKRSSGDLSKAFVTLSAHITVVILFFMPCMFLYVWPFPTTSLDKYLFIVDFAITPLLNPAIYTLRNKDMRVAMRRLAKRIVGLHGIS*
207 >lcl|XP_003433996.1|Plus1complement(441756..442691) NW_876294 olfactory receptor 4F21-like LOC100684112 __SEG__ Chr30 {Canis lupus familiaris} MGGLNDSVVTEIVLLALSCSWEKKLFLILVCSLLYLAVILGNLFILFLVIFDSHLHSPMYFLLANLSLIDVCLSSTTVPKIIKDLLNEYKVISFQGCMAQICFIHIIGGV
EMVLLIAMAFDRCTAICKPLHYLKIMNSKICISFVITGWVTGVIHAMSQFLFVINLPFCGPNKVDSFYCDFPKIIKLACTDAVKFEFIVTANSGFMSMGTFFLLILSYSF
ILITVWKRSSGELSKAFVTLSAHITVVFLFFTPCMFLYVWPSPPPSIDKNLFIVDFAIIPALNPTIYTLRNKDTKVAIKRLSKKISYSRFC*
208 >lcl|XP_003433997.1|Plus1complement(472545..473486) NW_876294 olfactory receptor 4F21-like LOC100684249 __SEG__ Chr30 {Canis lupus familiaris} MSMDGLNNSVVSEFVLLGLSTSWETKVFLMLTFSLIYLGIILGNLFIFFLVIFDSHLHSPMYFLLANLSFIDMGVASTTVPKMIGDLLNEYKIISFQGCMTQMCFIHIMG
GVEMVLLIAMAFDRYIAICKPLHYLNIMNPKICVSFVITGWVIGVIHAMSQFAFIINLPFCGPNEVDSFYCDFPRIIKLACTDGVKFEFIIAANSGFMSMGTFFLLILSY
VFILVTVWKRASGDLSKAFVTLSSHITVVVLFFTPCMFLYVWPFPTSSIDKYLFIADFAITPILNPIIYTLRNKDIKVSVKRLSKWGHYGRRC*
209 >lcl|XP_003433998.1|Plus1528164..529102 NW_876294 olfactory receptor 4F6-like LOC100684465 __SEG__ Chr30 {Canis lupus familiaris} MYEANYSEVSQFVFLGLSTYRPVQHFLLAFSTVFYVTIVLGNLLVVFTVTFDPYLHSPMYFLLANLSFVDLCLSTLTVPKMISDLQSGHKTISFQGCVIQIFALHVLGGS
EMVLLISMALDRYVAICKPLHYLTIMSPQMCILLLSGAWAVGLIHSVVQLAFVIHLPFCGPNEIDSFYCDLPWFIKLACADTYRMEFMVTANSGFISMGTFFSLLISYVF
ILVTVWKRSSAGLSKAFSTLSAHITVVVLFFVPCIFVYVWPFPSVPVDKFLAVLNFVITPILNPIIYTLRNKDMKMALKRLSSQLLSLRMIS*
210 >lcl|XP_003433999.1|Plus1complement(660473..661444) NW_876294 olfactory receptor 4F3/4F16/4F29-like LOC100684620 __SEG__ Chr30 {Canis lupus familiaris} MDGGNHSVVSEFLLLGLTSSWEIQILLFLFFTIFYIASMLGNLLIVVTIISDHHLHSPMYFLLANLSIIDTGVSSIASPKMIYDLFRKHKVISLTGCITQMFFIHTVGGT
EMVLLIVMAYDRYIAICKPLHYLSIMSLRMCISLLAVAWTIGLIHSVAQLAFVVNLPFCGPNTMDSFYCDFPRFIKLACTDTYRLEFLVTANSGFISMGTFFILIVSYIF
ILVTVCKHSSGGPSKALSTLSAHITVVVFFFGPCIIVYVWPFPTLPIDKFLAIFDALITPFMNPVIYTFRNKDMKVAMRRLFGKVLNFRKSSFMTSQRHSDSS*
211 >lcl|XP_003434018.1|Plus1complement(273546..274646) NW_876295 5-hydroxytryptamine receptor 1F-like LOC100683938 __SEG__ Chr31 {Canis lupus familiaris} MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIARESWIMGQVACDIWLSVDITCCTCS
ILHLSAIALDRYRAITDAVKYSRKRTPKHAGIMIIIVWIISIFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLTLILILYYKIYKAAKTLYHKRQASRI
AKEEVNGQVLFGSGEKSTRLVSTPYLLEKSLSDPSTDFDKIHSTVKNLRSEFKHEKSWRRQKILGTREHKAATTLGLILGAFVICWLPFFVKELVVNICEKCKISEEMSN
FLTWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRC*
212 >lcl|XP_003434104.1|Plus15065282..5066202 NW_876298 olfactory receptor 5AC1-like LOC100684572 __SEG__ Chr33 {Canis lupus familiaris} MEANKTQVTEFVLIGLTDRPGLQVPLFLVFLVIYLTTMVGNLALIFLIWKDPHLHTPMYLFLGSLALADACSSSSVTPKMLMKFLSKNHMISHFECITQFYIFASSATTE
CFLLVVMAYDRYVAICNPLHYPVVMSNRLCAWLISLSYVIGFLHPTIHVGLLFRLTFCRSNIIHHFYCEILPLYTISCTDPSINALVLFIFAAFIQAFTFMTIIVSYTRV
LFAILKKKSEKGRSKAFSTCSAHLLSVSLFYGTLFFMYVRPGSGPDQYQDKMYSLFYMIIIPLLNPFIYSLRNKEVLGALRKITKK*
213 >lcl|XP_003434106.1|Plus15155959..5156993 NW_876298 olfactory receptor 5H2-like LOC100684793 __SEG__ Chr33 {Canis lupus familiaris} MCVTYLNSPPYISCHKLTEFLVICSISFQKAPNENMEKENATLLMELILTGLTHEPRWKIPLFLMFLVFYLLTIVGNLGLIALIWNDPQLHIPMYLFLGSLAFVDAWLSS
TVTPKMLVSFFAKSKTISLSECMIQFFSFAISATTECFLLATMAYDRYVAICKPLTYPVIMSNTLCIRLILLSFLGGLLHAIIHSSFLFRLTFCNSIIVHHFYCDIIPLF
KISCTDPSINYLMVFIFSGSIQVFTILTVLVSYTLVLFTILRKKSLQGIKKAFSTCGAHLFSVSLYYGPLLFMYVRPRSAQADDQDMMDSLFYTVIIPVLNPMIYSLRNK
KVIDSMRKMLKRHA*
214 >lcl|XP_003434108.1|Plus15243059..5243988 NW_876298 olfactory receptor 5K4-like LOC100685107 __SEG__ Chr33 {Canis lupus familiaris} MDKENQSLATEFILIGFTDRPVLKSLLFSVFFAIYLVTMVGNLGLVALILMERRLHTPMYIFLGNLALMDSCCACAITPKMLENFFSKDRMISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICSPLQYHTLMSKKLCLQMTAGAYIASNLHSMIHVGLLLRLTFCRSNQIDHFFCDILPLYRLSCTDPSINELMIYIFSMPIQIFTIAIVLFSYLC
ILFTIFKMKSKEGRGKAFSTCASHFLSVSIFYICLLMYIRPFEEGDKDIPVAVFYTIVVPLLNPFIYSLRNKEVINVLKRCLKNYNIFK*
215 >lcl|XP_003434110.1|Plus15318423..5319391 NW_876298 olfactory receptor 5K1-like LOC100685342 __SEG__ Chr33 {Canis lupus familiaris} MAEENHTLKSEFILTGFTDHPELKTLLFVVFFAIYLITMVGNLGLVVLISKEHHLHMPMYIFLGNLALVDSCCASAITPKMLENFFSENRMISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICSPLQYHTMMSKKLCLQMTTGAYIAGNLHSMIHVGLLLRLTFCGSHQINHFYCDILPLYRLSCIDPYVNELVLFIFSGSIQVFTIGSVLISYFY
ILFTIFKMKSKEGRVKAFSTCASHFLSVSLFYGSLFFMYIRPNLLEQGDKDIPAAILFTIVVPLLNPFIYSLRNKEVITVLRKILKKKKSHESWKQMISTVA*
216 >lcl|XP_003434114.1|Plus15258048..5258983 NW_876298 olfactory receptor 5K1-like LOC100687081 __SEG__ Chr33 {Canis lupus familiaris} MDMTEDNYSLTTEFILIGFTDHPKLKTVLFVVFLTIYLITMVGNLGLVPLILMERRLHTPMYIFLGNLALMDSCCACAITPKMLENFFSKDRMISLYECMAQFYFFCLAE
TADCFLLAAMAYDRYVAICSPLQYHTLMSKKLCLQMTAGAYIAGNLHSIIHIVFLFRLTFCRSHQINHFFCEFLPLFKLSCVDPYINELLMFIFPGSVLVFSIIIVIISY
LCILFMIFKMKSKEGRGRALSTCASHFLSVSMFYGSLLFVYIRPNSVKEEDKDISVAIFYTLVIPLLNPFIYSLRNKEVINAMKKNIKKNF*
217 >lcl|XP_003434231.1|Plus126525385..26526347 NW_876302 olfactory receptor 10C1-like LOC100687422 __SEG__ Chr35 {Canis lupus familiaris} MNASCSLWQDNSLSVKHFSFAKFSEVTEQCFLLFTLILLMFLASLTGNALIALAIWTNPVLYTPMYFFLANLSVLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
TLFAISECCLLAAMAFDRYTAICSPLHYATRMSRGVCSQLAVVSWGVGCIVGLGQTNYIFSLNFCGPCEIDHFFCDLPPILALACGDTSHNEVAVFVVAILCISSPFLLI
VASYGRILAAVLIMPSPEGRRKALSTCSSHLLVVTLFYGSGSVTYLRPKASHSPGTDKLLALFYTVVTSMLNPIIYSLRNKEVKAALWRTLGRKNVLTRG*
218 >lcl|XP_003434276.1|Plus1complement(3008143..3008460) NW_876303 28S ribosomal protein S33, mitochondrial-like LOC100688252 __SEG__ Chr36 {Canis lupus familiaris} MSSLSEYASRMTGLSTRLLGEVARPTDSKSMKVVKLFSEQPLAKRKETSDWYPNHNTSFALMGTLRFLGLYRDEHQDFKDKQLRLKKLRGKGKPRKGEGKRATKK*
219 >lcl|XP_003434346.1|Plus122724175..22725107 NW_876305 olfactory receptor 10J1-like LOC100685473 __SEG__ Chr38 {Canis lupus familiaris} MKSENHTVVGEFVLQGFSSFREHQIILFVIFLTLYLFTLAGNVVIVTVIGSARHLHTPMYFFLSVLSVSETVYTLVIVPRMLCSLMGLSRRISRAGCATQMFFFITLAIN
NCFLLTAMGYDRYVAICNPLRYTVVMSKRVCALLVWGAFSIGLLVAIIQISSVFRLPFCDREVAHYFCDIRPVMELSCADTTLHDIINFIISSLVIVVPMGLVFVSYVLI
ISTILKISSAQGRKKAFATCASHLIVVIVHYGCASIAYLKPKSENTRDEDQLISVTYTVITPLLNPVVYTLRNKEVKDALHRAISKNPHA*
220 >lcl|XP_003434371.1|Plus1complement(22642590..22643519) NW_876305 olfactory receptor 10J1-like LOC100683336 __SEG__ Chr38 {Canis lupus familiaris} MEGKNHTLVSEFTFQGFSSFGEHQLTLFVVFLVLYTFTLAGNVVIVTVISVDRRLHTPMYFFLSTLSVSETVYTLVIIPKMLCNLLGLSQPISLAGCATQMFFFITLAIN
NCFLLTAMGYDRYVAICDPLRYAVIMSKGICIQLVGGACSIGLIVAMTQVLAVFRLPFCATRVAHFFCDIRPVMKLSCIDTTANEILTLIISVLVILVPMGLVFISYVLI
ISTILKIPSAQGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENSRDEDQLISVTYTVITPLLNPVVYTLRNKEVKDALLRATGRKLS*
221 >lcl|XP_003434459.1|Plus131238597..31239544 NW_876308 olfactory receptor 6C2-like LOC100683214 __SEG__ Chr3 {Canis lupus familiaris} MRNYTAITTFILLGLTDDPQLQILLFIFLFLTYILSVTGNRTIITLTLVNSHLKTPMYFFLRNVSFLEVSFTTVCIPRFLYSISTGANTITYNACASQISFVILFGATEF
FLLAAMSYDRYVAICKPLHYMTIMSNRVCSLLVFCCWVSGLMIILPPLSLCLQLEFCDSNAIDHFSCDAGPLLKISCSDTWMIEQMVILVAVFALIITLVCVFLSYTYII
RTILRFPSVQQRKKAFSTCSSHMIVVSITYGSGIFIYIKSSAKEEIAINKGVSVLTTSVAPLLNPFFYTLRNKQVKQAFNDFIKKMTFHSKKLKF*
222 >lcl|XP_003434460.1|Plus131283244..31284206 NW_876308 olfactory receptor 6C68-like LOC100683360 __SEG__ Chr3 {Canis lupus familiaris} MRNQTALTTFILLGLTEDPQLKILLFMFLFLSYMLNVSGNLTIIILTLIDSHLKTPMYLFLQNFSFLEISFTTSCVPRFLYSISSGDKSITYNACVSQLLFTDLFAVTEF
FLFATMSYDRYVAICKPLHYMTIMSRRVCKNFIVFCWVAALIIILPPISLVLGLEFCDSNIIDHFCCDASPILKISCSDTWLIEQMVIVCAVLTFIITLMCVVLSYIYII
GTILRFPFAQQRKKAFSTCSSHMIVVSITYGSCIFIYVKPSAKDEVAINKGISLLITSISPMLNPFIYTLRNKQVKKAFHDSIKKLHSYQRCKGEMSQLI*
223 >lcl|XP_003434461.1|Plus1complement(31330658..31331593) NW_876308 olfactory receptor 6C2-like LOC100683428 __SEG__ Chr3 {Canis lupus familiaris} MRNGTITTFILLGLTDDPELQVLIFIFLFLTYTLSITGNLAIIILTFVDPHLKTPMYFFLKNFSFLEISFTSAIIPRYLYSIATGDNVITYNACVIQVFFTDLCGVSEFF
LLAAMSYDRYVAICKPLHYVIIMSNSVCRILNICCWVAGLCIIIPPLSLGLNLKFCDSNIIDHFGCDAFPLVKISCSDTRFMEWTVIICAIVTLNMTLTCVVLSYAYIIK
TIFRFPSVQQRKKAFSTCSSHMIVVSITYGTCIFIYMNPTAKEKVTINKVVSLLISSISPTLNPFIYTLRNNQVKKAFEDSIKRIALLSTK*
224 >lcl|XP_003434462.1|Plus1complement(31358830..31359768) NW_876308 olfactory receptor 6C2-like LOC100683505 __SEG__ Chr3 {Canis lupus familiaris} MRNHTAITTFILLGLTEDPQLQVLLFIFLFLSYVLSITGNLTIIILTFMDSHLKTPMYFFLCNFSILEISFTTVCIPRFLYSITTGDNTITYNACACQIFFIGLFGVTEF
FLLAAMSYDRYVAICKPLHYMTIMNNKVCTILVLCCWISGLLIIITPLGMGLQLEFCDSNAIDHFGCDASPLFKISCSDTWVIEQVVIICAVLTFIITLIGVILSYIYII
RTILRFSSASQRKKAFSTCSSHMLVVSITYGSCIFIYIKPSAKEEVDINKGVSVLTTSVAPLLNPFIYTLRNKQVKRAFNDTIKKIAFILHK*
225 >lcl|XP_003434479.1|Plus131166582..31167517 NW_876308 olfactory receptor 6C3-like LOC100683408 __SEG__ Chr3 {Canis lupus familiaris} MNHTVITKFVLLGLSDDPDLQIVIFLFLFVTYLLSVTGNLTIITLTLVDSHLQTPMYFFLRNFSFLEILFTTVCIPRFLGAIITRDKTISYNDSAVQLFFFILMGVMEFY
ILTAMSYDGYVAICKPLHYTTIMIRKVCTLLVLCAWLGGFLTIFPPLMLLLQLNYCASNVIDHFACDYFPLLQLSCSDTWLLEVIGFYFDLVALLFTLALVILSYLYIIR
TILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKERASLTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKDMVHKVVFSSSK*
226 >lcl|XP_003434480.1|Plus131176423..31177361 NW_876308 olfactory receptor 6C1-like LOC100683479 __SEG__ Chr3 {Canis lupus familiaris} MRNHTEITDFILLGLSDDPQLQEVIFVFLLITYMLSITGNLTIITLTLLDSHLQTPMYFFLRNFSLLEISFTTVSIPKFLSTLITGDKNISFKDCMAQFFFLILLGVTEF
CLLAAMSYDRYIAICKPLHYMTIMNPRVCTLLVFASWSASFLIIFPLLMLFIQLDYCKSNVIDHFTCDYFPLLHLSCSDTRFLEIVGFSCAVFTLMFTLALIILSYIYIL
RTILRIPSTSQRTKAFSTCSSHMIVISISYGSCIFMYINPAAKDRVSLSKGVAVLNTSVAPMLNPFIYSLRNQQVKRAFLDRARKIVFFSSK*
227 >lcl|XP_003434593.1|Plus19997793..9998818 NW_876312 olfactory receptor 8B3-like LOC100687027 __SEG__ Chr5 {Canis lupus familiaris} MTACKEGAGFSINGIFFCSHRFPKRRILVRNDSLVTEFLLAGLTDRPELQQPLFFLFLMIYIVTMVGNLGLIILIGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMN
FVSKDNIISYVGCMTQLFFFLFFVISECYMLTSMAYDRYVAICNPLLYKVTMSHQVCSLLTVAAYMMGFARASAHTGCMLRLTFCNVNIINHYLCDILPLLQLSCTSTYV
NEVVVLIVVGINITVPSFTILISYVFILTSILHIKSAQGRSKAFSTCSSHVIALCLFFGSAAFMYLKYSSPGSMEQGKISSVFYTNVGPMLNPLIYSLRNKDVKIALRKA
LIRIWKRNIRF*
228 >lcl|XP_003434594.1|Plus110092360..10093292 NW_876312 olfactory receptor 8B3-like LOC100687264 __SEG__ Chr5 {Canis lupus familiaris} MAPGNASLVTEFILVGLTDLPDLQLPLFCLFLLMYVVTVLGNLCLVTLIGLNPHLHTPMYFFLFNLSFIDLFYSSVFTPKMLIHFTSKKNIISYRGCMTQLFFFCFFGIS
EAYVLTSMAYDRYVAICNPLLYNVVMSPNVCSLLMLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYLCDILPLLQLSCTSTYVNELVVFIVVGINVIVPSVTIFVSYGF
ILSSILSISSTEGRSKAFSTCSSHVIAVSLFFGSGAFMYLKPSSAGSMDEGKISSVFYTNAVPMMNPLIYSLRNKDIKIAVRNTLNRRQF*
229 >lcl|XP_003434595.1|Plus110150609..10151541 NW_876312 olfactory receptor 8B3-like LOC100687427 __SEG__ Chr5 {Canis lupus familiaris} MPPGNASFVTEFILVGLTDLPDLQLPLFCLFLLMYVVTVLGNLGLITLIGLNSHLHTPMYFFLFNLSFIDFCYSSVFTPKMLTNFISKKNIISYRGCMTQLYFFCFFGIS
ECYVLTSMAYDRYVAICNPLLYNVVMSSKVCSLLMLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDILPLLQLSCTSTYVNELVVFIVVGVNIIVPTVTIFVSYGF
ILSSILRISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSVGSMDEGKISSVFYTNVVPLMNPFIYSLRNKDVKCSVRKTLSRRQF*
230 >lcl|XP_003434598.1|Plus110379089..10380021 NW_876312 olfactory receptor 148-like LOC100688048 __SEG__ Chr5 {Canis lupus familiaris} MRNHTELREFILLGIPQTAGMETVLFVIFSLIYLFTLLGNLLILTAVVSSSTLHTPMYFFLGLLSIFDMLFPSVTCPKMLFYLSGQSHAISYEGCVAQLFFYHFLGSTEG
CLYSAMAYDRFVAICHPLRYMLIMRPGVCVGLVMAACLVGCLHATILTSFTFQLTYSGSNLVDYFFCDIPAVLPLACADSSLAQRVGSTNVGFLALMLWFSVCVSYTRIG
IAILRIRSAEGRQKAFSTCSAHLTAILCAYGPVIIIYLQPTPNPLLGAMVQILNNIVSPMLNSLIYSLRNKEVKSSLKRVFRHLVFISLE*
231 >lcl|XP_003434599.1|Plus110390062..10390997 NW_876312 putative olfactory receptor 10D4-like LOC100688253 __SEG__ Chr5 {Canis lupus familiaris} MRNHTLVTEFILLGIPETEGLETVLFFLFSSLYLCTLLGNVLILTAIVSSSRLHTPMYFFLGNLSMFDLGFSSTTVPKMLLYLSGQSQGISFQGCMSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYMVIMNHRVCSILATGTWMGGCVHAIILTSLTFQLTYCASNEVDYYFCDIPAVLPLACGDTSLAQRVGFTNVGLLSLICFFLILVSYTHIG
ISISKIRSAEGRQRAFSTCSAHITAILCAYGPVIIIYLQPNPSALLGAIIQILNNLVTPMLNPLIYSLRNKDVKSALRNVFHKRGFAVENK*
232 >lcl|XP_003434600.1|Plus110514381..10515409 NW_876312 olfactory receptor 10S1-like LOC100688600 __SEG__ Chr5 {Canis lupus familiaris} MFVDVSFAAKGITNRSGCEQTAMETEDPNQTVVSHFFLEGLMYTAEQPSLFFLLFLLTYSITLTGNLLILLTVGSDPHLCSPMYHFLGHLSFLDACLSTVTVPKVMAGLL
TVDGKVISLEGCALQLYCFHLLASTECFLYTVMAYDRYLAICQPLRYPVAMNSRMCVGLAGTTWAVGAVHSAIHTSLTFHLPYCGPHHIAYFFCDIPPVLKLACADTSVN
ELVMLANIGVVAAGCLILIVVSYVFIVAAVLRIRTARGRRRAFSTCTSHLTVVLLYYVPPVCIYLQPRSGGAGAGVPAVFYTIVTPMLNPFIYTLRNKEVKRALQRLLSR
GPRESPSGSPPP*
233 >lcl|XP_003434601.1|Plus1<10592420..10593403 NW_876312 olfactory receptor 8D4-like LOC100688741 __SEG__ Chr5 {Canis lupus familiaris} PDLALFLLSLQISQKRMGLRNQSAVTGFLLSGLTDQPELQLPLFCLFSGIYAVTVAGNLGMISIIGLSSQLHTPMYHFLSSLSFLDVCYSSVITPRMLADFLCNDKAISY
SGCMTQLFFFCIFVISECYMLAAMAYDRYVAICSPLLYHVIMSPRACSLLVAAGFSVGLIDAMIHGGCILRLTFCGPNIIKHYFCDIIPLIQLSCSSTYIDELLIFVIGG
FNMVATSLTIIISYGFILSKILHIHSMQGRSKAFSTCSSHLTAVLIFYGTLMSMYLKPASSRSLIQEKVSSVFYTTVIPMLNPLIYSLRNKEVKNALMKLLKRKVSL*
234 >lcl|XP_003434602.1|Plus110702807..10703745 NW_876312 olfactory receptor 6X1-like LOC100688953 __SEG__ Chr5 {Canis lupus familiaris} MRNGTTITEFILVGFPDIQGLQIPLFIVIFFIYILTLVGNGLIIVIVWAEPRLQIPMYFFLCNLSFLETWYTTTVIPKLLETFVVARATISIPCCLLQSFFHFFLGTTEF
FILTIMSFDRYLAICKPLRYPTIMTSNLCLQLALSSWMVGFTIVFCQMLLLIQLPFCGNNVINHFYCDVGPILKAACVDTSILELLGLLATILVIPGSLLFTVISYIYIL
STILQIPSATGRQKTFSTCASHLTVVSLLYGAVLFMYLRPTTHSSFKINKVVSVLNTILTPLLNPFIYTIRNKEVKAALRKTMTCPKTHHPE*
235 >lcl|XP_003434606.1|Plus110058028..10058960 NW_876312 olfactory receptor 145-like LOC100686309 __SEG__ Chr5 {Canis lupus familiaris} MAPTNSSFVTEFILVGLTDLPDLQLPLFCLFLLMYMVTLLGNLGLIFLIGLNSHLHTPMYFFLFNLSFIDFCYSSVFTPKMLINFISKKNIISYKGCMTQLYFFCFFAIS
ECYVLTSMAYDRYVAICNPLLYNVVMSPNVCFSLMLGSYLMAFSGAMAHTGRMLRLTFCDVNTINHYLCDILPLLQLSCTSTYVNELVVYIVVGINVIVPTVTIFVSYGF
ILSSILRISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSAGSMDEGKISSVFYTTTVPLMNPFIYSLRNKDIKLALRRNQSRKMF*
236 >lcl|XP_003434607.1|Plus110072688..10073620 NW_876312 olfactory receptor 147-like LOC100686560 __SEG__ Chr5 {Canis lupus familiaris} MAPGNASLVTEFILVGLTDLPDLQLPLFCLFLLMYVVTVLGNLCLVTLIGLNPHLHTPMYFFLFNLSFIDLFYSSVFTPKMLIHFTSKKNIISYRGCMTQLFFFCFFGIS
EAYVLTSMAYDRYVAICNPLLYNVVMSPNVCSLLMLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYLCDILPLLQLSCTSTYVNELVVLIVEGINVIVPTVTIFVSYGF
ILSSILRISSTEGRSKAFSTCTAHIIAVTLFFGSGAFMYLKPSSAGSMDEGKISSVFYTNVVPMMNPFIYSLRNKDIKLAVRKTLSKRVF*
237 >lcl|XP_003434610.1|Plus110110587..10111519 NW_876312 olfactory receptor 8B3-like LOC100687028 __SEG__ Chr5 {Canis lupus familiaris} MAPTNSSFVTEFILAGLTDLPDLQLPLFCLFLLMYVVTVLGNLGLIILIRLNSHLHTPMYFFLFNLSFIDFCYSSVFTPKMLIHFTSKKNIISYRGCMTQLYFFCFFVIS
ECYVLTSMAYDRYVAICNPLLYNVAMSPNVCSLLMLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYLCDILPLLQLSCTSTYVNELVVFIVVGVNIIVPTVTIFVSYGF
ILSSILRISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSARSMDEGKISSVFYTNVVPLMNPFIYSLRNKVIKLALRKIQSRRMF*
238 >lcl|XP_003434814.1|Plus1834262..835221 NW_876318 olfactory receptor 2AE1-like LOC100686764 __SEG__ Chr6 {Canis lupus familiaris} MWQRNQTFLADFILEGLFDDSLIHLFLFSLTILVFLIAVSGNTLTILLICADAQLHTPMYFLLSQLSLMDLMHVSTTIPKMATNYLSGKKTISFVGCATQHFLYLSLGGG
ECLLLVLMSYDRYVAICHPLRYTILMNRKVGLMMAIMSWLGASINSLIHTVILMHFPFCGSRKIHHFYCEFPAVVKLVCGDITVYETIVYISSVILLLFPIFLVSTSYGF
ILHSVIQMHSAGSKRNAFATCSSHLIVVSFWFGACIFSYMRPRSQRTPLQDKVGSVFYSIITPTLNPLIYTLRNKDIAKAMRRVLGRDILTQRQQLPLP*
239 >lcl|XP_003434911.1|Plus1complement(19312437..19314455) NW_876321 vasorin-like LOC100688709 __SEG__ Chr6 {Canis lupus familiaris} MCSRIPLSLVLLLLALEPGVQGCPSGCQCNQPQTVFCTARQGTTVPRDVPPDTAGLYIFENGITTLDVGSFASLLGLQLLDLSQNQIASLPGGVFQPLANLSNLDLTANR
LREITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDCLLELKLQDNELRALPPLHLPRLLLLDLSHNSLPALEPGTLDTANVEALRLAGLGLRRLDEGLFSRLRNLHDL
DVSDNQLERVPPAIQGLRGLTRLRLAGNTRIAQLRPEGLAGLVALQELDLSNLSLQALPHELSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESRVALASPEETRCHFP
PKNAGRLLLDLEYADFGCPATTTTATVPTTKPAVRGPTFSPSSPAPTWLAPTEPATEAPSLPPAAPPTVGPPPRPQDCPASICLNGGTCHLGVQGHLECLCPEFFVGLYC
ESRVRQGPQPSPAPGTLEPPPPLPLGIEPASPTSLRVGLQRYLQGGTVQLRSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVRPLGVGRVPEGEEACG
EARTPPAIRSNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVRRGRAAAAIAHGKGQVGPGTGPLELEGVKAPLEPGPKATEGGGEVAPSGPECEVPLMGYPGP
GPQGPLPTKPYI*
240 >lcl|XP_003434920.1|Plus1complement(21905418..21906515) NW_876321 somatostatin receptor type 5 SSTR5 __SEG__ Chr6 {Canis lupus familiaris} MEPLFPAPTLAGWNASSAAPGGGGDNGTQAGLAPSPGARAVVVPVLYLLVCAAGLGGNALVIYVVLRHAKMKTVTNIYILNLAVADVLLMLGLPFLATQNAVSYWPFGPV
LCRLVMTLDGINQFTSIFCLTVMSVDRYLAVVHPIRSTRWRRPRVAKLASAAVWAFSLLMSLPLVVFADIQEGWNTCNLSWPEPVGLWGAVFIIYTSVLGFFGPLLVICL
CYLLIVVKVKASGVRVGATRRRSERKVTRMVVVVVVVFVGCWLPFFIVNIVNLAFVLPEEPASAGAYFFVVILSYANSCANPVLYGFLSDNFRQSFRKVLCLRKGYGAED
AEATEPQPDKSSRLQEAMLPARGSEANGLMQTSRL*
241 >lcl|XP_003434943.1|Plus140462155..40462433 NW_876323 dolichol-phosphate mannosyltransferase subunit 3 DPM3 __SEG__ Chr7 {Canis lupus familiaris} MTKLAQWLWGLALLGSTWAALTTGALGLELPSPCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGMRF*
242 >lcl|XP_003435045.1|Plus1complement(31123352..31125307) NW_876323 rab proteins geranylgeranyltransferase component A 2 CHML __SEG__ Chr7 {Canis lupus familiaris} MADSLPTEFDVVIIGTGLPESILAAACSRSGQRVLHLDSRSYYGGNWASFSFSGLLSWLKEHQQNGDNAEESTASWQGLVHETEEAIALRKKDETIEHIEVFCYASQDMD
DNIEEISALQKNPSAVTSKPLDSVCLSEETNSLHVTSSETHAKDTPKSDEEISLEVTDVEDILAEEKCCGDKTCINTASGGDKDENKPIEEDNTDQPKRNRITYSQIVKE
GRRFNIDLVSKLLYSQGLLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRILMKFLTFCLDYEQHPDQYQAFVHCSFSDYLKTKKLTPNL
QHFVLHSIAMTESSCTTIDGLKATKNFLRCLGRFGNTPFLFPLYGQGEIPQCFCRMCAVFGGIYCLRHKVQCLIVDKESGRCKAIIDHLDQRINAKYFIVEDSYLSEETC
SNVQYKQISRAVLITDQSILKKADSDQQISILIVPPMESGTCAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEIDKEELTKPRLLWALYFN
MRDSSGISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEIFPNEDFCPPPPNPEDIIFDGDDKQPEALGTNNIIMAKPDYSEENKNPESPENHLQN*
243 >lcl|XP_003435070.1|Plus1complement(793705..794643) NW_876326 olfactory receptor 4L1-like LOC100682714 __SEG__ Chr8 {Canis lupus familiaris} MDLKNGSVVTEFILLGFSGQREFHIFFFVTFLLIYSATVWGNILIMVTVKFSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMITDLLSEHKTISVWGCMTQMFFMHLFGGA
EMTLLIAMAFDRYVAICKPLHYRTIMSHRLLSGFMILSWTIGFVHTMSQMVLTVNLPFCGPNVIDNIFCDLPLVIQLACMDTYTMEFFVIADSGLLSLICFILLLVSYTV
ILITVQQRSSGGLNKALSTLSAHIIVVTLFFGPCIFIYAWPFNSFAGNKVLAVFYTIITPLLNPVIYTLRNQKMQGAMRKLWFQRVISTQKF*
244 >lcl|XP_003435072.1|Plus1703781..704707 NW_876326 olfactory receptor 6C4-like LOC100683286 __SEG__ Chr8 {Canis lupus familiaris} MKNRTFTEFILLGFTNQPDIQVVIFIFLFITYILSVLGNLTIIILTLVDPHLQTPMYFFLRNFSFLEVSFTSIFIPRFLTSVTTGNKVISFAGCLVQYFFAIFLGATEFY
LLASMSYDRYVAICKPLHYLIIMSNRVCIQLVFCSWLGGFLAILPPIILMSQVDFCASNILNHYYCDYGPLLELACSDTSILEVMVIFLAVVTLVVTLLLVTFSYTYIIR
TILRIPSAQQRKKAFSTCSSHMIVISLSYGSCMFMYINPSAKEEGSFNKGIAVLITSITPLLNPFIYTLRNQQVKQAFKDAVKKIVKL*
245 >lcl|XP_003435082.1|Plus1complement(39010216..39010665) NW_876327 calmodulin-like LOC610013 __SEG__ Chr8 {Canis lupus familiaris} MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLVQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYIGAAELCHVM
TNLGEKLTDEEVDEMIREADIDGDGQVNYEDFVQMMTAK*
246 >lcl|XP_003435105.1|Plus155206241..55208223 NW_876327 leucine-rich repeat transmembrane protein FLRT2 FLRT2 __SEG__ Chr8 {Canis lupus familiaris} MGLQTTQWPSHGAFFLKSWLLISLGLYSQVSKILACPSVCRCDRNFVYCNERSLTSVPLGIPEGVTVLYLHNNQINNAGFPAELHNVRSVHTVYLYGNQLDEFPMNLPKN
VRVLHLQENNIQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPVDLQELRVDENRIAIISDMAFQNLTSLERLIVDGNLLTNKG
IADGTFSHLTKLKEFSIVRNSLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRVLTQGVFDNLSNLKQLTARNNPWFCDCSIKWVTEWLKYIPS
SLNVRGFMCQGPEQVRGMAVRELNMNLLSCPTTTPGLPAFTPAPSTAPPTTQPPTLSVPTPGRSHTPQTPTTARLPTVPAWDGRERATPPVSERIQLSVHFVNDTSIQVS
WLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSLVNLEPRSTYRICLVPLDAFNYRAVEDTVCSEATTHASYLNNGSNTASSHEQTTSHSMGSPFLLAGLIGGA
VIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSILEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHISNNMRYCNSSVPDLEHCHT
*
247 >lcl|XP_003435123.1|Plus1complement(8564195..8565214) NW_876327 probable G-protein coupled receptor 33-like LOC100688257 __SEG__ Chr8 {Canis lupus familiaris} MDLINFTDLLNVSTLGRNSTHFPAPASNAIIAFLLCMSVIIGSITNGLYLWVLKFKMKKTVNTLLFFHLILSYFISTLILPFIATTYLQNNHWSFGTAMCKVFNATLSVG
MFASIFFLSAISVDRYLLTLHPVWSQLHRTPRWASSIILVIWISAIVLGMPYLIFRETHDDHKGRVTCQNNYAVSPNWESKKMQILGGKIHVAFFIGRFLLGFLLPLFII
TLCYKRVANKMKERGLFKSNKPFKVMVTAIISFFVCWMPYHVHQGLLLTKNQSVLLQLTQILTVITISFYAIFSPTLYLLTGENFKNIFKRSILALFESTLSEDFLAERT
QNLNSEAYI*
248 >lcl|XP_003435130.1|Plus1complement(32556823..>32557944) NW_876327 probable G-protein coupled receptor 135-like LOC100687691 __SEG__ Chr8 {Canis lupus familiaris} TVTNAFILSLSLSDLLTALLCLPAAFLDLFTPPPGGSVPAAAAAAAAGPWRGFCAASRFFSSCFGIVSTLSVALVSLDRYCAIVRPPREKLGRRRALQLLAGAWLAALGF
SLPWELLRAPRAAPAPPAPPAPPAAQSFHGCLYRTSPDPAQLGAAYSVGLVVACYLLPFLLMGFCHYHICRAVRLSDARVRPLTTHARVLRFFGEVRTATALLVMIVFAV
CCWGPHCCLVLLAAARQAPAAQAPSPLNVAAVWLTWANGAINPVIYAVRNPNVSVLLGRSREEGYRPRNVDAFLPSQGPALRARSRDRLRNRCANRLRARSGRSPSNPAS
GMRGDVAVWARKNPVVLFCREGPPGPVTAAVKQPKCEGGDASL*
249 >lcl|XP_003435184.1|Plus128767158..28768480 NW_876327 suppressor of cytokine signaling 4-like LOC100687271 __SEG__ Chr8 {Canis lupus familiaris} MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVNAIEKTEIPLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSG
RHSSGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINPKSNEWISTDLSQNELRDGHLKRRNAEEEVNCFTHTNVQPCVITTNSASCRSGPVTGSVMNLVSN
NSIEDSDMDSDDEIITLCTSSRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRS
LHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFTLQHICRTVICNCTTYDGIDALPIPPSMKLYLKEYHYKSKVRVLRIDAPEQQC
*
250 >lcl|XP_003435317.1|Plus1complement(8555543..8556580) NW_876332 protein Tob1-like LOC100683517 __SEG__ Chr9 {Canis lupus familiaris} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGSQQQPQQQQQPSQPPPPPPPPQQQQQQKASALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLN
NMQYSNQQFQPVMAN*
251 >lcl|XP_003435329.1|Plus1complement(15229695..15230144) NW_876332 calmodulin-like LOC100688103 __SEG__ Chr9 {Canis lupus familiaris} MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAKLQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM
TNLGEKLTDEEVDEMIREPDIDGDGQVNYEEFVQMMTAK*
252 >lcl|XP_003435367.1|Plus1619687..620031 NW_876333 notch-regulated ankyrin repeat-containing protein-like LOC100683070 __SEG__ Chr9 {Canis lupus familiaris} MSPVEVSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYA
GGGR*
253 >lcl|XP_003435496.1|Plus19256641..9259757 NW_879562 toll-like receptor 8-like LOC100684828 __SEG__ ChrX {Canis lupus familiaris} MSPRSLVLTCLFLLISDSYEFVTKANYSRSYPCDERRQNGSVIAECNGRRLQEVPQTVGKYVTVLDLSDNYITHITNESFHGLQNLTKINLNHNANPQHLSENPDNKNGM
NITDGAFLNLQNLNQLLLEDNQLYQIPAGLPGSLKELSLIQNNIIWVTKKNTSGLTNLERLYLSWNCYFGNNCNNKTFNIEDGTFESLTNLEVLSLSFNKLVHVPPKLPS
SLKELYLSNAKIKIISQEDFKGLRNLRVLDLSGNCPRCFNAPFPCTPCEGGASIQIHPLAFQTLTELRYLNLSSTSLRKIPATWFDNMRNLKVLHLEFNYLVDEIASGEF
LTKLPVLEILDLSYNYVKAKYPKYINISHNFSSLKLLQALHLRGYVFQELRAGDFEPLMGLSNLKTINLGVNFIKQINFTLFQNFPNLSIIYLSENRISPLVNDIRQNEV
NGSSSQRHVLKPRSADMEFDPHSNFYHNTHPLIKPQCTVYGKALDLSLNSIFFIGREQFEAFHDIACLNLSSNGNGQVLHGNEFSAVPHIKYLDLTNNRLDFDDDNALSD
LPELEVLDLSYNAHYFRIAGVTHRLGFIQNLTQLKVLNLSHNSIYTLTEQDLRSVSLEELVFSGNRLDILWNAEGDKYWKIFTRLRNLTRLDLSLNNLRRIPNEAFLNLP
QSLTQLYIKNNALNFFNWTLLQEFPRLQVLDLSGNRLSSITNSLSKFTSSLQTLLLHRNRISHLPASFLSEASSLIHLDLSSNLLKMINKSTLQTKTNTSLAILELGRNP
FDCTCDIGDFRRWMDENLNVTIPRLTDVICSSPGDQRGKSIVSLELTTCISDTLAAVLCIFTSFITVTVMLAALGHHWFYWDVWFIYHVCLAKVKGYRSVSTSQTFYDAY
VSYDTKDASVTDWVINELRFHLEESEGKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTIFVLTKEYAQNWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLR
QRICKSSILQWPDNPKAEGLFWQSLKNVVLTENDSRYNNLYVDSIKQY*
254 >lcl|XP_003435549.1|Plus135960541..35961551 NW_879562 probable G-protein coupled receptor 82-like LOC100683784 __SEG__ ChrX {Canis lupus familiaris} MSNNSTCIQPSRISSMALPIIYTFLCIVGLFGNSLSQWVFLTKIAKKTSTHIYLAHLVTANLLVCSAMPFMGIYFLKGFQWEYRSAQCTVVNFLGTLSMHASMFVSLLIL
SWIAISRYATLMKKDSVQETTSCYEKVFYGHLLKKFRQPNFARKLCVYIWGVVLGIIIPVIIYYSVVEATDGDENVCYNRQTELGAVISQTAGLIGTTLIGFSFLVVLTS
YYSFVSHLRKIRTCTSIMEKDLTYSSVKRHLLVIQVLLVVCFLPYSIFKPIFYVLHQRENCQQLNYLIEIKNILTCLASARSSTDPIIFLFLDKTFKKTLYNLFTKSDSP
HIQPYG*
255 >lcl|XP_003435550.1|Plus135939668..35940714 NW_879562 LOW QUALITY PROTEIN: probable G-protein coupled receptor 34-like LOC100683845 __SEG__ ChrX {Canis lupus familiaris} MANQSSHVPGNNCSMDEKLLSSMLTISYSVIFIVGLIGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINGNQWTLGVILCKVVGTLFYMNMYISII
LLGFISLDRYIKINRSIQQRRTTTTKQSIYVCCIVWIVALGVFLIMIILTPKRRDHDSTMCFHYREKRNAKGEAIFNYALVVMFWLIFFLIILSYIKIGKNLLRISKRRS
KFPNSGKYAKTARNSFIVLIIFTVCFVPYHAFRFVYISSQLNGSSCYWKEIIHKTNEIMLVFSSFNSCLDPVMYFLMSSNIRKIMCQLLSRRFQGEASRSESTSEFKPGY
SLHDTSVAAKIQPTS*ST*
256 >lcl|XP_003435594.1|Plus1complement(70579124..70579417) NW_879563 protein S100-A10-like LOC100687748 __SEG__ ChrX {Canis lupus familiaris} MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK*
257 >lcl|XP_003435614.1|Plus112809863..12810840 NW_879563 probable G-protein coupled receptor 174-like LOC100683878 __SEG__ ChrX {Canis lupus familiaris} MPINVTCTGPDGDKTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLV
CISVRRFLFLIYPFRFHDCKQKYDLYISIAGWLIICLACLLFPLLRTSDDTAGNRTKCFVDLPTRNVNLAQYIAMMTIGELIGFVTPLLIVLYCTWKTVLSLHDKYPVAQ
DLGEKKKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNKIQSCLTRRVILIFHSVALCLASMNSCLDPVIYYFTTNEFRRRLSRQDSIQLHAKSFVSNHTTELC*
258 >lcl|XP_003435638.1|Plus1complement(11854157..11855179) NW_879563 cysteinyl leukotriene receptor 1-like LOC100686426 __SEG__ ChrX {Canis lupus familiaris} MDGVGNLTVSSANNNKCNDTIDDFRNQVYSTLYSMISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNL
YCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCLGIWIFVILASSPFLLSTSYKDEKNNTKCFEPPQDNQAKNHVLVLHYVSLFVGFIIPFVIIIACYTMIILTLL
KNSMKKNLSSRKKAIGMIIVVTAAFLISFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSVTYVPKKKASL
PEKGEEICKE*
259 >lcl|XP_003435640.1|Plus112228457..12229569 NW_879563 lysophosphatidic acid receptor 4 isoform 1 LPAR4 __SEG__ ChrX {Canis lupus familiaris} MGDRRFIDFQFQDLNSSFRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSASLFVFCFRMKKRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTL
CKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILN
VSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINTHLKM
ESLFKTETPLTTKPSLPAIQEEVSDQTTHNGGELMLESTF*
260 >lcl|XP_003435652.1|Plus173973167..73974105 NW_879563 olfactory receptor 1D2-like LOC100683490 __SEG__ ChrX {Canis lupus familiaris} MARGNQTIVSEFFLLGLSEVPEHQPLLFGLFLCMYVVAVVGNLLIILAIGSTSNLHTPMYFFIANLSCVDICFTSVTIPKMLLNIQTQSQSIPYVGCLTQMYFLILFLEL
DNVLLAVMAYDRFVAICHPLHYTITMSPKFCITVVSVALIITNIYPLIHTLLMDTLSFCASVRIHHIFCELYALLKLSCSDIHINELVVYTLGSCLFVAPFLFISVSYMH
IFSAILRLHSSQSKLKAFSTCSSHLAVVSLFYGTLFGVYLRPSSSYTIEDSVATVLYAVVAPMLNPFIYSLRNKDMKGALRNLLRWRKIWSW*
261 >lcl|XP_003435705.1|Plus143643078..43645096 NW_879563 transcriptional regulator Kaiso ZBTB33 __SEG__ ChrX {Canis lupus familiaris} MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTSQDGNAETLPPGSSDKNLEIQKSKDEAQDNGATIMPIITESFSLSAEDYETKKIIVTDSDDDDDDVIFCSEILPAKDTLPSTNAVAQVQPS
PGSVAISDVAPCTSNNSPPLPNLTPTQKLPTSVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLTTPPNVTSSLPNHMSPSINLLVQNQQTPNSAVLTGNKANEEE
EEEIIDDDDDTISSSPDSAVSNTSLVPQADIPQNATFDGSLVQKMQIPTLLQEPLSNSLKISDIITRNTNDAGLGSKHLMEGQKIITLDTATEIEGLSTGCKVYANIGED
TYDIVIPVKDDPDEGEARLENEIPKTSSGEPANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSGAMPVMKDDAIGYKVDAGKEPAVGTTSTPQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY*
262 >lcl|XP_531810.2|Plus132551722..32553332 NW_876251 suppressor of cytokine signaling 5 SOCS5 __SEG__ Chr10 {Canis lupus familiaris} MDKVGKMWNHFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKERNLSIGDSTPQQQSSPLRENVALQLGSSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGARLAR
RDSYSRHAPWGGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSMHDMDSMSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPF
PAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEVSGDSTAIPQANCDSEEDTTT
LCLQSRRQKQRQVSGDSHAHVSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFD
AHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK*
263 >lcl|XP_531945.3|Plus129854153..29855940 NW_876253 ras-related GTP-binding protein A RRAGA __SEG__ Chr11 {Canis lupus familiaris} MSRPIPDCPVLSRADLSRPVLSWAGLSRPILSRPVLSRTVPSCPGLCRPVLSRTVPSCPVLSWAGLSRPVLFRPVLSRPVPSRPVLSRPVLSRPVPSCPVPSCPGPSRAG
LGREPDLATRWQHSRNRASARVHLATAPPARRGQRAARCGSPSAPSLGRPRPAPGAPKRQLLRARAAEGRGPGPAALARPPPEVGVAGTPRPRSPEGELFPGASQPPRPG
RSPPRESSRRRALSGPALPPSAAGTARLHGRACGAPAPRPRPPSAPQVGRALRPIPRRPRRVMPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHS
HVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECA
CFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTS
NTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR*
264 >lcl|XP_531995.3|Plus143606476..43608242 NW_876253 calicin CCIN __SEG__ Chr11 {Canis lupus familiaris} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLISSNDMKTTDELFITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGCMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKDEREKYFKKFF
NYVNLNAVSNKTLMFASNKLMGMENSSAHATLIESVLVDRKQEKPSSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATSAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTNTGDVVQCITFPIDFNHRPLLSFHQDNILCVHSHRQSVEINLQKIKANKTTTSVPLLPNNCPLDVSHAICSIGDSRVFVCGGVTTTSDVQTKDYTINPNA
YLLDQKTGEWKTLAPPPEALDCPACCLAKLPCKILQRI*
265 >lcl|XP_532397.1|Plus118890676..18891866 NW_876257 calcium-binding and spermatid-specific protein 1-like LOC475165 __SEG__ Chr13 {Canis lupus familiaris} MAEDGLPKIYSHPPTERGKTTTEATIFFGADNTIPKSEKNITSEGDHITPVNDYTLESDFSTTDSKLTSPKEKLKSEDNVGSRIIKSSTHVEKEIATLTGTVNSIANDSI
TENLIPVKIDNISSPGATVSLIDFSTNMAKEDILLDTTDPANEDVSITSEVSGTLKEGTTSIADTPNLPAKKDKPDDNNYSSSVKSNVTANEAVQITNSSIPEAEISTAT
EKNFTIPDITAFTEEKITEIDLSLPENDPNPVPKLTDSDEEKFITVFELTTTVERDKDNPEDILLTNEESMDEVNVWMEKDITNEAENNPILLTAVESRYDFVIPTSVAM
NLTEDSSTLTNEDLSENNAIEFVTKDSEPLSETTPDPDTLSHEEDAFTTEMGVFKLFKEEPDEFLI*
266 >lcl|XP_532731.2|Plus1complement(11469027..11470427) NW_876260 muscarinic acetylcholine receptor M2 CHRM2 __SEG__ Chr16 {Canis lupus familiaris} MNNSTNSSSNGLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNAS
VMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKE
KKEPVANQDPVSPSLVQGRIVKPNNNNMPGSDDGLEHNKIQNGKAPRDAVTENCVQGEEKESSNDSTSVSAVASNMRDDEVTQDENTVSTSLGHSKDENSKQTCIKIVTK
TQKGDSCTPTNTTVELVGSAGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACY
ALCNATFKKTFKHLLMCHYKNIGATR*
267 >lcl|XP_532738.1|Plus1complement(5672530..5673471) NW_876260 olfactory receptor 2A1/2A42-like LOC475516 __SEG__ Chr16 {Canis lupus familiaris} MGENQTVVTEFILLGFCLGPRIQMVLFGLFTLFYTLTLLGNGLILGLISLDLRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLRPDKPISFAGCLTQTFLFLSFAHTE
CLLLVVMSYDRHVAICHPLHYCVIMSWRVCITLVVASWACGFLLALVHVSLILRLPFCGPHEINHFFCEILSILKLACADTRLNQVVIFVACMFILVVPLCLVLVSYSRI
LLAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMVPKSRHPEEQQKILFLFYSFFNPMLKPLIYSLRNAEVKGALKRVLYKESHSQLE*
268 >lcl|XP_532739.1|Plus1complement(5822252..5823184) NW_876260 olfactory receptor 2A5 OR2A5 __SEG__ Chr16 {Canis lupus familiaris} MTENQTWVPEFILLGFPLSPKLRVFLFGLFTLFYAFTLLGNSIILGLISLDSRLHTPMYFFLSHLAIVDIAYASNNVPKMLANLLNKEKTISFVPCIMQTFLYMAFAHTE
CLILVMMSYDRYVAICHPLHYSVIMSWRVCTVQAVTSWACGSLLALVHVILILRLPFCGPHEINHFFCEILSVLKLACADTRLNQVVIFAASVFILVGPLCLVLVSYSRI
LFAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSNHPEEQQKILSLFYSLFNPMLNPLIYSLRNTEVKGALKRVLWKERSL*
269 >lcl|XP_533041.1|Plus17669282..7669695 NW_876264 bolA-like protein 1 isoform 1 BOLA1 __SEG__ Chr17 {Canis lupus familiaris} MLSGQLVRHLFSMAGRVCLSRSSAGLGTIGPVEAAIRTKLEQALNPEVLELRNESDAHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALSEELAGRVHALAIQTRT
PAQWKENPQLDMSPPCLGGNKKTRGTP*
270 >lcl|XP_533182.2|Plus1complement(14391035..14391982) NW_876266 olfactory receptor 8J2 OR10C03 __SEG__ Chr18 {Canis lupus familiaris} MASGNLTHLTEFILRGVSDRPDLQMPLFFVFLVIYGLTMAGNLGIITLTSVDSQLQTPMYFFLRHLAIINLGDSTVIAPKMLVNFLASKKTISYYGCAAQLGGFLVFIVG
EIFMLAAMAYDRYVAICNPLLYMVVVSPQICLLLVSLTYLYSLTTALTVSCCVFSVSYCSSNVINHFYCDTVPLLALSCSDTYIPETAVFTSAGTNLFFSMIIVLTSYFH
IVLAILRIRSSEGRRKAFSTCASHMMAVTVFYGTILFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNKDVKDAFKRFLKSPCQSFKLM*
271 >lcl|XP_533377.1|Plus1complement(8085352..8086959) NW_876269 suppressor of cytokine signaling 6 isoform 1 SOCS6 __SEG__ Chr1 {Canis lupus familiaris} MKKISLKTFRKSFNLNKSKEETDFMVVQQPSLGSDFGKDDSLFGSCYGKDMASCDITNEDEKGGKGRSKSESLMGTLKRRLSAKQKQKGKGSTPSGSSADEDTFSSSSAP
LVFKDVRAQRPIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQADTVCQEQSNSLKSSESQNGDLHLHLDEHVPVVIGLMPQDY
IQYTVPLDEGMYPLEGPRSYCLDGSSPMEVSAVPPQVGGSSFAEDENQVEQDLVVAPEIFVDQAVNGLLIGTTGVMLQSPRASHDDAPPLSPLLPPMQTSQIQRNFSGLT
GTDAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRF
SFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY*
272 >lcl|XP_533887.3|Plus1complement(21211175..21212116) NW_876272 olfactory receptor 1F1 OR10A11 __SEG__ Chr20 {Canis lupus familiaris} MEDANLTSVTEFLLLGLSENPKQQQLLFIIFLTMYLVTGLGNLLIILAIATDPRLHTPMYFFLANLAFVDICFTSTTIPKMLANHVSGHKGIPYAGCLTQMFFFIWFAGI
DSFLLAAMAYDRYVAICHPLHYTTSVTPQLCGFLVAASWTAAFGNALTHTVLLTRLSFCTHNRVPHFFCDLSPLLKLACSDIFLNNIMVYTVGALPIITPFVGILVSYIR
IFATVLRIPSTRGKQKAFSTCGSHLSVVSLFYGTLIGVYFSPMSSHTAQKDTAAAVMYTVVTPMLNPFIYSLRNSDMKGALGALINRKPVFSQ*
273 >lcl|XP_533988.1|Plus113759586..13760698 NW_876273 coiled-coil domain-containing protein 89 CCDC89 __SEG__ Chr21 {Canis lupus familiaris} MPQEEKPLRMDPAPTEEPLEKQNKKLEKPEEEMEFKELDGLREALANLRGLSAEEKSEKAMLCSRIQEQSQLICILKRRSDEALERCQILELLNTELEEKRMLEAEQLKA
KSQHAQKLEERFMTLAANHELMIRFKDEHKSQNVKLREENEKLRLENSNLFSQALKDQEAKVLQLTARSEALSKELETLKQRCAQDACQAQAREKELLELQNQQACAHTK
ETEQLRSQLQSLQQQQRQAVEQMAEAERAHSSLNRELQARLQTVTREKDELLQLSMERGRVLQNKQAEIRQLEEKLETADVARRHALERFEQEAVAVDSNLRVRELQRRV
DGIQKAYDELRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
274 >lcl|XP_534339.2|Plus18360890..8362839 NW_876277 leucine-rich repeat transmembrane protein FLRT3 isoform 1 FLRT3 __SEG__ Chr24 {Canis lupus familiaris} MINPAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPAGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKV
FFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPMKVNVR
GLMCQAPEKVRGMAIKDLNAELFDCKDSAVVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDQRTTGSPARKTIIITVKSVTSDTIHISWKLVLPMTALRLSW
LKLGHSPASGSITETIVTGERNEYLVTALEPDSPYRVCMVPMETSNLYLFDDTRVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVTIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS*
275 >lcl|XP_534621.1|Plus14403437..4404387 NW_876280 olfactory receptor 12 LOC477425 __SEG__ Chr25 {Canis lupus familiaris} MPSHSYGNLSKVYFQDFVLEGFSGGLETQALLFAVFLALYMVTVLGNLLMIIVITLDARLHSPMYFFLKNLSFVDLWYSSFIAPNALANFFSSSKVITFTGCAMQFFFLS
ILATTECFLLGVMAYDRFMAICNPLRYPITMCQSACTRLVLGAYCGGCFNSIVQTSFTFHLPFCSSNRINHFFCDVPPLLQIACGNIAINKLLLFGICGLIIVGVMFVIL
ISYGYIIATILRMRSGAGRRKIFSTCGSHMTAVTLFFGTLFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEAVQRLGQKHMTM*
276 >lcl|XP_534623.2|Plus14449756..4450706 NW_876280 olfactory receptor 12-like LOC608416 __SEG__ Chr25 {Canis lupus familiaris} MPSHSNENLSKVYIQDFVLEGFGGGLETQALLFTLFLALYMVTLLGNILMIIIITLDARLHSPMYFFLKNLSFVDLCYSSVIAPNALANFFSSSKVITFAGCATQFFFIS
LMATTECFLLGVMAYDRFMAICSPLRYPSTMCQSACTRLVLGAYCGGCFNSVVQTSFTFHLPFCSSNHINHFFCDVPPLLQIACGNTAINELLLFGICGLIIVGVTFVIL
ISYGYITVTILRMGSGAGRHKIFSTCGSHMTAVTLFFGTLFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEAVQRLGQKHTVM*
277 >lcl|XP_535560.2|Plus1complement(11863450..11866950) NW_876295 nuclear receptor-interacting protein 1 NRIP1 __SEG__ Chr31 {Canis lupus familiaris} MTHGEELGSDVHQDSIVLTYLEGLLMHQAAEGSGTAVDKKSAGHNEEDQNFNISGNAFPACQSNGPVLNTHSYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIVNLNV
KKEALLAGMVDNVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALGHDSLKVEKDLRCYGVASSHLKTLLKKSKAKDQKPDTNLPDVSKNLIRDRFVESPH
HVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKEVGSFQLSKGMSSHLNGQAR
TSSSKLMASKNTAFQNPMGVVPSSPKNAGYKNSLERNHLKQAANNSLLLHLLKSQTIPKPMNGHNHSERGSIFEDSSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPID
LSCKHRIEKPEPDQPVSLDNLTQSLLNTWDPKVPTVDVKEDQDTSKNSRLNSHQKVTLLQLLLGHKNEESVERNSSPQEVHGDVTKFGSQNFARTSVIESPSTSRTTPVS
TPPLLSSTKAESPINLSQHSLVIKWNPPPFACGSQAEKPATSASNPLMDLTKSKDPLGEKPAHSEGAQNSATFSASKLLQNLAQCGVQASAPGEEQRPSKQLLSVNADRP
LGMVERLSSPLLSNKTHAAEDNRAFGSPAAGPEAGLSGSEIENLLERRPVLQLLLGNPHKGKGDKKDKTPLRDESAQEHADRALSEQILTVKIKSEPCDDSRSPSPSVRL
SPDARGAPFPGAAPPAQRSAPDGLKAEPVSPQDFSFSKNGLLSRLLRQNQESYLAEEGDGSRRSGELALLEARTLCVVPKKRKLYSEPLENPFKRMRNSVADAADSHGAP
EGLYGPPLSQQELKCSRSDLEFKFPGSQGPAGDAEHRAWARESKSFNVLKQLLLSENCVRDLSQHRSGSAGEGRRKGHRGAAGGGKPELSIPALDGLLYGPAQPGGCGDS
RTGPGPRPGPGPGPHPRTCPCPARAPSSPPFPEPGGCAGSRPEPGPANGCAGGAGDKGPIKWVIADADRNGYERDCPRLTKTNPILYYMLQKGGGPVAGRDTQDKDAWGE
PSSAESVAQVTVKEEFVPAAETRAAGFSLRGPYSSPPGRSAPRPHSANGEGYGLLGNVLAIKKEAE*
278 >lcl|XP_536041.1|Plus1complement(14726523..14727590) NW_876304 G-protein coupled receptor 1 GPR1 __SEG__ Chr37 {Canis lupus familiaris} MEDLEERLFEEFENYSYTLEYYSSESDLEEKGHVGAVHWVSLVLYCLAFILGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLC
KANSFIAQLNMFASVFFLTVISLDRYIHLIHPVVSHRHRTLKNSLIVIIFIWFLASLMGGPALYFRDTLEFDNHTLCYNNFHEHDPDLTLMRHHVLTWVKFIVGYLFPLL
AMSICYLCLIFKVRKRSILVSSKHFWTILAVVMAFLICWTPYHLFNIWELTIHHNSHFHQVLQAGIPLSTGLAFLNSCLNPILYVLISKKFQTRFRASVAEILKHTLWEV
SCSGTVSEQLRNSETKNLCLLETAQ*
279 >lcl|XP_536065.2|Plus1complement(24863496..24864551) NW_876304 c-X-C chemokine receptor type 2 CXCR2 __SEG__ Chr37 {Canis lupus familiaris} MWNITDWWESAEDEFGDFTGTPPTEIYSPCKIDTETLNKYAVVVIYALVFVLSLLGNSLVILVVLYSQIGHSVTDVYLLNLAIADLLFALTLPIWAVSKVKGWIFGTPLC
KIVSLLKEVNFYSGILLLACISMDRYLAIVHATRRLTQKRHWVKFICLGIWALSLILSLPIFVFRRAINPPYSSPVCYEDMGTNTTKLRIVMRALPQTFGFIVPLMIMLF
CYGLTLRTLFEAHMGQKHRAMRVIFAVVLVFLLCWLPYNLVLVADTLMRLQAIEETCQRRNDIGRALDATEILGFFHSCLNPLIYAFIGQKFRHGLLKIMAFHGLISKEY
LPKDSRPSFVGSSSANTSTTF*
280 >lcl|XP_536541.3|Plus1complement(10551294..10552238) NW_876312 olfactory receptor 4D5 OR4D5 __SEG__ Chr5 {Canis lupus familiaris} MNPTNHTQVTGFVLLGLSQVWELRFFFFIVFSAVYLMTVMGNLLIVAIVTSDPRLHTTMYFLLGNLSFLDFCYSTITAPRMLVDLLSGNPIISFGSCLTQLFFFHFIGGI
KIFLLTVMAFDRYIAISQPLRYRIIMNRTVCGLLVVASWVGGFIHSIVQVGLTIQLPFCGPDRLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTA
LLVMLRGHSREGRSKALSTCASHIAVVTLIFVPCVYIYARPFRTFPMDKVVSVLYTMVTPMLNPAIYTLRNKEAIMAMKKLWRRQKDLLGPLEH*
281 >lcl|XP_536672.3|Plus113066412..13067329 NW_876313 serine/threonine-protein phosphatase 6 catalytic subunit PPP6C __SEG__ Chr5 {Canis lupus familiaris} MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLL
RGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPGGAGWLFGAKV
TNEFVHINNLKLICRAHQQVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLVRAVPDSERVIPPRTTTPYFL*
282 >lcl|XP_537923.2|Plus1complement(197274..198386) NW_876319 G-protein coupled estrogen receptor 1 GPER __SEG__ Chr6 {Canis lupus familiaris} MDVTSPVPVFGMETRPGASNSTSPELNLSHTLTGAILANQTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIE
VFNLDEQYYDITVLCTFMSLFLQINMYSSIFFLTWMSFDRYIALAKAMRSSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTEDVCFCFADVKEIQWLEVTLGFII
PFAIIGLCYSLIVRVLIKAHKHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQRTQPGDAPCKQSFRHAYPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKL
RLYIEQKTNMSALNRFCHAALKAVIPDSTEQSDVRFSSAV*
283 >lcl|XP_538213.3|Plus17847..8773 NW_876295 olfactory receptor 6C4 OR6C4 __SEG__ Chr31 {Canis lupus familiaris} MKNRTFTEFILLGFTNQPEVQVVICIFLFLIYVISVLGNLTIIILTLVDPHLQTPMYFFLRNFSFLEVSFTSIFIPRFLTSVTTGNKVISFAGCFIQYFFAIFLGATEFY
LLASMSYDRYVAICKPLHYLTIMSNRVCIQLVFCSWLGGFLAILPPIILMSQVDFCASNILNHYFCDYGPLLEIACSDTSLLEMIILFVASVTLVVTLLLVTFSYTYIIR
TILRIPSAQQRKKAFSTCSSHMIVVSLSYCSCMFMYINPSAKEEGTFNKGMAVLITSITPLLNPFIYTLRNQQVKQAFKDTIKKIVKL*
284 >lcl|XP_538241.1|Plus11125951..1127105 NW_876250 G-protein coupled receptor 182 GPR182 __SEG__ Chr10 {Canis lupus familiaris} MPAREDAGPAPPGAVTSAPAGDPGEIRNWDELLYFFNHTLPECHVELREDAKQVTLFVLYLAIFVVGLLENVVVIGVSWRRAGRGLLSLYALHMAVADLGIVLSLPVWML
EVALDYTWLWGGFSCRFTHYFYFANMYSSIFFLLCLSVDRYVSLAAPGPQPQQQRLRRAVCAGVWLLAAVLPLPEVAHMQLLDGAEPVCLFMAPFEAYSAWALAVALSTS
VLGFLLPFPLMVLFNVLTACRLRRAGRPEGRRHCLLVCAYLGAFAACWLPYHATLLLLTLHGTHVSLHCYLVHLLYFFYDIIDCFAMLHCVLNPLLYNFLSPRFREQLLS
AVVHYLPKARARARADRRASSSSSSSSTQHSIVITKEGTQPTAAGAQAHPGGPN*
285 >lcl|XP_538294.3|Plus1complement(16025562..16026500) NW_876250 olfactory receptor 6C2-like LOC481173 __SEG__ Chr10 {Canis lupus familiaris} MKNYTAITTFILVGLTNDPHLQILLFIFLFLTYLLSVVGNLTIISLTLVDSHLKTPMYFFLRNFSILEVFFTTVCIPRFLYTMASGDNTVTYNACATQLFFVVILGVTEF
FLLTAMSYDRYVAICKPLHYMTIMNNRVCIKFLIGCYMLALLIVLPPYIMGFKLEFCDSNVIDHFGCDAAPILKITCSDTEFIERFVLVLAVLTLIFTLVCVILSYTYII
RTILRFPSVQQRKKAFSTCSSHIIVVSITYGSCIFIYIKPHAKEGVAINKVVSVLTTSVAPVMNPFIYTLRNKQVVQAFKDMIKRVASISKN*
286 >lcl|XP_538442.1|Plus1complement(21749094..21750212) NW_876251 probable G-protein coupled receptor 45 GPR45 __SEG__ Chr10 {Canis lupus familiaris} MACNSSTIETYQDLLLNGSNVSDSGVPLAPAPLRISLAIIMMLMIVVGFLGNAVVCIIVYQRPAMRSAINLLLATLAFSDIMLSLCCMPFTAVTLVTVHWHFGDYFCRLS
ATLYWFFVLEGVAILLIISVDRFLIIVQRQDKLNPRRAKRIIAVSWALSFCVAAPSLAGRTFVEVPARAPQCVLGYTELPAQRAYVVALVVAVFFVPFGVMLCSYLCILH
TVRKNAIRVHNQSDSLDLRQLTRAGLRRLQRQQQVSLDLSFKTKACTTILILFVGFSLCWLPHSVYSLLSVFSRGFYCSSSFYTTSSCVLWLSYLKSVFNPIVYCWRIKK
FREACIELLPQTVQILPKVPERIRRRIQPSTVYVCNENQSAV*
287 >lcl|XP_538571.1|Plus12867978..2868919 NW_876252 olfactory receptor 1D2 cOR1X2 __SEG__ Chr11 {Canis lupus familiaris} MSRGKENVTGVTEFLLLGITSDPEQRQVLFWLFLCMYLVTVAGNTLIILVIGSHPRLHTPMYFFLINLSFVDICFTTNLIPKLLVNHVAGTWTISYPHCLTQMYFLISFA
NLDTFLLAAMALDRYVAICKPLLYHTIITPQLCRGLTTLMWTCSGLISLVHTLLMNGLTFCSSAREILHFYCDAYLLMKIACSDTRVNQHMFLGAVVLFVAPCALIVVSY
IRIATAVLRIPSALGRRKAFSTCSSHLSVVTLFYGTVLGVYIRPPKSFSVQDTVATVMYTVVTPMLNPFIYSLRNQDMKEAVGRLFSKGSKSS*
288 >lcl|XP_538589.1|Plus1complement(975388..976320) NW_876252 olfactory receptor 10 cOR2AI2 __SEG__ Chr11 {Canis lupus familiaris} METANDSTGGYFILVGFSERPELELILSFFVLMFYTVTLVGNVAIVLLSILDTGLHTPMYFFLRNLSVLDLCFTTSIVPQMLVNMWGGNKKISYAGCMVQYWVALALGST
ECVLLAVMAVDRYVAVCWPLRYACIMHARLCHLLAAASWSFGFANSFLQSSMAIVLPRCGNRRVDHFFCELLIIIKLSCVDTGPTESKMFIARLIILGMPVSIILTTYVC
ITRAVVKMRSAEGRKKAFGTCASHLMVVSLFYGTIMFLYLQPKDNYSQDQSKALAVLYMILAPTLNPLIYTLRNKDVKKAVRRMIGKEQV*
289 >lcl|XP_538692.1|Plus1complement(36968208..36970028) NW_876253 leucine rich repeat and Ig domain containing 2 isoform 1 LINGO2 __SEG__ Chr11 {Canis lupus familiaris} MLHTAISCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEAGMFSELIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLACDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIRDKKLQHLLVDEGQTVQLECSADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFTSDRFLYANRTPMYMTDSNDTMSNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
290 >lcl|XP_538722.2|Plus1complement(43357507..43358580) NW_876253 putative olfactory receptor ENSP00000348552-like LOC481600 __SEG__ Chr11 {Canis lupus familiaris} MTCPRSGCLASRPVRASSDTCVVRTGLRENEMANQTAVTEYILLGLQEHHKLEMVLFVLCLGIYSVNVLGNSLLIVLNMLDPRLHSPMYFFLSNLSLMDICGTSSFVPLM
VVNFLKTQRTISFPGCALQMYLTLALGTTECLLLAVMAYDRYVAICQPLRYPEIMRRQTCVQMVVLSWGMGFANSLLQSFLTWNVSFCGHNIINHFFCEILAVLKLACGD
ISLNALLIMVATVILTLAPLLLIFLSYIFILATILRVPSAAGRCKAFSTCSAHIIVVVVFYGTISFMYFKPKAKDPDLDKIIALFYGVVTPSLNPIIYSLRNAEVKAAAI
ALLWGDLLSRKMSHLPCCSSTLSCMAG*
291 >lcl|XP_538724.3|Plus1complement(43429883..43430842) NW_876253 putative olfactory receptor ENSP00000348552-like LOC481602 __SEG__ Chr11 {Canis lupus familiaris} MDRFNWTSPVMGFILLGLSAHPKLEKMFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPSKTIPFSACAVQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAASSWAAGSMTATVQTSLAMRLPFCGDNIINHFTCEILAVLKLACADISINVISMAVANVIFLGIPVLFISVSYV
FIIATILRIPSAEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKSKDPQGADKQDISDKLTSLFYGVVTPMLNPIIYSLRNKDVKAAVRNLVLHKHFIQ*
292 >lcl|XP_538726.1|Plus1complement(43453220..43454173) NW_876253 putative olfactory receptor ENSP00000348552-like LOC481604 __SEG__ Chr11 {Canis lupus familiaris} MKMANQSVLAGFVLLGLSDQPKLERTFFVLILSMYLVILLGNGVLILVTIHDSRLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSGCAVQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAASSWVAGGINSLVQISLAVQLPFCGDNIINHFTCEILAVLKLACADISINVISMGVANVIFLGVPVLFISISYIF
ILTTILKIPSAEGRRKAFSTCSAHLTVVVIFYGTILFMYAKPKSKDPLGADKQDVSDKLISLFYGVLTPMLNPIIYSLRNKDVKVAVKTLVRQKRFA*
293 >lcl|XP_538734.3|Plus1complement(44730970..44733003) NW_876253 zinc finger and BTB domain-containing protein 5 ZBTB5 __SEG__ Chr11 {Canis lupus familiaris} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNASQSGEEQPAPMSSSMRSTLDQRTPFPMRRLHKRKQSAEERARQRLRPTMDESAIADVTPE
NGPSGVHSREEFFSPDSLKIVDNPKGDGMTDNQEDSAIMFDQSFGAQEDAQVPSQSDNTAGNMAQLSMASRATQVETSFEQEAATEKSGFQCENSDVGLGEKEHMRVVVK
SEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSNFSANQNNDDNIPNTTSDCRL
EGEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPKMPVVTSVRS
SQIPENSASSQLMMNAATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL*
294 >lcl|XP_538762.3|Plus1complement(51476711..51477751) NW_876253 LOW QUALITY PROTEIN: olfactory receptor 13C3 OR13C3 __SEG__ Chr11 {Canis lupus familiaris} LFR*FVTVVSWQ*KYFMLYFPLTS*KADDMDEINQTSASEFLLLGLAGYPTLEIIYFVLILVMYLVILIGNGLLIIASIFDSHLHTPMYFFLGNLSFLDICYTSSSVPST
LVSLISKKRNISFSGCAVQMFLGFAMGSTECLLLGMMAFDRYVAICNPLRYLIIMNKVVYVLMASVSWLSGGINSIVQTFLAMRLPFCGNNIINHFTCEILAVLKLACAD
ISLNIVTMVISNMAFLVLPLLVIFFSYMFILYTILRMNSATGRHKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQELPGEDKFQTSDKLISLFYGVVTPMLNPIIYSLRNK
DVKTAVKYLLNRKPIR*
295 >lcl|XP_538767.1|Plus1complement(51543084..51544058) NW_876253 olfactory receptor 13C2 cOR13C9 __SEG__ Chr11 {Canis lupus familiaris} MEWENQTILVEFFLKGLSGYPKLELLFFVLILIMYVVILLGNGTLILISVLDSHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYPVIMSKDSYVPMATGSWIIGLVNSAVQTAFVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMLVATTLFILTPLLLIIISYSL
IISSILKIRTSEGRSKVFSTCSAHLTVVIIFYGTILFMYMKPKSKKTLNSDDLDATDKLISMFYGVMTPMMNPLIYSLRNKDVKEAVKHLLKKMCLTSKWERDK*
296 >lcl|XP_538768.3|Plus1complement(51555540..51556496) NW_876253 olfactory receptor 13C2 cOR13C23 __SEG__ Chr11 {Canis lupus familiaris} MEWENQTILVEFFLKGLSGYPKLELLFFVLILIMYVVILLGNGTLILISVLDSHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTT
ECVLLGMMAFDRYVAICNPLRYPVIMSKDSYVPMATGSWFAGVINSAVQTAFVVQLPFCRNNVINHFSCEILAVMKLACADISGNEFIMLVATTLFTLLPLLLIVISYSL
IISSILKIRTSEGRSKAFSTCSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKLISMFYGVMTPMMNPLIYSLRNKDVKEAVKHLFSRRFFSK*
297 >lcl|XP_538840.2|Plus1complement(1359610..1360989) NW_876254 zinc finger and BTB domain-containing protein 12 ZBTB12 __SEG__ Chr12 {Canis lupus familiaris} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGISDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLSIGGSVGGHLGELTQSSVPPSTVAPQQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
298 >lcl|XP_538961.2|Plus120056361..20057425 NW_876254 membrane progestin receptor beta PAQR8 __SEG__ Chr12 {Canis lupus familiaris} MTTAILERLSTLSVSGQQLRRLPKLLEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWAATRSL
PLLLFILSSLTYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYELFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKLCQVVPAGLA
FVLDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSVCTLSQLEAILLDYQGRQEIFLQRHSPLSVYMACLSFFFL
AACSAATAALLRHKVKARLTKKDS*
299 >lcl|XP_539028.1|Plus146551727..46552824 NW_876254 5-hydroxytryptamine receptor 1E HTR1E __SEG__ Chr12 {Canis lupus familiaris} MNLTNCTTEANVAVRPKTITEKMLISVTLVIITTLTMLLNLAVIMAICTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWKLGYFICEVWLSVDMTCCTCSI
LHLCVIALDRYWAITNAIEYARKRTTKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSR
HLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKINTSIRIPSFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLT
WLGYVNSLINPLLYTSFNEDFKLAFKKLIKCREHT*
300 >lcl|XP_539034.1|Plus1complement(47542109..47543527) NW_876254 cannabinoid receptor 1 isoform 1 CNR1 __SEG__ Chr12 {Canis lupus familiaris} MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNAQLVPADQVNITEFYNKSLSSYKENEENIQCGENFMDMECFMI
LNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHR
PLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVT
RPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAA
SVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL*
301 >lcl|XP_539080.2|Plus166758594..66759682 NW_876254 G-protein coupled receptor 6 GPR6 __SEG__ Chr12 {Canis lupus familiaris} MNASASSLNESQVVAVTAEGAAAAATAAGARDGGDWGPPAAAALGGGGAANASLELSSQLPAGPPGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVL
VGSLATADLLAGCGLILHFVFQYVVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERATCSVVR
PLTRSHVALLSAAFFAVFGVMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSREDPAVYTYATLLPATYNSMINPIIYA
FRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV*
302 >lcl|XP_539182.2|Plus1complement(6176445..6177515) NW_876256 G-protein coupled receptor 20 GPR20 __SEG__ Chr13 {Canis lupus familiaris} MSSASPVGSWAPAVPNATAAANSSEPENPLFQQFARLDEELHAAFPGLWLALMAVHGVIFLAGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVFY
GTRGCLRCAFPHVFGYFLNMHCSVLFLTCICVDRYLAIVQPDGSRRWRQPACARATCAFVWMAAGAVTLSVLGVAAGSGPCCRVLALTVLEFLLPLLVISVFTGRIVCAL
SRPGLLRQGRQRRVRAMQLLLTVLVIFLVCFTPFHARQVAVALWPDVPHHASLVAYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFRRHGAGYEPNSSNMVSMHKSS
RGSGHNHILGAGPSAFTQDLADGPGA*
303 >lcl|XP_539329.3|Plus11135009..1135935 NW_876258 olfactory receptor 6F1-like LOC482210 __SEG__ Chr14 {Canis lupus familiaris} MGTDNATRHQDFLLLGFPGSQVLQLSLFMLFLVMYILTVGGNMAILMLVSTSHQLHTPMYFFLSNLSFLEIWYTTAAVPKALAILLGRSQTITFTGCLLQMYLVFSLGCT
EYFLLAAMAYDRYLAICYPLHYGAIMNSLLSAQLALGSWLCGFLAISVPTALISTLSFCGSRTINHFFCDIAPWITLACTSTQAVELVAFVIAFVVILSSCLITLVSYIY
IISTILRIPSASSRSKAFSTCSSHLTVVLIWYGSTIFLHVRLSIKESLDLTKAIHVLNTVVTPVLNPFIYTLRNKEVRETLLKKWKGN*
304 >lcl|XP_539330.3|Plus11184139..1185062 NW_876258 olfactory receptor 13G1 OR13G1 __SEG__ Chr14 {Canis lupus familiaris} MNKSIVTEFLILGFTQKPELQRALFIVFLLIYLVALLGNALIVIAIICNTTLHTPMYVFLLALAIVDIICTTSIIPKMLGTMLTTGRSISYESCMSQLFFFTWSLGAEMV
LFTTMAYDRYVAICFPLRYRTMMNPHMCVALLGITMVIAVTNSWVHTGLILRLTFCGPNIIDHFFCEIPPLLSLSCSPVRINEVMVYVADITLAIGDFTLTCISYGFIIA
AILRIHTAEGKRKAFSTCSSHLIVVSLYYSPVIYTYIRPASSYSFERDKVITALYTLVTPTLNPIVYSFRNKEMQTGIQKVFAFLRH*
305 >lcl|XP_539341.3|Plus11797066..1798004 NW_876258 olfactory receptor 2L2-like LOC482222 __SEG__ Chr14 {Canis lupus familiaris} MRSRNETESTDFILLGFFPEFKHITAVVSIILLIYMAAFTGNTLLIILIWLYSHLHTPMYFLLSQLSLMDLTLTSSIVPKMVANFFSGWRNISFLACGTQIFFSLTVAIA
ECILITLMCFDRYVAICDPLRYPVIINPRVCLRMIAMSWAGGALTSLGHTVFTLHFNICNPREIPHFFCEVMAVLRIVCEDISAYEKAVVITSILVLLLPLSLILSSYVL
ILLAVLRMNSPEGRNKALATCSSHLCVVGLYFGPGMCIYMRPGSAKTPKLNQGLFLFGTVLTPLLNPLAYSLRNKDVLSALKKLMGRYQSSK*
306 >lcl|XP_539343.3|Plus12003337..2004275 NW_876258 olfactory receptor 2L5 OR04C09 __SEG__ Chr14 {Canis lupus familiaris} MENYNQTLTDFLLLGLFPSSRIGLFLFILIVFIFLMALFGNLSMIILIIVDTHLHTPMYFLLSQLSLMDLNYISTIVPKMVSDYLFGNKSISLIGCEVQSFFFLTLAVAE
ALLLTSMAYDRYVAICFPLHYPIRMSKKLCVLMITGSWTIGSINSCAHTAYAFHIPYCRSRTINHFFCDVPAMLTLACMDTWVYEYTVFVSTTLLIVFPFIGIACSYGQV
LLAICRMQSTEGRKKAYSTCSTHLTVVTFYYAPFAYTYLRPRSLRTPTEDKALAVLYTILTPMLNPIIYSLRNKEVIGALRRLIQKISFVKM*
307 >lcl|XP_539344.1|Plus12024809..2025747 NW_876258 olfactory receptor 2L3-like LOC482225 __SEG__ Chr14 {Canis lupus familiaris} MENNNPNSTDFFLLGLFPPSRIGLFFFILIVFIFLMALFGNLCMIILIFLDTHLHTPMYFLLSQLSLMDLSYISTIVPEMASNYLSENKSISFIGCGVQSFFFLTLAGGE
GLILASMAYDRYVAICFPLHYAIRMSKRVCVLMITGSWIMGSINSCAHTAYALNIPYCQSRAINHFFCDVPAMLTLACMDTWIYEYTVFVSTTLLIVFPFIGIACSYGRV
LLAICRMQSTEGRKKAYSTCSTHLTVVTFYYAPFAYTYLRPRSLRSPTEDKALAVFYTILTPMLNPIIYSMRNKEVMGALRRLIQRISSEKM*
308 >lcl|XP_539346.3|Plus12056211..2057149 NW_876258 olfactory receptor 2T33 cOR2T24 __SEG__ Chr14 {Canis lupus familiaris} MNIWNTTSDFILLGLFNYTEAHLFLFVMILTIAFSSLVGNALMILLIHQDFQLHTPMYFLLSQLSLMDMMLISTIVPKMAADYLSGKKSISPAGCGLQIFFFITLEGSEC
FLLASMSYDRYVAVCHPLRYPVLMSWQLCLRMTVGSWSLGAADGLMQAAATLSFPFCDAHEINHFFCEAPTLVRLACADTFVFEYVMYICCVLMLLVPFSLILISYSLIL
AVVLQMRSREARKKAFATCSSHLTVVGLFYGAAIFIYMRPKSYRSANHDKVVSAFYTIFTPVLNPIIYSLRNSEVKGALRKCMGQCATINHE*
309 >lcl|XP_539347.3|Plus12079557..2080495 NW_876258 olfactory receptor 2T33 cOR2T15 __SEG__ Chr14 {Canis lupus familiaris} MKIGNSTSDFILLGLFNYTEAHLFLFVMVLTIAFSSLVGNALMILLIHQDVRLHTPMYFLLSQLSLMDMMLISTIVPKMAADYLSGKKSISPAGCGLQIFFFLTLAGGEC
FLLAAMSYDRYVAVCHPLRYPILMSWQLCLRMTVGSWCLGAADGLMQAAATLSFPFCDAHEINHFFCEAPTLVRLACADTFVFEYVMYICCVLMLLVPFSLILISYSLIL
AVVLQMRSREARKKAFSTCSSHLTVVGLFYGAAIFIYMRPKSYRSANHDKVVSAFYTIFTPVLNPIIYSLRNSEVKGALRKCMGQCATINHE*
310 >lcl|XP_539348.3|Plus12098211..2099149 NW_876258 olfactory receptor 2T33 cOR2T13 __SEG__ Chr14 {Canis lupus familiaris} MNIWNNTSDFILLGLFNYTEAHLFLFVMVLTIAFSSLVGNALMILLIHQDVHLHTPMYFLLSQLSLMDMMLISTIVPKMAADYLSGKKSISPAGCGLQIFFFLTLAGGEC
FLLAAMSYDRYVAVCHPLRYPILMSWQLCLRMTVGSWFLGAADGLMQAAATLSFPFCDAHEINHFFCEAPTLVRLACADTFVFEYVMYICCVLMLLVPFSLILISYSLIL
AVVLQMRSREARKKAFSTCSSHLSVVGLFYGAGIFTYMGPKSYRSANHDKIVSVFYTIFTPLLNPLIYSMRNSEVKGALRKCMGQCAALSHN*
311 >lcl|XP_539353.3|Plus1complement(2302310..2303245) NW_876258 olfactory receptor 2M3 OR2M5 __SEG__ Chr14 {Canis lupus familiaris} MALDNQTFNSDFILLGIFNYSPTHIFLFSMLLVIFTVVFMGNTAMILLIYLDTQLHTPMYFFLSQLSLMDLMLICTTVPKMAFNYLSGSNSISVVECATQIFLYTSLLGC
ERFLWAVMAYDRYIAICYPLRYPNLMSPKICGLMAASSWILGSTDCIIDAVATFFFFYCGSREIDHFCDFPSLLIISCNDTSTFEEVLFYCCIIMIVFPVVIIIASYTHV
IVAVIHIASGEGHQKVFATCSSHLMVVGMYYGTTLFIYMRPASDRSPTQDKMVSVFYTILTPMPNPLVYSLRNKEVARAAMKVLEKGRSGQ*
312 >lcl|XP_539355.3|Plus12416796..2417758 NW_876258 olfactory receptor 2T4-like LOC482236 __SEG__ Chr14 {Canis lupus familiaris} MKNMNWMANYTGESDFILVGIFSQSNHPALLCVVIFVVFLMALTGNAVLILLIHFDAHLHTPMYFFISQLSLMDVMYISITVPKMLIDQIMGISNISAPECGMQMFLYVT
LAGSECFLLATMAYDRYMAICHPLHYPVLMNHRLCLLLASGCWFLGSVDGFMLTPITMTFPFCRSREIHHFFCEVPAVMKLSCSDTSLYETVMYLCCVLMLLIPVTVISS
SYYFILLTIHRMNLAEGQKKAFATCSSHMTVVILFYGAAVYTYMLPTSYHTSEKDMIVSVFYTILTPGLNPLIYSLRNKNVMGALKKMLNVGPVFQETIK*
313 >lcl|XP_539358.3|Plus12600871..2601824 NW_876258 olfactory receptor 2T27-like LOC482239 __SEG__ Chr14 {Canis lupus familiaris} MELGNYSMYADFVLLGLFSNTRFPWLLSALILLVFVISIASNTIMIILIHMDSHLHTPMYYLLSQLSLMDILYISTIVPKMLVDQIVGQRAISFAGCTSQHFIYLTLAGA
EFFLLGLMSYDRYVAICNPLRYPVLMSRKVCLLIVVAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSCTDTSTYETAMYVCCIMMLLIPFSVISASYTR
ILITVYRMNEAEGRRKAVATCSSHMVVVSLFYGAAMYTYVLPHSYHTPEKDKAVSAFYTILTPLLNPLIYSLRNKDVSRALKKTLGKCLSSGSVSTF*
314 >lcl|XP_539359.3|Plus12613678..2614652 NW_876258 olfactory receptor 2T2 OR04B08 __SEG__ Chr14 {Canis lupus familiaris} MSMEAILQNSTDFILLGLITHPAFPGIIFAVVFSIFLVAVTANVVMILLIHVNSRLHTPMYFLLSQLSIMDTVYICITVPKMLQDLLSKEKMISFLGCSLQIFLYLTLIG
GEFFLLGLMAYDRYVAVCKPLRYPLLMNRRICLFMVVGSWVGGSLDGFMLTPFTMSFPYCGSREINHFFCEIPAVLKLSCVDTSLYETLMYACCVLMLLIPISIISISYT
HILLTVHRMNSAEGRHKAFATCSSHIMVVSIFYGAAFYTNVLPHSYHTPEKDKVVSAFYTILTPMLNPLIYSLRNKDVATALRKVLGRCPSSQRIRVVDLSRKY*
315 >lcl|XP_539362.3|Plus1complement(2713680..2714642) NW_876258 olfactory receptor 2T29-like LOC482243 __SEG__ Chr14 {Canis lupus familiaris} MENIMWVTNYTERSDFELVGLFSQSKHPTLLCVVIFVVFLMALSGNTILILLIHCDAHLHTPMYFFITQLSLMDVMYISVTVPKMLMDQVMGVNKISVPECGMQMFLYLT
LVGSEFFLLAAMAYDRYVAICHPLRYPILMNHRVCLLLVSSSWILGSVDGFMLTPVTMTFPFCRSREIHHFFCEVPAVMKLSCSDTSLYETLMYLCCVLMLLIPVTVISS
SYSFILFTIHRMNSAEGRKKAFATCSSHMMVVILFYGAAVYTYMLPTSYHTPEKDMIVSVFYTILTPVLNPLIYSLRNKDVTRALKKMLNVVSVLQEPIK*
316 >lcl|XP_539364.2|Plus12820271..2821227 NW_876258 olfactory receptor 2H1 cOR2G5 __SEG__ Chr14 {Canis lupus familiaris} MPKALGITNNSFQVGFILLGFSEWPHLEMILFWIVIILYTMIILSNSTIILLSYVDPHLYTPMYFFLSNLSFLDLCFTTTAVPQMLYNLWGPDKSITYTGCVIQLSVLLC
LGATEGVMLVVMAFDRYVAICQPLHYTIIMHHQFCWKLVLIAWMSGLMESVTQSPITFQLPLYTHHHLDDFICEVPAFIRLACGNTSAIEWQMTISADLFTIVPMGLILT
SYGYIAQALGKIQSKDGRQKAIATCSSHLTVVLMFYGTVAMVYTDPKNDFASNYGKLFTFFYTLVTPLLNPLIYTLRNKEVKDALQRLLKKWMCKWKK*
317 >lcl|XP_539411.2|Plus116995150..16997105 NW_876258 frizzled-1 FZD1 __SEG__ Chr14 {Canis lupus familiaris} MAEEEAPKKSRAAGGRASWELCAGALPAGPGAEPSGDAGSRRRRRPRADSGRLARRLLLLLWLLEAPLLPGVRGQAGGQGPGQGPGPGQQPPPPAPQQQQSGQQYNGERG
ISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEK
FPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIW
SVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWG
HEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTV
PATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV*
318 >lcl|XP_539495.3|Plus1complement(41957653..41960130) NW_876258 TLR4 interactor with leucine rich repeats-like LOC482378 __SEG__ Chr14 {Canis lupus familiaris} MGAARAVRFLLVVCGCLALPPRAQPVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQDVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLE
ELYLGNNLLQALVPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNALGALPDAAFAPLGNLLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLR
HAATFAPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLRGNQLTHLAPEAFWGLEALRELRLEGNRLSQLPVALLEPLHSLEALDLSGNALSALHPAIFGHLGRLREL
SLRDNALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCADPSPSVSPTAEGRGRPLPTTTGEAA
APPAGGLSEVLPRQPQPQPQQRGRFLPGGAWDGAAGELLGNRSALRLSRRGPGLQPPDPSAAAAAAAAAAAAAGPAPQPLDLLQKPERGPPTPAEAARAEPSPTAAPASG
PPSAGDPWQRAAKQRLGAQPRESPAPSDGAAGPPPPPPLVSDPCDFNKFILCNLTVEAVGADSASVRWAVRQHRSPPPLGGARFRLLFDRFGQQPKFHRFVYLPERSDSA
TLRELRGDTPYLVCVEGVLGGRVCPVAPRDHCAGLVTLPEPGARGSVDYQLLTLVLLAVNALLVLLALAAWASRWLRRKLRARRKAGAPVHVRHMYSTRRPLRSMGTGVS
ADFSGFQSHRPRATVCALSEADLIEFPCDRFMDSGGGGTGGSLRREDHLLQRFAD*
319 >lcl|XP_539520.1|Plus148814518..48815423 NW_876258 probable G-protein coupled receptor 141 GPR141 __SEG__ Chr14 {Canis lupus familiaris} MAGHNTSSCSPILTPHLTTLYFIVLIGGLVGIISILFLLVKMNTRSVTTTVVVNLVVVHSVFLLTVPFRLTYLIKHTWMFGLPFCKFVSAMLHIHMYLTFLFYMVILVIR
YLIFFKYKDKVEFYRKLHAVAASTGMWLLVIVIVVPVVVSQYGTYEVYDEQHCFKFHKELDRAYVQVINYMIVTTVIAIAVILLVFQIFIIMSMMRKLRHSFLSHQEFWA
QLKNLFFIGVILVCFLPYQFFRIYYLYTVANSSDCNNTVAFYNEIFLSVTAISCFDLLLFVLGGSHCKQKISDLWNCLLCR*
320 >lcl|XP_539523.1|Plus150886331..50888457 NW_876258 leucine-rich repeat neuronal protein 3 LRRN3 __SEG__ Chr14 {Canis lupus familiaris} MKDMPLRIHVLLGLAITTLVQAVDKKADCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGLLNFPARLPADTQILLLQTNNIAKIEYSIDFPVNLTGLDLSQNNLSSVTNI
NVKKMPQLLSVYLEENKLTELPEKCLSGLSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIA
GINLTEIPDNALVGLENLESISFYDNRLIRVPHVALQKAINLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLAVDNLPDLRKIEATNNPRLSYIHPNAF
FRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFREMMEICLPLIAPESFPSNMDLEAGSYV
SLHCRATAEPQPEIYWITPSGQKLLPNTLKDKFYVHSEGTLDINDITPSEGGLYTCIATNLVGADLKSVMIKVDGSFPQDNNESLNIKIKDVQANSVLVSWKASSKILKS
SVKWTAFVKTENSHAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQKTRKECVNVTTKGLDPDQREYEKSNTTTFMACLGGLLGIIGVICLYSCLSQQMNCDGGHS
YMRNYLQKPTFTFSELYPPLINLWETGKEKSTALEVKATVIGVPTNMS*
321 >lcl|XP_539527.2|Plus1complement(52529966..52531078) NW_876258 probable G-protein coupled receptor 85 GPR85 __SEG__ Chr14 {Canis lupus familiaris} MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAF
MLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQF
VAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFA
QAGINPFVCIFSNRELRRCFSTTLLYCRKSRLPREPYCVI*
322 >lcl|XP_539550.1|Plus1complement(257219..258166) NW_876259 olfactory receptor 2A12 OR18D12 __SEG__ Chr15 {Canis lupus familiaris} MQSLGKENHSSVFEFILLGFSSDSQVRISLFSFFLLLYLITILGNGLIVTLIYLDSHLHMPMYYFLSVLSLVDMSYVTTTMPQMLINMVCPKKTISWGACVAQMFIFLVL
GIAECVLYAIMAYDRYVAICFPLHYPLLMSRPICIKMVTGCWTISIAGALIYTVFTMHLPYCGPHKINHFFCEVPAVLKLACADTSFNDRLDFILGFILLLVPFSLILAS
YVRIFASILRIHSSQGRLKSFSTCASHITVVIMFYGPAMIMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSLRNKDVKGAFMNVLGNRRTSQ*
323 >lcl|XP_539551.3|Plus1277576..278514 NW_876259 putative olfactory receptor 2B3 cOR13P3 __SEG__ Chr15 {Canis lupus familiaris} MEEFNQSSVTEFILLGFSFNPRTTPLLFTVFLMTYLLIILGNSLITILICLDSHLHTPMYFFIGILSILDLGYTTTTVPQMLAHLASQKKTISFASCVAQMYIFLVLGIT
ESWLFAMMSIDRYVAICHPLRYKVIMSPWLCGVMVIFCGLMGIISALIYTVFAMCLPYCGPNKINHFFCEVPAVLKLACADTSVNDWVDFILGFSVILVPLSLILVIYVN
IFVAILRIRSAQGRLKAFSTCASHIIVVTTFCVPAMVMYMKPGSEASLEEDKRLALFYNVVSAFLNPIIYSLRNKDVKRAFLKVAGWSRAPE*
324 >lcl|XP_539552.1|Plus1299340..300287 NW_876259 putative olfactory receptor 2B3-like LOC482435 __SEG__ Chr15 {Canis lupus familiaris} MQNFPWDNHSSVSEFILLGFSRDSQINAILFNIFLFLYLSTLVGNGLIITLIYLDSRLHTPMYFFLSVLSMLDMSYVTTTVPQMLVHLICQKKTISYVGCVAQMYIFLVL
GITEGWLFSVMAYDRYVAICYPLRYKVIMTPWLCGAMVVFCGLWGISCSLVYTVFTMRLPYCGPNEINHFFCEVPAVLKLACADTSLNDQVDFILGFILLLVPLSFILAS
YVCIFATILKIRSAQGRLKTFSTCASHITVVTMFCGPAMFMYMNPGANASPERDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKLTGWGRASE*
325 >lcl|XP_539653.2|Plus1complement(17229482..17230405) NW_876259 olfactory receptor 4N2 OR4N2 __SEG__ Chr15 {Canis lupus familiaris} MENNNSTVVKEFILLSLTQSRNIQLLVFVLVLIFYFIILPGNFLIILTIRTDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EGLLLVVMAFDRYIAICRPLHYSTVMNPRACYALLLALWLGGFVHSIIQVALILRLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAV
ILCRVHGSSSEGKNKAVSTCTTHIIVIFLMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKRLFNQNRA*
326 >lcl|XP_539654.1|Plus1complement(17252272..17253198) NW_876259 olfactory receptor 4N2-like LOC482537 __SEG__ Chr15 {Canis lupus familiaris} MEAENSTVVKEFILLGLTQSRNIQLLVFVLVLIFYFIILPGNFLIILTIRTDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EGLLLVVMAFDRYIAICRPLHYSTVMNPRACYALLLALWLGGFVHSIIQVALILRLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLSSYAV
ILCHVHGSACEGKSKAVSTCTTHVMIILLMFGPAIFIYTRPFRALSADKVVSFFHTVIFPLLNPVIYTLRNQEVKTSMRRLLSRHVVC*
327 >lcl|XP_539655.3|Plus117292303..17293250 NW_876259 olfactory receptor 4Q3 OR16D10 __SEG__ Chr15 {Canis lupus familiaris} MKKSNDSKVTEFVLLGLSSSWELQLFLFFIFLLFYMTVILGNLLIMVTVRADAHLLQSPMYYFLGHLSFIDLCLGCVTVPKMLRDFLQQGKIISFSGCLTQIYFLHFLGA
NETFLLTVMAYDRYVAICNPLHYLTVMNRQLCFQLVFTCWFGGFIHSISQVTLVIQLPFCGPNELDNFYCDVPQVIKLACMDTYVVEVLMVSNSGLLSLICFFVLLFSYA
IILTTLRTRFHQGRSKALSTCASHLTVVSLIFVPCVFIYLRPFCSFSVDKIFSVFYTVITPMLNPLIYTLRNADMKRAMKKLRKKYAAFFFHSKG*
328 >lcl|XP_539661.1|Plus117482807..17483775 NW_876259 olfactory receptor 11G2 cOR11J3 __SEG__ Chr15 {Canis lupus familiaris} MSISGANNISGSVSEFILLGFPCRRELQVLLFVIFSIIYLLTLMGNTSIICAVASSRKLHTPMYILLANFSLLEICYVSSDVPKMLANIISQTKSISYAGCLLQFYFFFS
MCAAEGYFLSAMSYDRFLAICRPLHYPTIMTHHLCARLVVFCWVGGFLSILIPAILMSQVPFCGPNIIDHFFCDLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILG
SYTLVLRAVLRVPAGSGRNKAFSTCASHFLVVSLFYGSVMVMYVSPGSRSHPGTQKFVTLFYCMATPFFNPLIYSLRNKDMKDALKKVLGASSKEISKNTEK*
329 >lcl|XP_539667.2|Plus117597378..17598370 NW_876259 olfactory receptor 11H6-like LOC482550 __SEG__ Chr15 {Canis lupus familiaris} MLIIIHSLVISASLTALESQNTTMRFVSEFVLLGFPGQREMQNFFFSFILVIYLLTLLGNGIIVCIVKWDKQLHTPMYIFLGNFAFLEIWYTSSTVPSMLVNILSETKTI
SFTGCFLQFYFFFSLGTTECFFLSVMAYDRYLAICRPLHYPSIMTGKLCVALVCVCWVSGFLCYPVPIVLISQLPFCGPNIIDHFVCDPGPLFALACIPAPSTELLCYTF
NSLIIFGPFLFILGSYTLVLRAVLRIPSGAGRTKAFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPTGMQKIITLVYSAVTPLLNPLIYSLRNKDMKDALKKVLGLRSNQN
*
330 >lcl|XP_539678.1|Plus1complement(17941164..17942159) NW_876259 olfactory receptor 6S1-like isoform 1 LOC482561 __SEG__ Chr15 {Canis lupus familiaris} MAPGENQSSGVTEFILAGFPNLNNTKAEVFSVFLLVYLLTLTGNVLIVGVVGADARLQTPMYFFLGNLSCLEILLTSVIIPKMLSNFLSRQHTISFAACITQFYFYFFLG
ASEFLLLAVMSVDRYLAICHPLHYPLLMNGAVCSRVALACWMGGLVPVLGPTVAVALLPFCEQHTVVQHFFCDSGPLLRLACTNTKKLEETDFVLASLVIISSLMITAVS
YGHIALAVLRIPSVSGRQKAFSTCTSHLMVVTLFYGSAIFLYVRPSQSGSVNTNWAVTVVTTFVTPLLNPFIYALRNERVKEALKDMFRKMGVGFWGNLLLTKNFSKKTV
K*
331 >lcl|XP_539687.3|Plus1complement(18652737..18653684) NW_876259 olfactory receptor 4E1-like LOC482570 __SEG__ Chr15 {Canis lupus familiaris} MEAGDLLNQTTLVTHIRLRGLSVDQRVQMAVFAMFLTFYVLTLAGNILIVITIIYDRRLHTPMYFFLSNLSFIDVCHSTVTVPKMLVDTWAEEKLISFDGCVTQMFFLHL
FACTEIFLLTVMAYDRYVAICKPLQYLTVMSWRVCVLLAVALWVGGTIHSISLTSLTITLPYCGPDEIDSFFCDVPQVIKLACTDTHIIEILIVSNSGLISVVCFVVLVV
SYAVILVSLRQQISEGRRKALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKVVSVFFTAVTPLLNPIIYTLRNEDMKNALNKLMGRLEGKGKK*
332 >lcl|XP_539778.3|Plus152815855..52817000 NW_876259 LOW QUALITY PROTEIN: neuropeptide Y receptor type 2 NPY2R __SEG__ Chr15 {Canis lupus familiaris} MGPVGAKADENQTVEEMKVEKYHPRQTTPRGELAPDPEPELIDSTMLIEVRIILILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLT
YTLMGEWKMGLVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVVCTEKWPGRRRTSMAPST
VFLPC*SCMFFLWASYLFPTLVSGVNLRTT*ALELPVITTISEGRKPPKCWCVWWWCLRSAGCLSMPSSLLSTLTTKS*T*RNTNSSSPCSTLSPCAPPLPTPSSMAG*T
ATIERPSSQPSAVSRGWMPFTPRCL*HSSLKRTWKSKRTMAPMTLSQKLPTS
333 >lcl|XP_539835.3|Plus1complement(5692286..5693227) NW_876260 olfactory receptor 2A1/2A42 OR08A11 __SEG__ Chr16 {Canis lupus familiaris} MEKNQTMVTEFILLGFCLGPRIQMVLFGLFTLFYAFTLLGNGLILGLISLDPRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLRPDKPISFAGCLTQTFLFLTFALIE
CLLLVVMSYDRYVAICHPLRYSVIMNWRVCITLMVASWACGSLLALVHVSLILRLPFCGPHEINHFFCEILSILKLACADTRLNQVVIFVACMFILVVPLCLVLVSYSRI
LLAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSHHPEEQQKILFLFYSLFNPMLNPLIYSLRNTEVKSALRRAMCKKSHSQLE*
334 >lcl|XP_539840.1|Plus1complement(5806345..5807277) NW_876260 olfactory receptor 2A25-like LOC482724 __SEG__ Chr16 {Canis lupus familiaris} MAGNQTSVTEFILLGFPLSPEIQMVLFGLFTLFYAFTLLGNGLILGLISLDPRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLRPDKPISFAGCLTQTFLFLTFAHTE
CLLLVVMSYDRYVAISHPLHYSVIMSWRVCITLALTAWILGVLLALVHLGLLIPLPFCGPQKVNHFFCEIIAVLKLACADTHVNEIMVLTGAVSVLVGPFTSIVISYIHI
LRAILKIQSGEGRQKAFSTCSSHLCVVGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVKAALKRILEKERTS*
335 >lcl|XP_539841.3|Plus1complement(5864917..5865843) NW_876260 olfactory receptor 6B1-like LOC482725 __SEG__ Chr16 {Canis lupus familiaris} MEVENQTQVTKFILVGFPGNWGMRVAVFLMFLMAYIVTVAENVVIILLVQQNRPLHKPMYFFLANLSFLETWYISVTVPKLLFSFWSVNNSISFTHCMIQLYFFIALMCT
ECVLLAAMAFDRYVAICRPLHYPTIMSHGLCFRLALGSWAIGFGISLAKIYFISRLSFCGPNVINHFFCDISPVLNLSCTDMSVAELVDFVLALVIFLFPLSITVLSYGC
ILATVLRMPTGKQKAFSTCASHLVVVTIFYSATIFMYARPRAIHAFNMNKVISIFYAIVTPALNPFIYCLRNREVKEALKKLAYCQAI*
336 >lcl|XP_539842.3|Plus1complement(5922942..5923895) NW_876260 cOR13M3 olfactory receptor family 13 subfamily M-like cOR13M3 __SEG__ Chr16 {Canis lupus familiaris} MGTNNQTWMREFILLGLSSDWDTQVSLFVLLLVMYLVTVLGNFLIVLLIRLDSRLHTPMYFFLTNLSFVDVSYATSIVPQMLAHLLAAHKAMPFVSCAAQLFFSLGLGGI
EFVLLAVMAYDRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLIHTAITFQLPMCTNKYIDHISCEILAVVRLACVDTSSNEIAITVSSIVLLMTPFCLVLLSYIQ
IISTILKIQSTEGRKKAFHTCASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYAVLTPMLNPMIYSVRNKEVKGAWQKLLGQLSGITSKLAT*
337 >lcl|XP_539844.3|Plus1complement(5972739..5973692) NW_876260 cOR13M1 olfactory receptor family 13 subfamily M-like cOR13M1 __SEG__ Chr16 {Canis lupus familiaris} MDTENQTWVREFILLGLSSDWDTQVSLFVLFLIMYMVTVLGNFLIILLIRLDSRLHTPMYFFLTNLSFVDVSYATSIVPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGI
EFVLLAVMAYDRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCEILAVIRLACVDISSNEIAIMVSSIVLLMTPFFLVLLSYIQ
IISTILKIQSTEGRKKAFHTCASHLTVVVLCYGMTIFTYIQPRSSPSVLQEKLISLFYAILMPVLNPMIYSVRNKEVKGAWQKLLGQLSGITSKLAT*
338 >lcl|XP_539849.3|Plus16194189..6195130 NW_876260 olfactory receptor 2F1-like LOC482733 __SEG__ Chr16 {Canis lupus familiaris} MRRDNLTWESEFVLLGLSSDRQTQVGFFVLFGAAYLLTLLGNGLIILLIGLDARLHLPMYFFLCNLSVVDICYTSSGVPQMLVHFLLEKKTISFIRCGAQLFFSLALGGT
EFLLLAAMAYDRYVAVCDPLRYVAVMSPRCCVGLAAVSWLIGLVNSVVETVVTMRLPTCGHHVLNHVACETLALVRLACVDITLNQVFIVASSVVVLLLPCCLVSLSYAY
IVAAILRIHSTGGRRKAFGTCASHLTVVSMSYGMALVTYMQPHSTASAQQDKVVVLFYAVVTPMLNPLIYSLRNQEMKAALSRVLMRSSESKL*
339 >lcl|XP_539856.3|Plus16537645..6538592 NW_876260 olfactory receptor 6V1 OR6T1 __SEG__ Chr16 {Canis lupus familiaris} MSNFSIVREFVLLGFSHLHEFQILLFAFILLIYVLTVLGNLAIITLTCLDTRLHSPMYFFLCNFSLMEMLVTSTVVPRMLADLLSTHKTISLAKCLTQSFFYFSLGSTNF
LILTVMAFDRYVAICRPLHYPTIMNGPVCVKLVAVCWVVGFVSIISPTLQKTQLWFCGPNIIDHYFCDSAPLLKLSCSDTHHIERMDFFLSFLFVLATMMLIIVSYFLIV
AAVLRIPSFSGRQKAFSTCASHLTVVVLGYGSTIFIYVRPGKGHSTHLNKVVALMTAVVTPFLNPFIFTFRNEKFKEVIEDMTKRLRFRDAAAHR*
340 >lcl|XP_539857.3|Plus1complement(6546401..6547342) NW_876260 olfactory receptor 6V1 OR6V1 __SEG__ Chr16 {Canis lupus familiaris} MANLSHPSEFVLLGFSSFGKLQVLLYGPLLMLYLLAFVGNTVIIVMVIANTHLHTPMYFFLGNFSLLEILVTMTAVPKMLSDLLTSHKVISFNGCMVQFYFYFSLGSTSF
LILSDMALDRFMAICHPLRYGTLMSWAVCVRLAGVAWAAPFLAMVPTVLSRAYLNYCHNNIINHFFCDNAPLLQLSCSDTRLLEFWDFVMALAFVLSSFLVTLISYGYIV
TTVLRIPSASGRHKAFSTCGSHLTLVFIGYSSTIFLYVRLGKTHSVEVNKTVALVTSVLTPFLNPFILTFRNETVKAVLQGQMQRLKGLHKGL*
341 >lcl|XP_539875.1|Plus1complement(7258283..7259227) NW_876260 olfactory receptor 9A4 cOR9A7 __SEG__ Chr16 {Canis lupus familiaris} MLKNYSSAVEFYLLGFHGSKEQHNILFATFFFLYSVTVMRNMLIIVIVCVDKRLQSPMYFFLGHLSVLEILITSVAVPLMLWGLLLPEMQAISLPACSAQLYLYLSLGTS
ELVLIGAMAVDRYVAVCNPLRYNIVMNSHTCIWVVIVSWVFGFLFQIWPVYATFQLTFCKSNVLDHFLCDRGQLLKLSCDDSLFTEFILFLMAVFIIVGSLIPTIISYTY
IISTILKIPSASGRRKAFSTCASHFTFVVIGYGTCLFLYVKPKQTQAAEYNRVASLMVLVVTPFLNPFIFTLRNDKFIEAFRDVMKRCYHLHKG*
342 >lcl|XP_539996.2|Plus114103087..14103944 NW_876261 protein phosphatase 1 regulatory subunit 3B PPP1R3B __SEG__ Chr16 {Canis lupus familiaris} MMAVDIEYRYSCMAPSLRRERFTFKTSPKPSEPLRPCIQLSSKNEASGVVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDEPLDIPFNITELLDNLVSLTSPESESF
VLDFTQPSADYLDFRNRLQADHVCLENCVLKDRAIAGTVKVQNLAFEKMVKIRMTFDTWKSFTDFPCRYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCFECSGQT
YWDSNKGKNYRITRAELKSAQGTAEPQNGPDFGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
343 >lcl|XP_540204.1|Plus143900770..43902338 NW_876263 leucine-rich repeat transmembrane neuronal protein 1 isoform 1 LRRTM1 __SEG__ Chr17 {Canis lupus familiaris} MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQ
KLRRVKELTLSSNQITQLANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRSNAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHND
LVKVNFAHFPRLISLHSLCLKRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLS
SFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAVTNHSDLGLPASLATTLADGREGQLDGTHEPATVALPGGEHAENAVQIHKVVTGTMALIFSFL
IVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV*
344 >lcl|XP_540322.3|Plus1complement(9300192..9302099) NW_876264 leucine rich repeat and Ig domain containing 4 LINGO4 __SEG__ Chr17 {Canis lupus familiaris} MLRQIAQSLVPLRRSREVQGHQPLKSLSKKDHVIICSRIEEGIAMATAPKRAPAPWLPLLFLFLLPGGSCGGCPAVCDCTSQPRAVLCAHRRLETVPGGLPLDTELLDLS
GNHLWGLQQGMLSRLGLLKELDLSYNQLSILEPGAFHGLQSLLTLRLQGNRLRIMGPGVFSGLSALKLLDLRLNQIVLFLDRAFGELGSLQQLEVGDNHLVFVAPGAFAG
LAKLSALTLERCNLSTVPGLALARLPALLTLRLRELDIGRLPAGALRGLGQLKELEIHHWPCLEALEPGSLLGLNLSSLAITRCNLSAVPFQALHHLSFLRVLDLSQNPI
SAIPARRLSALVRLQELRLSGACLTSIAAHAFHGLTAFHLLDVADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGTSPPACAGPRHVQGKSLQD
FSDILPPGHFTCQPALIRKSGPRWVIAEEGGHAVFSCSGDGDPAPTVSWMRPQGAWLGRAGRVRVLEDGTLEIRSVQLQDRGAYVCMVSNVAGNDSLRTWLEVIQVDPPN
GTLSGSNITMPGIPGPFFLDSRGVAMVLAVGFLPFLTSVTLCFGLIALWSKGKGRVKHHMTFDFVAPRPSGDKNSGGNRVTAKLF*
345 >lcl|XP_540535.1|Plus13539838..3541757 NW_876266 leucine-rich repeat-containing protein 4C LRRC4C __SEG__ Chr18 {Canis lupus familiaris} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
346 >lcl|XP_540538.1|Plus1complement(6330115..6333246) NW_876266 V(D)J recombination-activating protein 1 RAG1 __SEG__ Chr18 {Canis lupus familiaris} MAVSLPPTLGLTSAPDEIQHPHIKFSEWKFKLFRVRSLEKAPEEAQIEKKVSSEGKPSLEQSPAVPDKADGQEAALSPPALKAHPKFLKEPHDDGKTRDKAIHQANLRHL
CRICGNSLKTDRRNRRYPVHGPVDGKTQVLLRKKERRATSWPDLIAKVFRIDVKADVDSVHPTNFCHKCWKVMYRRFSSAPRGVCFPRKAAPEWLPHAPSCDLCRAARQG
LKRKSPQPSAQLSKRLRTVLERAGRARGHRRRARAGLRDSGATGKASDCGNVHLGTELLAVDFPAHFVKSISCRICEHILADPVETTCKHVFCRVCILRRLKATGSYCPC
CRYPCFPTDLESPGRSFLSILNSLMVRCPAKGCDEEVSLERYNQHVAGHKDSDQTFVHINKGGRPRQPLLSLTRRAQKHRLRELKLQVKAFADREEGGDVKSVCLALFLL
VLRARNEHRQADELEAVLQGRGPGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHALRAAEKALLPGHHAFEWQPPLQNVSSSAHVGIIDGLSGLSSCVDD
YPVGTIAKRFRYDAALVSALMDMQEDLLEGVRARGLDDHLGGPFTVVVKESCDGMGDVSEKHGGGPAVPEKAVRFSFTVMRITVAQGSESVQVFEEGKPNSELCCKPLCL
MLADEADHETLTAILSPLVAEREAMKSSCLLLEMGGALRTFRFIFRGTGYDEKLVREVEGLEASGSVYICTLCDATRLEASQNLVLHSITRSHSENLERYEVWRSNPYHE
SVDELRDRVKGVSSKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGQAYSKAGASKEERRRWQATLDKHLRKKMNLKPIMRMNGNFARKLMTKETVEAVCELIPSEERHE
ALRELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDV
LKHHWLYTSKYLQRFMNAHNGYKKSGPPFNSQAGLGDPLGLEDSLETQDSMEF*
347 >lcl|XP_540562.1|Plus1complement(11774918..11775856) NW_876266 olfactory receptor 10V1-like LOC483444 __SEG__ Chr18 {Canis lupus familiaris} MEGANQTGMVRFHFRPFSKLPEVQMLIFVAFLIMYLVSISGNVSISLIIWLNRSLHTPMYFFLANLAALEICYSSTIAPLTLASVLSTERALISLPGCGTQMFFFIFLGS
ADCILLAVMAYDRFVAICHPLRYTLMMSWRLCVQLAMGSLVLGFILAMQLTVLIFQLPFCSSKEISLFYCDVLPVMRLACADTWVHEATLFVVSITVLTIPFLLITLSYV
FIVAAILKIRSAEGRHKAFSTCSSHLTVVLLQYGCGSLIYLCPSSSYSPERGQVVSVVYTFITPVLNPLIYSMRNRELKDALRRTMIRFLLS*
348 >lcl|XP_540564.3|Plus111809421..11810350 NW_876266 olfactory receptor 10V1 OR10V1 __SEG__ Chr18 {Canis lupus familiaris} MEEMNKTAKIQFFFHPFSADPKIQVGIFVAFLVMYLTSLGGNTTIAVLVQINPSLHIPMYFFLANLAVLEIFYTSAIAPLALANLLSMGKTPVSIPGCGAQMFFFIFLGG
ADCVLLAVMAYDRFVAICYPLRYTRIMSWPLCVELMVGSLVLGFLLSLPLTILIFHLPFCGHNEIHHFYCDMPAVMRLACADTHTHQTALYIISFIVLSVPLSLISTSYI
FIMAAILRIRSAEGRHRAFSTCSSHILVVLLQYGCTSFIYLSPRSSYSPEMGRVVSVVYTFITPILNPLIYSMRNRELKDALRRALRKF*
349 >lcl|XP_540565.3|Plus111837320..11838258 NW_876266 olfactory receptor 10V1-like LOC483447 __SEG__ Chr18 {Canis lupus familiaris} MGDENQTIDIQFHFHPFSPILEIQILIFVAFLLMYIGSLTGNATIFLTVWAERSLHTPMYFFLANLAVLEIFYSSTVAPLALVNLLTMGRIPISFAGCGTQMFFFVFLGS
ADCILLGIMAYDRFVAIRKPLRYTLIMRWQLCAQLALGALVLGFILALQLTALIFHLPFCGHNRITHFYCDVLPILQLACGDTRMQEAMIFIVSVIILTIPFSLISISYV
FIVGAILKIRSAEGRHKAFSTCSSHLTVVLLQYGCCSLIYLRPSSSYNPEMGRVVSVVYTFVTPVLNPLIYSMRNKELKDALNKVMKRHLLH*
350 >lcl|XP_540567.3|Plus1complement(11964283..11965218) NW_876266 olfactory receptor 4D9 OR4D9 __SEG__ Chr18 {Canis lupus familiaris} MDQGNYTKVKEFLFLGITQSRELSLVLFVFLFTVYMTTLLGNLLIMVTVTFESHLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSKRKTISFNGCVTQMFFFHLLGGA
DVFSLSVMAFDRYVAISRPLHYMTIMSKERCTSLVLASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTDTISLEILMISNNGLVSWLIFFFLLISYTV
ILMMLRSHAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPMIYTLRNQEMKSAMRRLKKRLGHSERI*
351 >lcl|XP_540568.1|Plus1complement(11974765..11975700) NW_876266 olfactory receptor 4D11-like LOC483450 __SEG__ Chr18 {Canis lupus familiaris} MELGNSTRIKEFIFLGLTQSHDLSLILFLSLCLVYVITLLGNLLIMVTVTCESRLHTPMYFLLRNLAVLDICFSSITAPKVLIDLLSKIKTISYTSCMTQMFFFHLLGGA
DIFSLSVMAFDRYMAISKPLHYVTIMSRGRCTALIVASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTDTFALELLMISNNGLVTTLWFIFLLVSYTV
ILTILRSQAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPMIYTLRNQEMKSAMRRLSRRLTPFVME*
352 >lcl|XP_540571.1|Plus1complement(12014216..12015151) NW_876266 olfactory receptor 4D6-like LOC483453 __SEG__ Chr18 {Canis lupus familiaris} MGQSNHTNVKEFVFLKLTHFHELELFLFVVFLAVYVATVLGNVLIVVTITCESHLHSPMYFLLRNKSVLDIVFSSVTVPKFLVDLLSERKTISYNGCMAQIFFFHFAGGA
DIFFLSVMAYDRYLAIAKPLHYVTIMRRETWVGLVVASWVGGGLHSIVQVTLMLPLPFCGPNILDAFYCDVPQVIKLACTNTFALELLMISNNGLVTLLWFLLLLGSYTV
ILVMLRSHSGEGRNKALSTCTSHIFVVTLHFVPCVYIYCRPFITLPMDTVVSINNTVITPMLNPMIYTLRNQEMKSAMKRLQRRLGPSESS*
353 >lcl|XP_540572.3|Plus1complement(12029751..12030710) NW_876266 olfactory receptor 5A1-like LOC483454 __SEG__ Chr18 {Canis lupus familiaris} MSTVKAWNSSSVTMFILLGFADHPELQTLLFVTFLSIYLVTLAWNLALIFLIRSDPHLHTPMYFFLSNLSFIDICYSSTVAPKMLTDFFQEQKTISFLGCAAQFFFFVSM
GLTECFLLTAMAYDRYAAISNPLLYTAIMSQGLCTRMVLGAYVGGFLSSLIQAISIFQLHFCGPNIINHFFCDLPPVLALSCSDTFPSQVVNFLIVITVGGTSFLILLIS
YSYIGAAVLKIRSVEGRRKAFNTCASHLMVVTLLFGTALFMYLRPSSSYSLARDKVVSVFYSLVIPMLNPLIYSLRNRDIKDALWKALEKKKVFFLDHD*
354 >lcl|XP_540573.3|Plus112052932..12053891 NW_876266 olfactory receptor 5A2-like LOC483455 __SEG__ Chr18 {Canis lupus familiaris} MVAGKNNTIVTKFILLGFSDHPQMKLFLFMLFLGIYLLTLAWNLSLIVLIRMDCHLHTPMYFFLSNLSFLDICYVSSTTPKMLSDIITGQKTISFVGCATQYFVFCGMGL
TECFLLAAMAYDRYAAICNPLLYTALISHTLCLKMVVGAYAGGFLSSLIETYSVYKHDFCGPNMIDHFFCDLPPVLVLSCSDTFTSQVVNFIVGVVVGMVSVLVILISYG
YIVAAVLKTSSAKGRTKAFSTCASHLTSVTLFYGSGLFMYMRPSSSYSLNRDKVVSIFYALVIPMVNPIIYSFRNKEIKNAMKKAMQKDHVLSHGPLFF*
355 >lcl|XP_540575.3|Plus112097105..12098043 NW_876266 olfactory receptor 5AN1 OR04E07 __SEG__ Chr18 {Canis lupus familiaris} MTGGGNTTEITYFILLGFSDFPRILAVLFAVFLLIYILTLTWNLGLIILIRMDSHLHTPMYFFLSNLSFIDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGL
SESCLMTAMAYDRYTAICNPLLYSSVMSPTLCIQMVLGSYLAALSASISQLCAMFQLHFCGLNVINHFFCDMPQLLVLSCTDTLFVNLLTAILTMIFGIINAFIIMISYG
FIVMSIMKITSAKGRSKAFNTCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLPKKTWYC*
356 >lcl|XP_540578.2|Plus112253043..12254005 NW_876266 olfactory receptor 5A1 cOR5A3 __SEG__ Chr18 {Canis lupus familiaris} MAVRRNISMTANFILVGFSEHPELQVVLFVLFLGIYSMTLAWNLGLIVLIRMESCLHSPMYFFLGNLSFVDISYTSSIAPKMLCDFFKQQKTISFVGCAAQFFFFIGMGG
TECCLLAAMAYDRYAAISNPLLYTALMSPTICVRMVITAYTGGFLTGLVQTSSVFQLHFCGPRVIDHFFCDLPPLLVLSCSSTFLSQVVNFLVVCAVGGTSALVVLVSYG
YIIAAVMKIHSTQGRMKAFNTCASHLTMVILFYGSGLFSYLHSSASYSQDQDKVVSMFYGAVIPMLNPIIYSLRNKDIKDALKKLKDRKKQISSLCLIVP*
357 >lcl|XP_540584.3|Plus112608960..12609910 NW_876266 olfactory receptor 5B21-like LOC483466 __SEG__ Chr18 {Canis lupus familiaris} MENSTEATEFILLGLTDDPNLQVPLLLVFLFIYLITLVGNGGMMVIIHLDPHFHTPMYFFLSNLSFVDLGYSSAVAPKAVAALQSGNKVISYSGCAAQFFFFVGFATAEC
YLLACMAYDRHAAICRPLHYTTTMRAGVCALLTVGSYVCGFLNASIHTGNTFRLSFCASHEINHFFCDLPPLLALSCSNTRINNLVVFCVVGFNVFFTLLVILISYLFIY
IAIQRIRSVEGRKKAFSTCASHLTAVTIFYGTIIFMYFQPSSSQSMDTDKIDSVFYSVVIPMLNPLIYSLRNKDVKNALRKVLNKLHPQSVSVGGK*
358 >lcl|XP_540587.3|Plus112667019..12667957 NW_876266 olfactory receptor 5B12 OR26A01 __SEG__ Chr18 {Canis lupus familiaris} MENSTEVNEFMLLGLTDNPELQVPLFITFTLIYFTTLIGNLGIIMLILLDSRLHTPMYIFLSNLSLVDCVYSSAVTPKVMAGLLTGDKVISYGGCVAQMFFFVAFASVDC
FLLAVMAYDRHAAVCKPLHYATTMTTSLCAQMAVGCYVWGFIESSIHTGFTFCLSFCHSNVVHHFFCDIPPIIALSCSDIYLNEIVLFILAAFNVCFALIVILTSYLFIF
IAILRMRSAEGRKKAFSTCASHLTAVTIFYGTVMFMYLQPSSSHSMDNDQMASVFYTIIVPMLNPIVYSLRNKEVNNAFRKVTKKLKILFGP*
359 >lcl|XP_540590.3|Plus1complement(12710067..12711011) NW_876266 olfactory receptor 5B2-like LOC483472 __SEG__ Chr18 {Canis lupus familiaris} MGNNTEVTEFILLGLTNAPELQIPLFIMFTLIYLITLAGNLGMVVLILLDSRLHTPMYFFLSNLSLVDFGYSTAVTPKVMAGLLIRDQVISYNACAAQMFFFVALATVEN
FLLASMAYDRYTAVCKPLHYTTTMTTSVCAHLAIGSYLCGFLNASIHIHDTFSLSFCMSNLVHHFFCDVPVVMALSCSDRYVSELVLVVVASFNIFFALLIILISYLFIF
ITILKMHTADGYQKALSTCASHLTAVSIFYGTVIFMYLQPNSSHSMDTDKIVSVFYSMVIPMLNPLVYSLRNKEVKNAFKKVVEKAKLSAGFTS*
360 >lcl|XP_540594.1|Plus112799970..12800914 NW_876266 olfactory receptor 5B2 OR08G08 __SEG__ Chr18 {Canis lupus familiaris} MKNNTKVTEFILLGLTNAPELQIPLFIMFTLIYLITLAGNLGMMMLILLDSHLHTPMYFFLSNLSLVDFGYSTAVTPKVMAGLLRGDQVISYNACAAQMFFFVAFATVEN
YLLTSMAYDRYVAVCKPLHYATTMTTGVCAWLSIGCYFCGFLNTSIHTWNIFRLSFCNSNVIHHFFCDVPAVMTLSCSNRHVSELVLVFVAVFNIFFALLIILISYLFIF
ITILKMPSVEGYLKAISTCVSHLTAVSIFYGSFIFMYIQPTSSYSMDTDKIASVFYSMIIPMLNPLVYSLRNKDVKNAFNKVVEKVKLPLSFTS*
361 >lcl|XP_540596.3|Plus112827411..12828364 NW_876266 olfactory receptor 5B12 cOR5BC3 __SEG__ Chr18 {Canis lupus familiaris} MTLMENVSEVTEFILVGLTDALEMQVPLFTVFTIIYFIILVGNAGMIVLILLDSRLHTPMYFFLSNLSFVDCVYASAVTPKVMVGFLTKDKIISYNACAAQMFFFSAFAT
IESFLLASMAFDRHTAVCKPLHYATIMTSAMYTSLATGSYISGLLQSSIHVALTFHLSFCRSNIINHFFCDIPALLALSCSDIYMNEIVLFILAAFNVLFTLLVILNSYL
FIFIAILGMHSAEGQKKAFSTCASHLTTVSIFYGTIIFMYLQPTSSHSMDTDKMASIFYTMVIPMLNPLIYSLRNKEVKSAFQKVVGKAKSSVGLAY*
362 >lcl|XP_540597.3|Plus112840823..12841782 NW_876266 olfactory receptor 10Q1-like LOC483479 __SEG__ Chr18 {Canis lupus familiaris} MFARSPVLNQSGPTEFFFRVLTTVPEFQALLFLLFLLLYLMILCGNTAIIWVVCTHSSLRTPMYFFLCNLAFVEISYTTVVVPLMLSNIWGAPKPIPLAGCGAQMFFFLT
LGGADCFLLAIMAYDRYVAICHPLHYTLIMTQKLCAQMVACAVGLALVLSLQLTSLIFTLPFCGHRQEINHFLCDVPPVLRLACADIRVHQAVLYVVGILVLTVPFLLIC
VSYVFIASAILRIRSAEGRRRAFSTCSSHLTVVLLQYGFCAVVYLRPQSTSSVDEDRQFALVYTFVTPLLNPLIYTLRNKDVKGALKKAISSKAASEAL*
363 >lcl|XP_540598.1|Plus112869169..12870128 NW_876266 olfactory receptor 10Q1-like LOC483480 __SEG__ Chr18 {Canis lupus familiaris} MFARSPVLNQSGPPEFFFRVLTTVPEFQALLFLLFLLLYLMILCGNTAIIWVVCTHSSLRTPMYFFLCNLAFLEICYTTVVVPLMLSNIWGAPKPIPLAGCGAQMFFFVT
LGSTDCFLLAIMAYDRYVAICHPLHYTLIMTQKLCAQMVACAVGLALVLSLQLTSLIFTLPFCGHRREINHFLCDVPPVLRLACADIRVHQAVLYVVGILVLTVPFLLIC
VSYVFIASAILRIRSAEGRRRAFSTCSSHLTVVLLQYGCCSLVYLRPRSSSSVDEDRQIALVYTFVTPLLNPLIYTLRNKDVKGALRNAVLHKAASGAS*
364 >lcl|XP_540600.3|Plus1complement(12893459..12894403) NW_876266 olfactory receptor 9Q2 OR10H08 __SEG__ Chr18 {Canis lupus familiaris} MARRNHTIVTEFFLTAFSEHPEWGLPLFLLFLGFYVITLLGNAGMVLLIRVDGRLHTPMYFLLGHLSFVDICYSSTIVPQMLAVLLQRGAALSYTCCAAQFFLFTFFASI
DCYLLALMAYDRYVAVCRPLLYVTIMTEKARWGFVAGAYGAGFSSAFVRTITAFSLSFCGDNEIDFIFCDLPPLLKLTCGDSYTQEVVIVVFAIFVMPICVVAILVSYLF
IVVAIMRIPSAGGRAKTFSTCASHLTAVSLFFGTLIFMYLRGNEDQPSEGDRVVSVLYTVVTPLLNPFIYSLRNKEVKEAFRKALNRPKASGRT*
365 >lcl|XP_540605.3|Plus113067547..13068494 NW_876266 LOW QUALITY PROTEIN: olfactory receptor 484 OR10C10 __SEG__ Chr18 {Canis lupus familiaris} MTLGQNHTTVTRFILLGLTDQAPGRHLLFGIFLLIYAVTLVGNLGMMDLIRTSSTLHTPMYFLLSVLSFLDICNSSVFTPRLLISFLTTDQSISFAGCVVQMAFMILHGT
GECLLLAFMAYDRFVAICHPLLYHTIMSKRLCIQLAVVTYAAGVFISALQTGNAFILPYCGPNIIDHFFCDIPPVLQLACSDTTVANIILLFLSALVTVPTVSAILVSYT
YILVTICRMRSLEAQRKAFSTCASHLIALSLFYGSVFFVYVQPNPESASAYNKTLSVFYTIVIPMLNPLVYSLRK*DVKAAVQIRVLNLSKKGIY*
366 >lcl|XP_540606.2|Plus113118152..13119111 NW_876266 olfactory receptor 1020 cOR5BA2 __SEG__ Chr18 {Canis lupus familiaris} MTPGELALASGNHTPVTQFILLGFSSYPELQQLLFVTFLLIYAMTVMGNLGMMALIFTDSRLHSPMYFFLSVLSFLDICYSSVVTPKLLVNFLASDKTISFEGCVVQLTF
FVVHVTAESFLLASMAYDRFVAICQPLHYGSIMTKETCLQLVAASYAFGGANSAIQTGNVFALPFCGPNQVTHYFCDIPPLLRLACANTATAGVVLYIFSALVTLLPAAV
ILTSYSLVLVAIGRMRSAAGREKALSTCASHFLAIAIFYGTVVFTYVQPHGSTNDTNGQIVSVFYTIIIPMLNPFIYSLRNKEVKDALQRKLQVSIFPC*
367 >lcl|XP_540616.1|Plus113622235..13623377 NW_876266 apelin receptor APLNR __SEG__ Chr18 {Canis lupus familiaris} MEEAGDFDNYYGADNQSECEYADWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSGREKRRSADIFIASLAVADLTFVVTLPLWATYTYRGYDWPFGTFACKLSSYVIF
VNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLALPVMVFRSTGDLENSTKVQCYMDYSMVAAASSEWAWEVGLGVSSTAVGFVVPFTVMLTC
YFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGGLLHWPCDLDIFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRQACASMLCCGRSR
CGAASHSSSGEKSASYSSGHSQGPGPNSGKGAEQMHEKSIPYSQETLVVD*
368 >lcl|XP_540620.1|Plus1complement(13768825..13769754) NW_876266 olfactory receptor 5AK2-like LOC483501 __SEG__ Chr18 {Canis lupus familiaris} MEQNNGTKVTEFILLGFAGQHKSWHILFIAFLVIYVATLMGNIGMILLIKIDSRLHTPMYFFLQHLAFVDLCYTSAITPKMLQNLVETEQSISFIGCMVQLLVYGAFATT
DCYILAAMAVDRYVAICNPLRYPTVMSQAVCIQLLIGSYFVGFLNASVNTSFAFSLNFCKSNKINHFFCDEPPLLALSCSNIDFNIMLLTVFVGFNLMFTVLVVIFSYIY
ILAAILKISSAAGRKKAFSTCASHLTAITVFYGTLSYMYLHHGTKESQEQEKMASVFYGIMIPMLNPLIYSLRNQDVKEALKGIRKKAF*
369 >lcl|XP_540621.2|Plus1complement(13781144..13782073) NW_876266 olfactory receptor 5AK2 OR5AK2 __SEG__ Chr18 {Canis lupus familiaris} MTRENSTEVTEFFLLGFGAQHKYRYFLFIVFLVIYATSMMGNIGIILLIKTDSRLQTPMYFFLQHLAFVDICYTSAITPKMLQNFILENKSISFEGCAMQLLVYATFATS
DCYLLAAMAVDRYVAICNPLHYPMIMSQRVCIQLVAGSYIMGSINASVHTGFTFSLYFCKSNTINHFFCDVPPILALSCSSIDINIMLLVVFVGFNLMFTVLVVISSYIY
IMAAILKISSATERKKAFSTCSSHLTAIIIFYTTLSYMYLQPQANNSQENMKVTSVFYGIVIPFLNPLIYSLRNKEVKEALKVMRKKFF*
370 >lcl|XP_540623.3|Plus113924967..13925911 NW_876266 olfactory receptor 1009 OR04E05 __SEG__ Chr18 {Canis lupus familiaris} MADGNHTRITEFIFIGLKYHPRMQVFLFLLFLLFYFVTVTGNLGMIILIQMDSRLHTPMYFFLSHLSFVDICFSSVVGPKMLTDFFAEKKAISFLGCALQQWFFGFFVAI
ECLLLASMAYDRYVAICNPLLYSVAMSQRLCIQLVVGPYTVGFLSTMTHTTAAFRLPFCGSNIINHFFCDMSPLLSLVCADTRINKLLVFIVAGAVLVVSSLTIIISYFY
ILTAILRIRSADGRRKAFSTCSSHLTAVSILYGTLFFIYVRPGAIFSLDVNKVVSVFYTAVIPMLNPLIYSLRNKEVKAAMHRMIIRRKFCIRS*
371 >lcl|XP_540624.3|Plus113941797..13942738 NW_876266 olfactory receptor 1009 OR16B12 __SEG__ Chr18 {Canis lupus familiaris} MAFENYTRVTEFIFTGLNCSPQLQVFLFLLFLSFYFINLTGNLGMIILIRVDSRLHTPMYFFLSHLSFVDICFSSVVSPKMLTDFFVKRKAISFLGCALQQWFFGFFVAA
ECFLLASMAYDRYVAICNPLLYSVAMSQRLCVQLVVGPYIIGFVNTMTHTTNAFRLPFCGPNVLNHFFCDMSPLLSLVCADSRLTKLVVFVVAGAVGVFSGLTIVVSYIY
ILIAIMKIHSADGRRKAFSTCSSHLTAVSILYGTLFFIYVRPSASFSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKDAIHRTITRRKFCRA*
372 >lcl|XP_540626.3|Plus1complement(13986995..13987930) NW_876266 olfactory receptor 1013-like LOC483507 __SEG__ Chr18 {Canis lupus familiaris} MERGNHTVTEFILVGFTTDPVMQLVLFMVFLGVYSLTVVANATLIVLICNDSRLHTPMYFFIGNLSFLDVWYSSVYTPKILMTCISEDKSISFAGCVCQFFFSAGLAYSE
CYLLAAMAYDRYAAISNPLLYAQTMSSRLCICLVVYSYTGGFVNAIILTSNTFTLDFCGDNVIDDFFCDVPPLVKLACDVKESYQAVLYFLLASNVITPTALILASYVFI
IAAILRIRSTQGRRKAFSTCSSHLVSVTLYYGSILYIYSRPSSSYSLERDKMVSTFYTVLFPMLNPMIYSLRNKDVKEALKKLIWLTQSDV*
373 >lcl|XP_540638.3|Plus114155575..14156510 NW_876266 olfactory receptor 1030 cOR5M13P __SEG__ Chr18 {Canis lupus familiaris} MLKNNYTAVTEFILLGLTDRAELQPVLFVVFLVIYLITVLGNVSMILLIRSDSKLHTPMYFFLSHLSFVDLCYTTNVSPQMLVHFLSERKAISFLGCLLQFHFFIALVIT
DYYMLTVMAYDRYVAICKPLLYGSKMSRCVCFSLVATPYIYGFVNGLAQTILMLRLSFCGPNEINHFYCADPPLIVLACSDTYVKETAMFVVAGFNLTCSLAIILISYIF
IFSTILRIHSAEGRRKAFSTCGSHLTAVTIFYGTLFCMYLRPPSETSVEQSKIVAVFYIFVSPMLNPFIYSLRNKDVKNAIRKVFQRKLLN*
374 >lcl|XP_540639.3|Plus114166643..14167611 NW_876266 olfactory receptor 5M11 OR5M11 __SEG__ Chr18 {Canis lupus familiaris} MSITNDSAIREFILLGLTDRPELQPLLFVLFLGVYLVTLLGNLGMMVLIRLDSRLHKPMYFFLTNLAFVDLCYTSNATPQMLTNFLSEKKTISFAGCFTQCYIFIALLLT
EFYMLAAMAYDRYVAICNPLHYSMKMSRRVCIGLATFPYVYGFSDGLLQAILTFRLNFCRSNVINHFYCADPPLIKLSCSDTYVKEHAMLISAGFNLSNSLSIILVSYAF
IIAAILRIKSAEGRQKAFSTCGSHMMAVTLFYGTLFCMYVRPPTDKTVEESKIIAVFYTFVSPVLNPLIYSLRNKDVKQALKNVLRRNMIIKMRLPPVSNKS*
375 >lcl|XP_540640.2|Plus114179242..14180180 NW_876266 olfactory receptor 1030-like LOC483521 __SEG__ Chr18 {Canis lupus familiaris} MVRGNSTLVTEFVLLGLTDRPELQPILFVLFLLIYLITVCGNLGMLVLIKIDSRLHTPMYFFLASLSCLDLCYSTNVTPKMLVNFLSEKKTISYAACLVQCYFFIAMVIT
EYYMLAVMAYDRYMAICNPLLYSSKMSRGVCIRLIVGPYVYGFLSGLMETMWTYRLTFCGSNIINHFYCADPPLIQLSCSDTFIKETSMFVVAGFNLSNSLLIILISYIF
ILIAILKMHSAEGRHKAFSTCGSHLVAVTVFYGTLFCMYVRPPTDKSVEQSKIIAVFYTFVSPMLNPIIYSLRNKNVKQAFWKLIKRNVLLK*
376 >lcl|XP_540641.3|Plus114201181..14202113 NW_876266 olfactory receptor 5M3-like LOC483522 __SEG__ Chr18 {Canis lupus familiaris} MLNFTDVTEFILLGLTSRPELQVLFFAVFLLVYTITLVGNIGMIILIRISPQLNSPMYFFLSHLSFADVWFSSNVTPKMLENLVAEIKTISYTGCIVQCFFFIAFVHVEV
FILAVMAFDRYMAIGNPLLYSSRMSRTICIRLISFPYIYGFFISLISTLWTHGLYFCGKVEINHFYCADPALIKMACAGTFIKEYTMRTLAGLNFSYSLLVIIISYIFIL
IAILRMRSAEGRKKAFSTCGSHLTAVTIFYGTLFFMYLRSPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMSRAVSRTFLTK*
377 >lcl|XP_540642.3|Plus114208147..14209079 NW_876266 olfactory receptor 5M3 OR5M3 __SEG__ Chr18 {Canis lupus familiaris} MLNFTDVTEFILLGLTSRQEWQVLLFAIFLAVYIVTVVGNVGMIVLIKVSPQLNSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSETKTISYAGCLVQCFFFIALVHVEI
FILAVMAFDRYMAIGKPLLYGSKMSRAVCIRLISFPYVYGFLTSLAATLWTYGLSFCGNIEINHFYCADPPLIKMACAGTFVKEYTMIILAGINFTYSLTVVTISYLFIL
LAILRMHSAQGRRKAFSTCGSHLTAVVIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAMSKVISRTCLTK*
378 >lcl|XP_540643.3|Plus114213991..14214920 NW_876266 olfactory receptor 5M9-like LOC483524 __SEG__ Chr18 {Canis lupus familiaris} MPNFTDVTEFILLGLTSRQEFQVLFFVVFLVVYMITLLGNIGMIFLISISPQLQSPMYFFLSHLSFVDVWFSSNVTPKMLENLLSGTKTISYVGCLVQCYFFIALVHVEV
YILAVMAFDRYMAICNPLLYGSKMSRTVCVQLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADPPLIKIACGGVHIKEYTMIVIAGINFTYSLSVVLISYTLIV
VAVLRMRSADGRRKAFSTCGSHLTAVTMFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVNKAIAKANLG*
379 >lcl|XP_540647.2|Plus1complement(14277512..14278459) NW_876266 olfactory receptor 1044 OR10G10 __SEG__ Chr18 {Canis lupus familiaris} MAQINCTHVQEFILMGLTDRKELKMPFFVVFLSIYFLTVVGNLGLILVIRTDSRLTNTPMYFFLSNLAFVDFCYASVITPKMLGNFLYKQNVISFNACAAQLGCFLTFMV
SECLLLASMAYDRYVAICNPLLYMVVMSPGIRIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIINHFYCDDMPLLRLTCSDTHSKQLWILACAGITFISSVLIVFVSYM
YIISAILRMRSAEGRRKAFSTCGSHMLAVTIFYGTLIFMYLQPSSNHSLDTDKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKAILNRNQALCL*
380 >lcl|XP_540650.3|Plus114328775..14329713 NW_876266 olfactory receptor 5J2 OR5J2 __SEG__ Chr18 {Canis lupus familiaris} MAEENYTTVTEFILLGLTDLTDLKIILFVLFLVIYAITLLGNMVMIFIIQITPKLHTPMYLFLSCLSFVDACYSSAIAPKMLVNLLVVKGTITFSACMVQHLCFGVFVTT
EGFLLSVMAYDRYVAIVNSLLYSAAMSKRKCVGWVNGSWICGIINSLIHTISLGRLSFCGSNVVNHFFCDIPSLLKLSCSDTTMNELLLLTFSGVIAMATFLIVIISYVF
IAVAILRIRSAAGRQKAFSTCASHLTAVTIFYGTLSFSYIQPSSQYFVEQEKVVSVFYTLVIPMLNPLIYSLRNKEVKDAVKRAIEMTHFPC*
381 >lcl|XP_540654.3|Plus1complement(14432286..14433272) NW_876266 olfactory receptor 8K1 OR04A01 __SEG__ Chr18 {Canis lupus familiaris} MTLVMVVPTAISLNGLDEQNLTVLTEFILMGITDHPELQALFFGLFLIIYTVSVVGNLGMIILTKVDSRLQTPMYFFLRHLAFIDLGYSSAVAPKMLVNFVADQNTIPYN
WCATQLAFFILFIISELFNLSAMAYDRYVAICNPLLYTIVMSQRVCWGLITIPYVYSACLSLIITIKIFMASFCGHNVIRHFYCDSLPLLTLLCSSTRDIELIILIFSAF
NLISSLLIVLVSYILILMAILRMNSAEGRHKAFSTCGSHLTVVVVLYVTLFFMYVQPKSSHSFDTDKIASIFYTLIIPMLNPMIYSLRNKEVKGALHRIWKNLHKPPV*
382 >lcl|XP_540655.2|Plus1complement(14444278..14445225) NW_876266 olfactory receptor 8J2 TPCR63 __SEG__ Chr18 {Canis lupus familiaris} MASGNLTHLTEFILRGVSDRPDLQMPLFFVFLVIYGLTVAGNLGIITLTSVDSQLQTPMYFFLRHLAIINLGDSTVIAPKMLVNFLASKKTISYYGCAAQLGGFLVFIVG
EIFMLAAMAYDRYVAICNPLLYMVVVSPQICLLLVSLIYLYSLTTALTVSSCVFSVSYCSSNIIDHFYCDNVPLLALSCSDTYIPETVVFTSAGTNLFFSMIIVLTSYFH
IVLAILRIRSSEGRRKAFSTCASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNKDVKDAFKRFLKSPCQAFKLV*
383 >lcl|XP_540658.3|Plus114494221..14495210 NW_876266 LOW QUALITY PROTEIN: olfactory receptor 5T2 cOR5T6 __SEG__ Chr18 {Canis lupus familiaris} MSYNFVNIFKLLL*DINMKNATEVTIFVLKGFTDKLELQTALFFLFLATYLFTMMGNLVLVLLVIVDSQLHNPMYYFLSVLSSVDACFSSVITPNMLVDFMLKNKVISFL
GCAAQMFLAVTFGTTECFLLAAMAYDRYVAIYNPLLYSVGMSPRVYVPLIVASYVGGILHASVHTVATFSLSFCASNEIRHVFCDIPPLLAISCSDTHTNQLLLFYFVGS
IEIVTILIVLISYGFIVLAILNIHSAEGRWKVFSTCGSHLTGVSIYHGTIVFMYVRPSSSYAPDHDMIVSMFYSIVIPMLNPIIYSLRNKDVKEAMKRMFQKKWFINSY*
384 >lcl|XP_540660.3|Plus1complement(14555161..14556093) NW_876266 olfactory receptor 1052-like LOC483540 __SEG__ Chr18 {Canis lupus familiaris} MAGWNHTGVKEFLLVGLTENPNLQIPLFLLFTLIYFTTLAGNWGMIMLIWLNAQLHTPMYFFLSNLSFCDICYSTVFAPKMLVNFLSKHKSSTFSGCVLQSFFFAVYVTT
EGILLSMMAYDRYVAIANPLLYRVIMTQRVCIQMVLASYLGGLINSLTHTIGLLKLDFCGPNIVNHYFCDIPPLLRLSCSDAHNNEMLLLIFSGVIAMFTFTIIMVSYMC
IIMAIQRIRSAEGRRKAFSTCASHLTAVTLFYGSVTFSYIQPSSQYSLEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKDAAKRSIWWKRT*
385 >lcl|XP_540661.3|Plus114588406..14589377 NW_876266 olfactory receptor 5F1-like LOC483541 __SEG__ Chr18 {Canis lupus familiaris} MTRRNHTSLTEFILLGLADTMELQVILFLLFLVIYTLTVLGNVGMILLIRTDSQLHTPMYFFLANLSFVDVCYSSTITPKMLVDLLSEKKTISFAGCFLQLYFFIALATT
ECILFGLMAYDRYVAICNPLLYSLIMSRTVCLKMAAGAFTAGFLNSMVNTSYISSLPFCSSNVIHHFFCDSPPLFRLSCSDTRLNESIFSTFAGMNMVGALLVILTSYSY
ILFSIFHMHSGEGKRKAFSTCGSHLTALTLFYATAIYTYLRPSSSYSLDKDKVASVFYTVVIPMLNPLIYSLRNREVKKALWNVTIRTRIPFISLISLVNFLN*
386 >lcl|XP_540672.2|Plus114801152..14802090 NW_876266 olfactory receptor 5W2 OR16F12 __SEG__ Chr18 {Canis lupus familiaris} MAVENCTVITDFILLGLSGRKDVQQGLFVLFLLVYSTTMIANLGMILLIKLDSRLHTPMYYFLSNLSLCDVCYSSTVSPKMLADFLSEQKRIPYDLCAIQMYFFGVFADV
ECLMLAVMAYDRYVAICNPLLYTIAMSRQICIQLVSLAYIVGFVDSAIHTCCTFRLSFCDSNIINHFFCDIPPLLALSSSDTSINEIVMFTFIGCVVGCSIITVLLSYSY
ILTTILRMNSAEGRRKAFSTCASHLTAVAIFHGTLLFMYFRPSSSYSMDTDKMSSVFYTVVIPMLNPLIYSLRNKDVKGALKKAISTKLCSG*
387 >lcl|XP_540673.3|Plus1complement(14807034..14807966) NW_876266 olfactory receptor 1019 OR16D05 __SEG__ Chr18 {Canis lupus familiaris} MELENHTVKSEFFLLGFSDHPELWRVLFVMFLFIYSVTLMGNLGMILLITTSSHLHTPMYFFLCILSFVDVCYSSVIAPKLLVDLISKEKTISYKGCAAQLYFFCSLVDT
ESFLLAAMAYDRYIAICNPLLYMVIMSKRVCSQFAIGAFLGGTMSSIIHTTNTFHLSFCSKEINHFFCDISPLFSLSCTDTYMHDIILVVFAGLVEAICLLAVLLSYVCI
IAAILKTGSAEGRKKGFSTCASHLTVVTIYHGTLIFIYLRPSTGHSLDIDKVTSVFYTLIIPMLNPLIYSLRNKDVKNAFRKVIGRKLLS*
388 >lcl|XP_540676.3|Plus1complement(14838193..14839128) NW_876266 olfactory receptor 5L1 OR5L1 __SEG__ Chr18 {Canis lupus familiaris} MGEENCTSVTEFILLGLADAPELRVFLFLLFLLIYGVTVLGNLGMIAVIQVSSQLHTPMYFFLSHLSFVDFCYSTIIVPKMLPNILNRDKAISFLGCMVQFYLFCTCVVT
EVFLLAVMAYDRFVAICNPLLYMVTMSQNLCMELVSCCYLCGTACSLIHLCLALQIPSYRSDVINHFFCDLPPLLSLACSDVTMNELLLYIVATFNELTTILIILTSYLL
ILITILRMRSAEGRRKAFSTCASHLTAILVFHGTILFIYCRPGSGNSMDADKVATVFYTIVIPMLNPLIYSLRNKDVKEALRKVVSSKMFS*
389 >lcl|XP_540677.3|Plus1complement(14847130..14848071) NW_876266 olfactory receptor 5D18 OR5D18 __SEG__ Chr18 {Canis lupus familiaris} MLLSERNKSGATFTLLGFSDYPELQIPLFLIFLAIYSVTVVGNLGMIVIIKINPKLHTPMYFFLSHLSVVDFCYSSIIAPKALANLVAEDRTISFPGCVVQFFFFCTFVV
AESFLLAVMAYDRFVAICNPLLYTVTASQKLCAMLVVGSYAWGVTCSLILTCSVVKLSFQGFNTINHFFCEFSALISLSCSDTYISQLLLFIFATFNEVSTLLIILLSYV
FIVVTILKMRSASGRRKAFSTCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKGTVNKLIGTKVFSF*
390 >lcl|XP_540679.3|Plus1complement(14886552..14887502) NW_876266 olfactory receptor 5D13-like LOC483559 __SEG__ Chr18 {Canis lupus familiaris} MELDEGNQSSVTTFILLGFSEYPHLQMPLFLVFLTVYTVTLVGNLGIIMVVRINPKLHTPMYFFLSHLSFLDICYSSVFTPKLLETLVTEDRSISFKGCMVQFFFICAFV
ITEMFMLAVMAYDRFVAVCNPLLYTVAMSQKLCALLVAGTYTWGGICSLTLTYSLLELSYCGSNIINHFGCEYSAILSLSCSDPYFSQMTCLVISTFNEACSLLIILASY
IFIVVTIIKMPSAGGLQKAFSTCASHLTAITIFHGIILLLYCVPNSKSSWLLVKVATVFFTVMIPMLNPLIYSLRNKDVKDTARKLIHTKLLSHSM*
391 >lcl|XP_540682.3|Plus1complement(14974713..14975642) NW_876266 olfactory receptor 4P4 OR4P4 __SEG__ Chr18 {Canis lupus familiaris} MDQSNNVTVFILLGLSKNKNIEILCFVLFLFCYLAIWIGNLLIMISIMCSQLIEQPMYFFLNYLSVSDLCYTSTVTPKLMTDLLAERKTISYSNCMTQLFTTHLFGGIEI
FILTGMAYDRYVAICKPLHYTIIMSRQRCNAIIAACCTGAFIHSTSQFLLTIFLPFCGPNEIDHYFCDVYPLLKLACSNTHAIGLLVIANSGLIALVTFAVLTLSYCFIL
CSIRAYSAQSRSKALATCTSHLTVVVLFFAPALFIYLRPATTFPEDKVLALFYTIIAPMFNPLIYTLRNTEMKNALRKVWCHHALLEGK*
392 >lcl|XP_540684.3|Plus1complement(14993078..14994013) NW_876266 olfactory receptor 4P4 cOR4Y1 __SEG__ Chr18 {Canis lupus familiaris} MERQRNISEFILLGLSYDQNMQIFCFVLFLFCYIALLVGNLLILVSIRCSPLFHQPMYYFLSHLSSMDICYTSSVTPKLIADLLGGTKTISYGNCMLQVFAMHFFGSIEV
FVLTVMAFDRYVAICRPLHYMLIMNRARCHLLVLAAWAGGALHSFPQLSMTIQLPFCGPNEIDHYFCDIFPLLKVACTDTYIIGVLVVANSGMVALVTFVVLFVSYVIIL
FSLRHHSAEGRHKALSTCGSHITVVILFFGPSIFAYLRPPTTFPEDKVFALFYTIIAPMFNPLIYTLRNAEMKNAMTKVWCQTLFSRKAHN*
393 >lcl|XP_540702.3|Plus1complement(15598533..15599447) NW_876266 olfactory receptor 4C11-like LOC483582 __SEG__ Chr18 {Canis lupus familiaris} MSMNSSVNEFILLGLTQDPRKQKAIFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFFLFYLSFADACFSTTIAPRLIVDAISQQKTISYNECMTQVFAVHFFACMGI
FVLILMAFDRYVAICKPLRYTTIMNRHVCSVLVTLGWVGSCIHSSAQIVLALKLPFCGPNMIDHYFCDLQPLLKLACMDTYVINLLVVTNSGAICMVSFIILLISYVIIL
YSLRNYSAEGRRKALSTCTSHFIVVVLCFGPCIFIYTRPATTFPVDKVVAVFYTIGTPLLNPLIYTLRNAEVKIAMKMLWCSKV*
394 >lcl|XP_540706.3|Plus1complement(15705514..15706428) NW_876266 olfactory receptor 4C11 cOR4C31 __SEG__ Chr18 {Canis lupus familiaris} MAMNSSVNEFILFGLTQDPRKQKAIFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFFLFYLSFADACFSTTTAPRLIVDALSQQKTISYNECMTQVFAVHFFGCMEI
FVLILMAFDRYVAICKPLRYTTIMNRHVCSVLVILGWVGSCIHSSAQIVLALRLPFCGPNVIDHYFCDLQPLLKLACMDTYVINLLVVSNSGAICTVSFTILLISYVIIL
YSLRNHSAEGRRKALSTCTSHFIVVVLFFGPCIFIYTRPATTFPVDKVVAVFYTIGTPLLNPLIYTLRNTEVKIAMKKLWCSKV*
395 >lcl|XP_540709.1|Plus1complement(15744805..15745749) NW_876266 olfactory receptor 4C6 OR14D11 __SEG__ Chr18 {Canis lupus familiaris} MENPRNVTEFILLGITENPELRKMLSAVFLIMYVSTVLGNLVIVVTVITSQSLRSPMYFFLPFLSLLDVTYSSVIAPKMIVDSLSKSTAISLEGCMTQLFAEHFFGGVGI
ILLIVMAYDRYVAICKPLHYMTIMSPRMCCLLLGGAWVGGFIHAAIQLLFMYQLPFCGLNVIDHFMCDLFPLLKLACMDTHTLGILVILNSGVMCMTIFLILITSYMVIL
CSLKSCSSEGRRKAFSTCGSHLTVVVLFFVPCIFLYVRPVATYPIDKAMAVSFTIVTPMLNPLIYTLRNSEVKNAVRKLVKQGILGITSSHAKD*
396 >lcl|XP_540715.3|Plus1complement(15901104..15902009) NW_876266 olfactory receptor 4C12 OR08D06 __SEG__ Chr18 {Canis lupus familiaris} MEKMNNVTEFILLGLTQNVELQKFSFVVFLIVYLVTLAGNLLIMITISTSKALETPMYFFLSYLSLIDGCCSSSMTPKMLADTLTMRKIISFRGCMTQVFAEHFFGAAEI
ILLTVMAYDRYVAICKPLRYTTIMSQQVCSLLVGVAWAGGFVHATIQIFFTVWLPFCGPNVIDHFMCDLNPLLKLVCMDTHTLGLFVAANSGFICLLNFLLLVVSYMVIL
HSLGTYSLEGRRKALSTCVSHITVVILFFVPCIFVYLRPAITFSIDKAVAVFYTMITPMLNPLIYTLRNAEVKNAIKKLWI*
397 >lcl|XP_540719.3|Plus115953245..15954174 NW_876266 olfactory receptor 4C45-like LOC483599 __SEG__ Chr18 {Canis lupus familiaris} MERMNNVTEFVLLGLTQNPELQKFLFAVFLITYLITLAGNLLISVTIFISPALGSPMYFFLSYLSIIDGFYSSSIAPKMIFDLISERNTISFNGCMTQLFAEHFFAGAEI
ILLIAMAYDRYVAICKPLHYMTIMSRPVCGFLVGMAGILGFVHGGIQVLFMIQLPFCGPNVIDHFMCDLIPLLELTCADTHTLGPLVSANSGSLCLLTFSMLVASYIVIL
RSLRTHSSEGRRKALSTCASHVTVVILFFVPCSFLYLRPTTSFPADKAVTVFCTLVTPMLNPLIYTLRNSEVKNVMKKLWGQIMKTGDK*
398 >lcl|XP_540724.3|Plus1complement(16096192..16097121) NW_876266 olfactory receptor 4C12 OR4C12 __SEG__ Chr18 {Canis lupus familiaris} MENKRNVTEFILIGLTQNPTMQNIVFLGFLILYMVTLSGNLLIVVTITTSQVLNSPMYFFLTHLSVIDTIYSSSSAPKLIVDSLHEKKVISFNGCMAQVYAEHIFGATEI
ILLIVMAYDRYVAICKPLHYTTVMNHRLCILLLGMAWTGGFLHATIQILFTVWLPFCGPNVIDHFMCDLYPLLKLVCMDTHTLGLFVALNSGFICLLNFLLLVVSYVVIL
YSLKNYSLEGRRKALSTCVSHITVVVFSFVPCIFVYLRPVTTLPIDKAVAVFYTMVVPMLNPLIYTLRNAEVKNAMRKLWRKNVTSDNE*
399 >lcl|XP_540727.3|Plus1complement(16158440..16159369) NW_876266 olfactory receptor 4S1-like LOC483607 __SEG__ Chr18 {Canis lupus familiaris} MGTKNNVTEFVLFGLFQSREMQLVCFVVFSLFHVLTVLGNLLVIITINASKTLNAPMYFFLSHLSFADMCYPSATTPKMIADTFVERKTISFNGCMTQLFSAHFFGGTEI
FLLTAMAYDRYVAICRPLHYTAIMDRWKCGLLAGASWVGGFLHSILQTLLTVQLPFCGPNEIDNFFCDVHPLLKLACADTYVVGLIVVANSGMISLVSFIILIISYVVIL
LNLRSQSSEGRRKALSTCGSHIVTVLLVLLPPMFMYIRPSTTLAVDKLVILFNIVMPPLLNPLIYTLRNNEVKNAMRKLFRVEGNMGEK*
400 >lcl|XP_540729.2|Plus1complement(16184880..16185617) NW_876266 olfactory receptor 4X1-like LOC483609 __SEG__ Chr18 {Canis lupus familiaris} MATPSNVTEIILLGFPPNREVQKTVSVLFLLMYMTIVLGNGLILVMVMASKGLTSPMYFFLSFLSFVEICYCSVTAPKLILDSFIERQTISLKGCITQIFFLHFFGGTEI
FLLTVMAYDRYVAICKPLHYTVIMNRRVCGLLVGAAWSGGLLHSVGQTFLIFQLPFCGLKVLDHYFCDVHPVLKLACSDTFLIGVLIIANGGSISVVSFVGLLASYVVIL
YSLRTQTSEGRRKALSTCASHIAVD*
401 >lcl|XP_540731.3|Plus1complement(16206584..16207513) NW_876266 olfactory receptor 4S1-like LOC483611 __SEG__ Chr18 {Canis lupus familiaris} MGTKNNVTEFVLFGLFQSREMQLVCFVVFSLFHVLTVLGNLLVIIIINASKTLNSPMYFFLSHLSFADMCYPSATTPKMIANSFMERKTISFNGCMTQLFSAHFFGCTEI
FLLTAMAYDRYVAICRPLHYTAIMDRWKCGLLAGASWVGGFLHSILQTLLTVQLPFCGPNEIDNFFCDVHPLLKLACADTYLVGLIVMVNSSMITLGSFIILIISYMVIL
LNLRNQSSEGWRKALSTCGSHIITVLLVLLPPMFMYTRPSTTLAADKLVILFNIVMPPLLNPLIYTLRNNEVKNAMRKLFRVEGSMGEK*
402 >lcl|XP_540733.1|Plus1complement(16239785..16240714) NW_876266 olfactory receptor 4X2 OR4X2 __SEG__ Chr18 {Canis lupus familiaris} MGNTHNVTEFVFLGLSSNQDVQKVFFVLFLFLYTAVVLGNLLIVLIVMTSRRLGSPMYFFLSYLSFVEICYSSTTAPKLISDLLAERKAISLWGCMTQLFFMHFFGGTEI
LLLTVMAYDRYVAICRPLNYTVMMNRQVCAVLVGMAWVGGFVHSFAQILLIFRLPFCGPNVIDHYFCDLLPVLKLACSDTFLIGVLIVANGGTLSVISFGIILASYVVIL
LHLRTRSSEGRSKALSTCGSHITVVTLFFGPCIFIYLRPSTTLSADKTVAVFYTVITPLLNPVIYSLRNAEVKKAMKKLWIRTMKLEEK*
403 >lcl|XP_540734.1|Plus1complement(16248743..16249672) NW_876266 olfactory receptor 4B1-like LOC483614 __SEG__ Chr18 {Canis lupus familiaris} MANTNNVTELIIIGLFQDPEVQRVCFVIFLLVYLATVVGNGLIVLTVNVSKSLHSPMYFFLSYLSLVEITYSSTVVPKFITDLLAKIKTISLEGCVAQIFFFHFFGVTEI
FLLTVMAYDRYVAICKPLHYTTIMSRSVCCLLVAGSWIGGFFHSMVQIIITLQLSFCGPNVIDHYFCDLHPLFKLACTDTSVEGVIVLANSGLFSIFSFLLLVSSYIVIL
FNLRNHSAEGRRKALSTCASHIMVVLLFFGPAIFLYMRPPSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKNAMRKLWGKKVNSGMG*
404 >lcl|XP_540735.3|Plus1complement(16267592..16268521) NW_876266 olfactory receptor 4B1 OR08C02 __SEG__ Chr18 {Canis lupus familiaris} MESTTNNVTELIFVGLFQDPEVQRVCFVVFLLMYLATVVGNGLIVLTVNVSKSLHSPMYFFLSYLSLVEITYSSTVVPKFITDLLTKIKTISLEGCVAQIFFFHFFGVTE
ILLLVVMAYDRYVAICRPLHYMNIMSRQLCHILVAGSWLGGFFHSIIQILITIQLPFCGPNVIDHYFCDLQPLFKLACTDTFVEGVIVLTNSGLIALCSFLILVSSYIVI
LFNLRNHSAEGRRKALSTCASHIMVVLLFFGPAIFLYMRPSSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKNAMRKLWSKKNSGME*
405 >lcl|XP_540793.3|Plus1complement(21837756..21838616) NW_876266 mas-related G-protein coupled receptor member G-like MRGPRG __SEG__ Chr18 {Canis lupus familiaris} MFGFWRAFTNVLFYLTLAIGLGGLLGNGLVLWHLGFHIKKGPFSVYVLHLAAADFLFLGFQVGFSIAQAALGSKDNLYFAVTFVGFAVGLWLLAALNAERCLSLLFPTCY
QGHRPRHTSGVICGLVWALTPPAVLLPAHTCGLLRASKRPLTCLRYHAASVTWLLSLACVACVAGLVLFIWVACCSQRPRPQFFGVTVGSALLLCFCGLPLVLYWSLQPL
LSFPLPAFFPLAVLLACVHGSAKPLLHFMAGRRPGPRQPLRALLQRSLGEQAQRGARGLSLPMSLM*
406 >lcl|XP_540806.1|Plus123732744..23733793 NW_876266 mas-related G-protein coupled receptor member D MRGPRD __SEG__ Chr18 {Canis lupus familiaris} MSQTLNGSQILKPTPYSPMLDAPYSPTREVLHGIVVGREYHPTLDSSDSPKAQVVLSILAMFTCVCGIMGNSLVIWLLTCRMQRTPFCTYILHLAVADLLFLLCTAITIC
LEDSLLAYEVMQRMKYFAYTVSLGLLTAISTQRCLSVLFPIWYKCHQPQHLSAVVCAVLWAVFLLMNMLASFFCSKFWHFKNEQCFIVDSTFSTLIMGVFTPVMTASSVT
LFVLVRRSSRQWQRQRQPTRLYVVTLASVLVFLICALPLGISWFLFYWLLLPLELKSLFHHMATFSSAVSSSANPIIYFVVGSRGRRGLQEPLGTVLQRALREEPELEER
ETLSTGTGTGTGTGTEEGA*
407 >lcl|XP_540888.1|Plus1complement(27632083..27634107) NW_876266 leucine-rich repeat transmembrane protein FLRT1 FLRT1 __SEG__ Chr18 {Canis lupus familiaris} MVVAHPATTATTTPTATVTATVMMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQV
IYLYENDLDEFPVNLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPRTLEELRLDDNRISTIPLHAFKG
LNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLENLAQLLLRNNPW
FCGCNLMWLRDWVQARAAVVNVRGLMCQGPEKVRGMAIRDITSEMDECFETGSQGGAANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSSLDYPMATGEGAKTLA
IHVKPLTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETGNAYVADETPVCAKAETADSHGPTTTLNQEQNADAMAG
LPLAGIIGGAVALVFLFLVLGAICWYVHRAGELLTRDRAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKGTHTIGYGTTRG
YRDGGIPDIDYTYT*
408 >lcl|XP_540897.2|Plus128500706..28502088 NW_876266 muscarinic acetylcholine receptor M1 CHRM1 __SEG__ Chr18 {Canis lupus familiaris} MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASN
ASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFILWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRAR
ELAALQGSETPGKGGGSSSSSERSQRGTEGSPETPPGRCCRCCRTPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAPAPTKQPPRSSPNTVKRPT
RKGRERAGKGQKARGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKNCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKR
RWRKIPKRPGSVHRTPSRQC*
409 >lcl|XP_540958.1|Plus1complement(16977554..16978513) NW_876267 protein sprouty homolog 1 SPRY1 __SEG__ Chr19 {Canis lupus familiaris} MDPQNQHGSGSSLVVIQQPTLDSRQRLDYEREIQPAAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPINVNNNYEHRPTSHLGHAGLSSNARGPI
LSRSTSTGSAASSGSNSSASSEQGLLGRSPPTRPVPGNRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGT
CMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRGCYDWIHRPGCRCKNSNTVYCKLESCPSRGQGKPS*
410 >lcl|XP_541098.2|Plus124418965..24419855 NW_876269 adrenocorticotropic hormone receptor MC2R __SEG__ Chr1 {Canis lupus familiaris} MKHIINLHENINDTARNNSDCPHVVLPEEIFFIISIIGVLENLMVLLAVIKNKNLQSPMYFFICSLAISDMMGSLYKILENILIVFRNMGYLKPRGNFETTADDIMDSLF
ILSLLGSIFSLSVIAADRYFTIFHALQYHSIVTMRRAIVVLTVIWTGCTGGAITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHARKILTLPRANMKGAIT
LTILLGVFIFCWAPFVLHVLLMTFCPNNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELREAFKKMVFCSRS*
411 >lcl|XP_541099.3|Plus1complement(24461096..24462073) NW_876269 melanocortin receptor 5 MC5R __SEG__ Chr1 {Canis lupus familiaris} MNSSFHLLFLDLNSNATEGNFSGPNVKNKSSPCEEMGIAVEVFLTLGLISLLENILVIGAIVKNKNLHSPMYFFVCSLAVADMLVSMSNTWETITIYLIHNKHVVIADAF
VRHIDNVFDSMICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTVRRSRVIITCIWTFCTGCGIVFIVYYESTYVIVCLISMFFTMLFLMVSLYIHMFLLARTHVKRIA
ALRGCSSVRQTASMRGTVTLTMLLGIFIVCWAPFFLHLILMISCPQNFYCSCFMSYFNMYLILIMCNSVIDPLIYAFRSQEMRKSFKEIICCHGFRIPRRFLSRY*
412 >lcl|XP_541198.1|Plus1complement(55023406..55024356) NW_876269 probable G-protein coupled receptor 31 GPR31 __SEG__ Chr1 {Canis lupus familiaris} MGDVVPANCSARSRAVEVSVATLLALECILGLLGNVVALWTFFFRLKVWKPYAVYLLHLVVADLLLTFCLPFHAAFYLRRKTWSFGHVSCQTLHFLQVLSRGVGIAFLTA
VALDRYFRVVHPRLKVNLLSCRAAWGVSGFIWLLLLGLTHQSLFVSEATCPNPDPGVDLSFSIVWQEALFFLQFIFPFGLLLFCNARIIRTLQKRLRDPDKQPKLQRARA
LVTVVVVLFAVCFLPSFLARILMAIFQGAGGCRALGPMVHVSDVASSLTYLQSVLNPVLYCFSNPAFRHSYRKVFNTLRGRGRDTEAPGDIRDSYS*
413 >lcl|XP_541315.2|Plus1complement(27560621..27561769) NW_876270 sphingosine 1-phosphate receptor 3 S1PR3 __SEG__ Chr1 {Canis lupus familiaris} MATVVPPRARPSPGNGNETETLHEHYNYVGKLEGRLREAPEGSMPTTVLFLIICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKRTLSL
SPTLWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKKHRVFLLIGMCWLIAFSLGALPILGWNCLHNLPDCSTILPLYSKRYIAFCISIFTAILVTIVILYA
RIYFLVKSSSRRVASPHNSERSMALLRTVVIVVSVFIACWSPLFILFLVDVACRVKQCAILFKAQWFIVLAVMNSAMNPVIYTLASKEMRRAFFRLVCTCLVRRWGARSS
PTQPALDPSRSKSSGSNNSSPSPKSKEDPPQIAASPCIMDGNKTLQNGILCK*
414 >lcl|XP_541555.1|Plus140251332..40252423 NW_876270 G-protein coupled receptor 4 GPR4 __SEG__ Chr1 {Canis lupus familiaris} MGNRTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQRNELGVYLMNLSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCC
ISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKA
KIKRLALSLIAIVLVCFAPYHVLLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKALHNLLRFLASDKPQEMANASLTLETPLTSK
RNSMAKAMAAGWAAVPPSQADQVQLKMLPPAAQ*
415 >lcl|XP_541769.3|Plus1complement(7166034..7167497) NW_876271 histamine H1 receptor HRH1 __SEG__ Chr20 {Canis lupus familiaris} MNLPNSSCIFEDKMCEGNKTTIANPKLMPLVVFLSAISLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSRWSLGQPLCLFWLSMDYVA
STASIFSVFILCIDRYRSVRQPLRYLKYRTKTRASATILGAWFLSFLWIIPILGWHHFMSQTSGHREDKCETDFYDVTWFKIMTAIINFYLPTLLMLWFYARIYKAVRQH
CQHRELINGSLPSFSEPKLKPENPKAGAKKPGKESPWEFLKRKSKDASGEPVLKPPSQDSEEMKSPSVFRQEEDREVDKLQCFPLNIVQVQTEAEGSVRSYVAINQSQSM
LEMDEQGLNMRGANETSEDQILGDSQSFSRTDSDTPTESGSGKGKPRSESSTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAF
CKSCCNERVHMFTIWLGYINSTLNPLIYPLCNENFKKTFKKILHIRS*
416 >lcl|XP_541904.2|Plus1complement(17086298..17087347) NW_876272 chemokine (C-C motif) receptor-like 2 CCRL2 __SEG__ Chr20 {Canis lupus familiaris} MDNYVTAPEDDYDVLIEDDLNNDEIKLCHLYETKILSTRVLPQLYATVFLAGLLGSLLVVLILVKHKGLKHMGNIYFLNLAVSNLCFLLALPFWAYAAMHGEVLGNSMCK
ILVILYSIGLYSEAFFNILLTVQRYLVFINVNFPSTTRAMHWGIISSVLAWVLATLVILPESMFYKPQMESQKYKCSISRPHFLPAEETFWKYFLTLKMNILGFLFPLCI
FVFCYARMRRILRSGERGNGLHQLVFAIMAVFLLMWGPYNIALFLSTFKEYFSLHDCKSNYNLDKSVQILRIFATTHCCVNPLLHVFLDTTFRRHLRRLCSVHDSSLLQS
TEESARAAPREERDHSTKV*
417 >lcl|XP_541906.1|Plus1complement(17123401..17124519) NW_876272 c-C chemokine receptor type 2-like CCR2 __SEG__ Chr20 {Canis lupus familiaris} MGDNGTFSQVSHNMLSTSHSLFTTNIQGSDEPTTIYDYDYSAPCQKSSVRQVAAGLLPPLYSLVFIFGFVGNMLVVLILINCKKLKSMTDIYLLNLAISDLLFLLTIPFW
AHYAANGWLLGEVMCKSFTGLYHIGYFGGTFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSGVTWMVAVFASLPRIIFTTVQIEDSFSSCSPQFQQAWKNFHTIMRSV
LGLVLPLLVMVICYSAILKTLLRCRNEKKRHKAVKLIFVIMIVYFLFWAPNNIVLLLSTFQESFNVSNCKSTSQLDQIMQVTETLGMTHCCVNPIIYAFVGEKFRRYLSL
FFRRHIAKHLCKQCPVFYGETADRVSSTYTPSTGEQEVWVGL*
418 >lcl|XP_541908.2|Plus117327325..17328317 NW_876272 chemokine XC receptor 1 XCR1 __SEG__ Chr20 {Canis lupus familiaris} MEPSGTPESITIYYDYQSLLCETKSFTFATFSTTILYFLVFLLSLVGNSLVLWVLVKYESLESLTNVFILNLCLSDLVFSCLLPVWAMGYHWGWVLGDFLCKLLNMIFSI
SLYSSIFFLTIMTIHRYISVVRPLSSLRVHTLQCRVLMTTSVWATSILSSIPDAIFHKVFPEGCHYSENKWFLTSVYQHNIFFLLSIGIILFCYVEILRTLFRSRSKRRP
RTVRLIFTIVVAYFLSWAPYNLVLFLQTLLKLGVIQSCELSQQIDYALLICRNVAFSHCCFNPVLYVFVGVKFRRHLKSLLQHFWLCQQQAPSTPPHSAGAFNYEGASFY
*
419 >lcl|XP_541969.2|Plus1complement(21227587..21228528) NW_876272 olfactory receptor 1F1 OR18C09 __SEG__ Chr20 {Canis lupus familiaris} MEDANLTSVTEFLLLGLSENPKQQQLLFIIFLTMYLVTGLGNLLIILAIATDPRLHTPMYFFLANLAFVDICFTSTTIPKMLANHVSGHKGIPYAGCLTQMFFFIWFAGI
DSFLLAAMAYDRYVAICHPLHYTTSVTPQLCGFLVAASWTAAFGNALTHTVLLTRLSFCTHNRVPHFFCDLSPLLKLACSDIFLNNAMVYTLGALPTIIPFVGILVSYTC
IFATVLRIPSTRGKQKAFSTCGSHLSVVSLFYGTLIGVYFSPMSSHTAQKDTAAAVMYTVVTPMLNPFIYSLRNSDMKGALGALINRKPVFSQ*
420 >lcl|XP_541971.3|Plus121283923..21284882 NW_876272 olfactory receptor 10H2 cOR10H9 __SEG__ Chr20 {Canis lupus familiaris} MAATLGLNHSSVSEFILVGFSTFPPHLLPAFFLLFLLMYLFTLLGNLLIMATVWSERGLHTPMYLFLCALSISEILYTLAITPRLLADLLSTRRTIAFAACTSQMFFSFT
FGFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCTYLVAWSWAGGSIIGLVVATAVFHLTFCGPNEIHHFLCHVPPLLKLACGTDVPIVALGVGLVCITALLGCFLLIL
LSYAFIVAAILRIPSAEGRHKAFSTCASHLIVVIVHYGFASVIYLKPKGLHSQEGNTLMAITYTVLTPFLSPIIFSLRNKELKIAMKKTFLSKLYPSSI*
421 >lcl|XP_541978.1|Plus121362439..21363398 NW_876272 olfactory receptor 10H1-like LOC484862 __SEG__ Chr20 {Canis lupus familiaris} MAATLGLNHSSVSEFILVGFSTFPPHLLPAFFLLFLLMYLFTLLGNLLIMATVWSERALHTPMYLFLCTLSISEILYTLAITPRLLADLLSTRRTIAFAACTSQMFFSFT
FGFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCTCLVAWSWAGGSVMGLVVTTAVFHLTFCGPNEIHHFFCHVPPLLKLACGTDVPIVALGVGLVCITALLGCFLLIL
LSYAFIVAAILRIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKAPQSLEGDTLMGITYTILTPFLSPIIFSLRNKELKTAMKKTFLSKLYPQSS*
422 >lcl|XP_541979.1|Plus1complement(21377957..21378904) NW_876272 olfactory receptor 10H1 isoform 1 cOR10H13 __SEG__ Chr20 {Canis lupus familiaris} MQRGNFSVVTEFILVGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATVGSERGLHTPMYLFLCALSISEILYTLAITPRLLADLLSTHHTITSMACASQMFFSFTFGFT
HSFLLTVMGYDRYVAICHPLRYNVLMSPRGCTCLVVWSWVGGLVMGLVVTTAVFHLTFCGPNEIHHFACHVPPLLKLACGTDVPIVALGVGLVCITALLGCFLLILLSYA
FIVAAILRIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKAPQSLEGDTLMGITYTILTPFLSPIIFSLRNKELKTAMKKTFLSKLYPEKI*
423 >lcl|XP_541980.1|Plus1complement(21397828..21398763) NW_876272 olfactory receptor 24 OR10A02 __SEG__ Chr20 {Canis lupus familiaris} MDNQTRNFEFILLGLSEQPLQQQVFFGLSFSLYLIGCMGNLLSILAILLDPHLHSPMYFFLSNLSLLDICFASTTIPKMLVNHLCGHSTISSKACLTQMYFFITFGAADS
ILLSTMAYDRYLAICCPLRYITIMSVLRCALLVAVPWISANLISMVHTILMTRLSFCTNRIPHFFCDLNALIKLSCSNTQVNEMLVLVFGGSVVLIPFVCIMASYTPIAM
AVWKVPSAQGKWKAFSTCSSHLCVVALFYGTIIGVYFNPASTHTTQKDIATTVMYTMVTPMLNPFIYSLRNRDLKEALWKLLKGNHLATPL*
424 >lcl|XP_541990.1|Plus1complement(21982925..21983863) NW_876272 olfactory receptor 7C1-like LOC484874 __SEG__ Chr20 {Canis lupus familiaris} MELRNHSGLPVFLLLGFSEKPEIQSVLFGLFLSLYLVTVFGNLLIILAISSDSHLHTPMYFFLSNLSFSDICFTSTTIPKMLLSIQTQNKVITYAGCITQMYFFTVFGLL
DNLLLTAMAYDRFVAVCHPLHYTVIMNPQLCAQLLTLTWLISVLGALPESLTMLRLSFCAVVEIPHYFCELPEVLKLACSNTFTNNVVLYIVTGVMGFFPLAGILFSYSR
IVSSVLNISTVGGKYKAFSTCGSHLSVVSLFYGTCLGVYLSSTWTHASETGMFASVLYTVVTPMMNPFIYSLRNRDMKRALRKLLCSMSSSQ*
425 >lcl|XP_541994.2|Plus122089041..22089973 NW_876272 olfactory receptor 7A17 OR08H06 __SEG__ Chr20 {Canis lupus familiaris} MEPGNDSQISEFLLLGLSEEPELQPLLFGLFLSMYLITIFGNLLIILAVRSDPHLHTPMYFFLANLSFVDICFTSTTVPKMLLNIQTQIKVITYKGCITQIYFFLLFTAL
DDFLLAVMAYDRLVAICHPLHYRVIMKPTCCALLVLMSWMISALNSLLQSLMVLWLSFCSEVEISHFFCELNQVVQLACSDTFLNDLVMYFAAVFLAGGPLTGILYSYSK
IVSSIQRISSAQGKYKAFSTCASHLLVVSLFYCTLIGVYLSSAATQSSHSSAVASVIYTVVTPMLNPFIYSLRNKDIKRALKRIIGVPVM*
426 >lcl|XP_541995.1|Plus1complement(22133383..22134351) NW_876272 olfactory receptor-like protein OLF4-like LOC484879 __SEG__ Chr20 {Canis lupus familiaris} MEPGNLTEVSEFLLLGFSEGPELQPLIFGFFLSMYLITVFGNLLLILAVSSDSHLHTPMYFFLANLSFVDICFTSTTIPKMLMNIQTERKVITYADCITQMYFFLLFAGL
DNYILTVMAYDRFLAICHPLHYTVIMNPQICGLLVLVSWIMSALHSLLQTSVVLRLSFCTEVEIPHFFCEIKQLVQLACSDTFLNDMVMYFGAGLLGGGPLAGILYSYSK
IISSIFGISSAQGKYKAFSTCASHLSVVSLFYCTSLGVYLSSAAPQTSHLSATASVMYTVVTPMLNPFIYSLRNKGIKRALKRFFGKQSIKGPFFLGLKKYT*
427 >lcl|XP_541996.3|Plus1complement(22143818..22144786) NW_876272 olfactory receptor 7A17 OR7A17 __SEG__ Chr20 {Canis lupus familiaris} MKPANATRMSEFLLLGFSEEPELQPLIFGLFLSMYLITVFGNLLIILAISSESHLHTPMYFFLANLSLVDICFTSTTVPKMLWNIQTQSKVITYAGCITQMYFFIIFSGL
DIYLLAVMAYDRFVAICQPLHYMAIMNTRLCGLLVLVSWTTSVLHSLLQTSMVLRLSFCTEVEIPHFFCELNQMIQLACSDTFLNNVVMYFAAMLLAGGPLTGILYSYSK
IVSSICRISSAQGKYKAFSTCASHLSVVSLFFCTSLGVYLSSAATQSSHASAVASVMYTVFTPMLNPFIYSLRNNDIKTALKRIIGAPVILGLKLCPRLQGS*
428 >lcl|XP_542000.3|Plus122342745..22343677 NW_876272 olfactory receptor 7A17 OR01C09 __SEG__ Chr20 {Canis lupus familiaris} MEPGNDTQIPEFLLLGLSEESELQPLLFGLFLSMYLITVFGNLLIILAVTSDPHLHTPMYFFLANLSFVDICSISTTVPKMLQNIQTQSKVITYAGCVTQIYFFLLFAGW
DDFLLAVMAYDRFVAICHPLHYTVIINSQLCVLLVLVSWIISVLHSLLESLMVLQLSFCREVEISHFFCEINQVVRLACSNTFLNDMLMYLAAVLLAGGPLAGIIYSYFK
IVSSILRISSAQGKYKAFSTCTSHLSVVFLFYCTILGVYLSSAVPQSSHSSALASVMYTVVTPMLNPFIYSLRNRDIKRALKRIFGVPVM*
429 >lcl|XP_542001.3|Plus122361586..22362533 NW_876272 olfactory receptor OR10A12 __SEG__ Chr20 {Canis lupus familiaris} MGQGNDTEISEFLLLGLSEEPELQPLLFGLFLSMYLITIFGNLLIILAVSCDPHLHTPMYFFLTNLSFVDICFTSTTVPKMLQNIQTQSKVITYAGCVTQIYFFILFAVS
DFFVLSVMAYDRFVAICYPLHYTVIMNSRLCGLLVLVSWIMCILNSLLQSLMMLRLSFCTHFQIPHFFCELNQMIQLACSDTFLNNMVMYFAAVLLGGGPFAGILYSYSK
IVSTICGISSALGKYKAFSTCASHLSVVSLFYCTILGVYLSSAAPQSSHSSAVASVMYTVVTPMLNPFIYSLRNRDIKKALRAFLVKETLHGQLS*
430 >lcl|XP_542002.2|Plus1complement(22382532..22383461) NW_876272 olfactory receptor OR08D04 __SEG__ Chr20 {Canis lupus familiaris} MELENDTRISEFLLLGFSEKPELQPFLFGLFLSLYLVTIFGNLLIILVFSSDSHLHTPMYFFLANLSFVDICFTSTTIPKLLVNIQTQRKVITYKSCIMQMYFFILFIGL
DNFLLTVMAYDRFMAICHPLHYTVIMNPRLCALLVLVSWIISALHSLLESLMVLQLSFCTALEIPHFFCELNQMIQLACSDTFLNDLVMYCATVLLVGAPLAGVLYSYSK
ILSSIRGISSAQGKHKAFSTCASHLSVVSLFYCTGLGVYLSSDAPQSSHSSAAASMMYTVVTPMLNPFIYSLRNKDIKEALTVFFRGKP*
431 >lcl|XP_542004.3|Plus122435459..22436427 NW_876272 olfactory receptor 7A17-like LOC484888 __SEG__ Chr20 {Canis lupus familiaris} MEPGNLTGDSEFLLLGFSEELELQPLVFGLFLSMYLITVFGNLLLILAVSSDSHLHTPMYFFLTNLSFVDICFTSTTVPKMLWNIQTQSKVITYEGCISQIYFFILFAGL
DVLLLTVMAYDRFVAICHPLHYMVIMNPQLCGQLVLMSWIISILHSLLESLMVLRLSFCTKLEIPHFFCELNQMIQLACSDTFLNNMVMYFAAVLLAGGPFVGILFSYSK
IVSSIHRISSAQGKYKAFSTCASHLSVVSLFYCTILGVYLSSAATQSSHSSAVASVMYTVVTPLMNPFIYSLRNRDIKEALMRFSGMPALKRPIVLGLKKCP*
432 >lcl|XP_542007.3|Plus1complement(22465268..22466200) NW_876272 olfactory receptor 7A17 OR08D07 __SEG__ Chr20 {Canis lupus familiaris} MEQGNYTQISAFLLLGLSEEPDLQPLLFGLFLSMYLITVFGNLFIILAVSSDSHLHTPMYFFLANLSFVDICFTSTTVPKMLQNIQTQSKVITYEGCITQIYFFLLLAGL
DNFLLAVMAYDRFLAICHPLHYTVIMKPQLCVLLVLVAWMMSALNSLLQSLMVLWLSFCREVKVSHFFCEINQVVQLACSDNFLNDKVMHFAAGLLGGSSLAGILYSYSK
IVSSIHRISSAQGKYKAFSTCASHLSVVSLFYCTILGVYLSSAAPQSSHSSAVASVMYTVVTPMLNPFIYSLRNRDIKRALKRIIGAPVI*
433 >lcl|XP_542009.1|Plus122499423..22500355 NW_876272 olfactory receptor 7A10 OR12C09 __SEG__ Chr20 {Canis lupus familiaris} MELSNDTKISEFLLLGFSEEPELQPLIFGFFLSMYLITVFGNLLIILAVSSDSHLHTPMYFFLTNLSFVDICFTSTTMPKMLQNMRTQSKVISFAGCISQMYFFLLCALL
DDFVLSVMAYDRFVAICHPLRYTVIMNPQICGLLVLVSWIISVLNSMTQSLMVLQLSFCTDMEIHHFFCELNQIVGNACSDTFLNDMVMYLAIVLLGGVPLAGIMYSYSK
IVSTICRISSAQGKYKAFSTCASHLSVVSLFYGTSLGVYLSSAAPLNSHSSAVASVMYTVVTPMLNPFIYSLRNRDIKRALKRIIGIPVM*
434 >lcl|XP_542010.3|Plus122532040..22532972 NW_876272 olfactory receptor 7A10 OR4B10 __SEG__ Chr20 {Canis lupus familiaris} MEADNDTGISEFLLLGLSEEPELQPLLFGMFLSMYLITVFGNLLIILAVRSDPHLHTPMYFFLANLSFVDICFTSTTVPKMLLNIQTQGKVITYAGCITQIYFFLLFADW
DDFLLAVMAYDRFLAICHPLRYTVIMDPWLCGLLVLVSWIMSTLNSLLQSLMVLRLSFCAEVEIPHFFCELNQVVGHACSDTFLNNIVIYFAAVLLGGAPLTGIIYSYSK
IVSSILRISAAQGKYKAFSTCASHLSVVSLFYGTSLGVYLSSAANHSSYKSAVASVMYTVVTPMLNPFIYSLRNRDIKRALRRITGVPVI*
435 >lcl|XP_542076.1|Plus125680489..25681547 NW_876272 sphingosine 1-phosphate receptor 2 S1PR2 __SEG__ Chr20 {Canis lupus familiaris} MGNLYSEYLSPNKVREHYNYTKETLDTQETASRQAALVIIIILCFAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDMLTGVAFVANTLLSGPVTLGLTPIQWFAREG
SAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISVALGGLPILGWNCLGHLEACSTVLPLYTKHYVLCVVTIFSVILLAIVALYVRIYCVVRSSQ
ADVAGPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVRSCPILYKAHYFFAFATLNSLLNPVIYTWRSRDLRREVLRPLQCCKQAAGVQGRRGGTPGHQLLPLRSS
SSLERGTHMPTSPMFLEDNTIV*
436 >lcl|XP_542090.3|Plus126245999..26246928 NW_876272 olfactory receptor 7E24 LOC484972 __SEG__ Chr20 {Canis lupus familiaris} MEPQNLTSVSEFLLLGLSDDPELQPLLFGLLLTMYLVTVLGNLLIILAVSSDSHLHTPMYFFLSNLSLADIGFSTTTVPKMLVNIQTHSKYITYAGCLTQMSFYFLFGCL
DNLLLAVMAYDRFVAICHPLNYPIIMNPRLCGLLVLLSFFSSLLESQIHCLMVSQLTFCTDVEIHHFFCDAPQLLHLACSYTSINTILIYFIGAIFGGIPLSGILCSYSR
IASSILRVPTTGGKYKAFSTCGSHLSVVCLFYGTGLGVYLGSSISPSPGKDAVASVVYTVVIPMLNPFIYSLRNRDIKRALWGIISITA*
437 >lcl|XP_542091.2|Plus1complement(26277926..26278864) NW_876272 olfactory receptor 7D4-like LOC484973 __SEG__ Chr20 {Canis lupus familiaris} MGAGNQTEVSVFLLLGFSEDPELQPLLFGLFLSMFLVTVLGNLLIILAILSDSHLHTPMYFFLSNLSFVDICFISTTVPKMLLNIQVHSKDISYIGCITQVYFFMIFAGM
DDFLLTVMAYDRFVAICHPLHYTIIMNPRLCVLLVLICWLTIFWVSLIHILMVGQLTFCTGTELPHFFCELAQILKVACSDTLINNICLYVATALLCVFPLTGILFSYSQ
IVSSLMRMSSTEGKYKAFSTCGSHLSVVSLFYGTSLGVYLTSAVTHSSQRSSVASVMYTVVTPMLNPFIYSLRNKDVKGALRRLLNRAASCP*
438 >lcl|XP_542092.3|Plus126312335..26313273 NW_876272 olfactory receptor 7A10 OR08H09 __SEG__ Chr20 {Canis lupus familiaris} MEAGNQTAVLKFILLGLSEDVDLQPLLFGLFLYMYLVCVIGNLLIILAISLHSNLHTPMYFFLSNLSLSDIGFTSTTVLTMLVNIQTRTNTITYEGCLTQMYFFMIFAGL
DNLLLTVMAYDRFVAICHPLHYTVIMNPRLCVLLLLLSWLICLTYSLLQSLMVLRVSFCKETEIPHFFCELTQILKLACSDTLINDILLYFVSGLLGVIPLTGILFSYSK
IISCIMGISSVAGKYKAFSTCGSHLLVVSLFYGVGLGVYLTSGTTHPSRKGSIASVMYTVVTPMLNPFIYSLRNRDMKGALRRLFRSGAYSP*
439 >lcl|XP_542099.2|Plus126407762..26408790 NW_876272 olfactory receptor 7G1 OR08C06 __SEG__ Chr20 {Canis lupus familiaris} MVFASSDALPAGLGNTHLIDSIFSIRFINNMEPRNDTHVSDFLLMRVTENPELQFPLFILFVSMYLVTILGNLLIILAVIYDSHLHTPMYFFLSNLSINDICLSTTTIPK
MLVNIQTQNQSITYTGCLAQICFVLIFASLESSLLAVMAYDRYVAICHPLRYTVIMNSHLCGLLILLPLFIIIVDALMHSLMVLHLSFCTELEIPLFFCEVVQVIKIACS
DTLINNILIYFATSVFGGIPLCGIIFSYTKIVSSVLRMPSAGTKYKAFSTCGSHLSVVSLFYGTGLGVYISSALTSSSRNTAVVSMMYTVVPQMMNPFIYSLRNRDMKGA
LRKLISRMPSLL*
440 >lcl|XP_542101.2|Plus1complement(26453902..26454918) NW_876272 olfactory receptor 7G1 OR7G2 __SEG__ Chr20 {Canis lupus familiaris} MLLWLIQGPFILFGFHSIFSIRFINNMGPKNQTVFSEFFLLGLTEDPELQSLLFSLFLSIYLATILGNGLIILAVICDSHLHTPMYFFLSNLSFTDICLSTTTIPKMLVN
IQAQSHSISYTGCLTQVCFVLTFVGLENFLLAAMAYDRYVAICHPLRYTVIMNPQLYGLLMVLSLLISIVNALLHSLMVLQLSFCKDVDIPHFFCELGQIVKLACSDTLI
NDILAYFAAGLFGGVPLSGIIFSYTQIFSSVLRMPSAGRKYKAFSTCGSHLSVVSFFYGTAFGVYISSALSDSSRKTAMASVMYIVIPQMMNPFIYSLRNSDMQGALKKL
FSRIPSFL*
441 >lcl|XP_542104.1|Plus126514775..26515716 NW_876272 olfactory receptor 24 OR08F07 __SEG__ Chr20 {Canis lupus familiaris} MESRNQSSASEFILLGLSENPEQETLLFALFPCMYVVMAMGNLSIILAISSDSHLHTPMYFFLANLSLVDFGLATNTVPKMLVNIQMKSKSISYPCCLTQMYFFHFFGIV
DSVLIAVMAYDRFVAICHPLHYTTIMSPHLCGLLAGSPWVFSYFISLTHILLMVRLVFCGNNKIPHYFCDLTPLLRLSCTDTSVNKIFVLIVAGMVIATPFICILASYAR
IIVAIMKVPSAGGRKKAFSTCSSHLSVVALLYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALRKLFSKKIISSS*
442 >lcl|XP_542105.3|Plus126538867..26539808 NW_876272 olfactory receptor 24 OR1M1 __SEG__ Chr20 {Canis lupus familiaris} MEPRNQTSASEFILLGLSENPEQETLLFALFLCMYVVTVVGNLLIILAISSDSYLHTPMYFFLANLSLVDFCLATDTVPKMLVNIQIRSKSISYACCLTQMYFFHFFGIM
DSVLIAVMAYDRFVAICHPLHYTTIMSPRLCGLLAGGPWVFSCFISLTHILLMARLVFCGSNELPHYFCDLTPLLRLSCTDTSVNKIFVLIVAGMVIATPFICILASYAR
IIVAIMKVPSAGGRKKAFSTCSSHLSVVALFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALRKLVNRKITSSS*
443 >lcl|XP_542132.2|Plus128012306..28013247 NW_876272 olfactory receptor 2Z1 OR2Z1 __SEG__ Chr20 {Canis lupus familiaris} MGDVNQSVTSDFVLVGLFSHSGSRQLLFSLVAATFTMGLLGNTILLFVIRTDSRLHTPMYFLLSQLSLFDVGFPLVTIPKMASDFLQGDGSISFGGCAAQIFFLTLMGVA
EGILLALMSYDRYVAVCHPLQYPVLMRRQVCLLMVGSSWLAGVLNASVQTSITLHFPYCASRIVDHFFCEVPALLKLSCADTSAYELALSTSGVLILVLPLFLIATSYGH
VLGAVIRMHSEEARNKAFTTCSSHITVVGLFYGAAVFMYMVPGAYHSPHQDNVVSLFYSLVTPTLNPLIYSLRNREVRMALVKVLSRTGLRPK*
444 >lcl|XP_542296.2|Plus1complement(21919101..21920174) NW_876273 tsukushin TSKU __SEG__ Chr21 {Canis lupus familiaris} MLWPLLLPPLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIVPVPIPLDTAHLDLSSNRLETVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSR
LRYLESLDISHNGLAALPAESFTCSPLSDVNLSHNRLREVSVSAFSTHSQGRALHVDLSHNLIHRLVPHPAGASLPTPTIQSLNLAWNRLRTIPDLRDLPLRYLSLDGNP
LAAVGPGAFRGLAGLTHLSLGSLQGLPQLAPYGFRELQSLQVLDLSGNPKLKWAGAEVFSGLGSLQELDLSGTSLLPLPETLLIHLPALQSISVGQGMRCQRLVREGAYP
RQPGSSPKVALHCRDARGSAAERPNTL*
445 >lcl|XP_542320.1|Plus1complement(24932633..24933610) NW_876273 P2Y purinoceptor 6 P2RY6 __SEG__ Chr21 {Canis lupus familiaris} MEWDNGTGQALGSPPTTCVYRENFKRLLLPPVYSVVLAAGLPLNACVIAQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDLACRLVRFLFYANL
HGSILFLTCISFQRYLGICYPLAPWHKRGGRRAAWLVCGAVWLAVTTQCLPTALFASTGIQRNRTVCYDLSAPALATRYMPYGMALTVIGFLLPFIALLACYCRLAHRLC
RQDGPAGPVAQERRGKAARMAMVVAAAFAISFLPFHVTKTAYLAVRSTPGVPCPVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQR*
446 >lcl|XP_542321.2|Plus1complement(24997775..24998908) NW_876273 P2Y purinoceptor 2 P2RY2 __SEG__ Chr21 {Canis lupus familiaris} MATGLDHWNSTINDTWDGDELGYKCRFNEDFKYVLLPVSYGVVCVLGLCLNAVALYIFLCRLKTWNASTTYMFHLAVSDALYAASLPLLVYYYSRGDHWPFSMVLCKLVR
FLFYTNLYCSILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAAAVWVLVLACQSPVLYFVTTSVRGSRITCHDTSAPELFGQFVAYSSVMLGLLFAAPFAVILVCYAL
MARRLLKPAYGASGGLPRAKRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHALNAVNVAYKITRPLASANSCLDPVLYFLAGQRLVRFARDAKPPTDPTPTA
PARRRRGLHRWDRTDVKRIKDVSTSSEDSRRTESTPAGGESSKDVRL*
447 >lcl|XP_542341.1|Plus1complement(26726410..26727372) NW_876273 olfactory receptor 52B4 OR52B4 __SEG__ Chr21 {Canis lupus familiaris} MTALNHTAVSHTVFHLLGIPGLEDQHMWISIPFFISYVIALLGNSLLICIILTKRSLHEPMYLFLCMLAGADIVLSTCTVPQALAIFWFHAGEISLDRCITQLFFIHTTF
ISESGILLVMAFDRYIAICYPLRYTTILTGALIGKIGVTIFLRSYGTIFPIIFLLKRLTFCQNNIIPHTYCEHIGLAKYACNDIYANIWYGFSILMLTVVLDVVLIFVSY
VMILRAVFCIPSRDARHKALNTCGSHVCIIILFYGPGIFTILTQRFGCHIPPHTHILLANVCMLAPPMLNPIIYGIKTKQIREQVVHVLFTRQKSLWFRN*
448 >lcl|XP_542345.3|Plus126802537..26803523 NW_876273 olfactory receptor 51L1 cOR51R2 __SEG__ Chr21 {Canis lupus familiaris} MQSGQLPPGITMFSCNTSTSGHSTFLLTGFPGLEASHHWVSIPVNLTCVVSILGNSIILLLIRTDPALHEPMYFFLSMLAASDLGLSASTFPTMMWLFWLNARELPFDIC
AAQMFFIHAFTYVESGVLLAMAFDRFVAIREPLHYATILTHSAMARMGAAILVRAVLLNLPGPILLRRLLFPQISVLSHCYCLHCDLVGLACSDTQINSLVGLVSILFSL
GLDSFLIVLSYALILRTVVSIASPGERLKALNTCVSHLCIVLIFYLPKLGLSVLHRVEKHNYPALAVLMANLHFLVPPFMNPIVYCIKSKQIRQGLLKRFKRKRVDVS*
449 >lcl|XP_542346.1|Plus1complement(26825248..26826195) NW_876273 putative olfactory receptor 52P1 cOR52P2P __SEG__ Chr21 {Canis lupus familiaris} MQFTNYSQQNPNSFLLMGIPGLEASHFWIAFPFCSMYALAVFGNMAVLLVVRSEPALHQPMYLFLCMLSIIDLVLCTSTVPKLLALFWTNDTEINFGACATQMFFIHGFS
AVESGILLAMAFDRYLAICQPLHYGSLLPPEAVGKLAAAAVFRGLGLMTPLTCLLARLSYCSRVVAHSYCEHMAVVKLACGGTRPNNIYGITAATLVVGTDSICIAVSYA
LILRAVLGLSSKEARAKTFGTCGSHLGVILLFYTPGLFSFYTQRFGQHVPRHIHILLADLYLVVPPMLNPIIYGMKTKQIRVGALRLLKRGIVQS*
450 >lcl|XP_542347.3|Plus126853169..26854113 NW_876273 olfactory receptor 52K1 isoform 1 cOR52K5 __SEG__ Chr21 {Canis lupus familiaris} MSASNISSTYPALFMLMGIPGLEHLHNWISIPFCFAYTLALLGNCTLLFIIQADAALHEPMYFFLAMLAAIDLVLSSTTLPKMLAIFWFRDREISFYGCLVQMFFLHSFS
IMESAVLLAMAFDRYVAICKPLHYTTVLTRPLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGTMIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLASQEARYKAFGTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILFANFYLLFPPMINPIIYGVKTKQIRERVLGLFQRKDA*
451 >lcl|XP_542348.1|Plus126872073..26873017 NW_876273 olfactory receptor 52K1 cOR52K6 __SEG__ Chr21 {Canis lupus familiaris} MTVFNITTTHPASFLLVGIPGLEQLHVWISIPFCFAYTLALLGNCTLLFIIQADAALHEPMYFFLAMLAAIDLVLSSTTLPKMLAIFWFRDREISFYGCLVQMFFLHSFS
IMESAVLLAMAFDRYVAICKPLHYTTVLTRPLITKIGMAAVARAVTLMTPLPFLLRRFHYCRGTMIAHCYCEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSY
IFILRAVLQLASQEARYKAFGTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMINPIIYGVKTKQIRDHVLNLFQRKKV*
452 >lcl|XP_542349.1|Plus1complement(26894935..26895888) NW_876273 olfactory receptor 52M1 cOR52M5 __SEG__ Chr21 {Canis lupus familiaris} MFMSNNACLVPSSFWLTGIPGLQSLHIWLSIPFSSMYLMAIVGNVTILAVIKVERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFGAHNIDLDACLAQMFFIHCFA
TVESGIFLAMAFDRYVAICDPLRHTLVLTHAAVGRLGLAALFRGVLYIGPLPLMIRLRLPHYQTQIIAHSYCEHMAIVTLACGDTTVNNLYGMGIGFLVLILDSLAITAS
YVMIFRAVMGLATPEARLKTLGTCSSHICAILVFYIPIAVSSLTHRFGHHVPPHIHILLANFYLLIPPILNPVVYAVRTKQIRERLLYILKAGSQPK*
453 >lcl|XP_542353.1|Plus127029252..27030205 NW_876273 olfactory receptor 51E1-like LOC485235 __SEG__ Chr21 {Canis lupus familiaris} MVDPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYFIAVLGNLTIIYIVRTEHSLHEPMYVFLCMLSGLDILISTSSMPKMMAIFWFNSTTIQFDACLLQMFAIHSLS
GMESTVLLAMAFDRYVAICHPLRHATVLTLPRVMKIGMAAVVRGTALMAPLPVFIKRLPFCHSNILSHSYCLHQDVMKLACADIRVNIIYGLIVIISAIGLDSLLISLSY
LLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFGKRHDSFLPIIMANTYLLVPPVLNPIVYGVKTKEIWQRILRLFHVTNHTSDL*
454 >lcl|XP_542355.2|Plus1complement(27062854..27063816) NW_876273 olfactory receptor 51I2 cOR51A17 __SEG__ Chr21 {Canis lupus familiaris} MLLSHSYVNISFFQPHAFLMIGIPGLEAVHGWISIPFSFMYTVALTGNCLILLAVRRTPSLHQPMYYFLSMLALTDVGLTLSTLPTTLAVLWFDYRHIGFNACLVQMFFL
HSFSVVESSVLLAMSFDRFVAISNPLRYAATLTNNVIIRIGLAIMARATVSLFPGPFLLKRLNFCPDKILLSHSFCFHADVMKRACADITVNILYGLYVVLSTVGVDSLF
IVLSYTLILHTVMGLASPRERVRALNTCVSHILAVLIFYIPVIGVSMIHRFGRHLPHIVHALVAYVYLVVPPVLNPIIYSVKSKPIREAMLRLLRKKRKG*
455 >lcl|XP_542364.3|Plus128143710..28144660 NW_876273 olfactory receptor 52A5 cOR52A12 __SEG__ Chr21 {Canis lupus familiaris} MSKLNGTIFMPPVLTLIGIPGLESVQFWIGIPFCAMYIIALFGNSLLLVIIKSERSLHEPMYLFLAMLGVTDIALSTCILPKMLGIFWFHLPDIYFDACLFQMWLIHTFQ
SIEIGILFAMALYRYVAICDPLRHASIFTHKLLTQIGVGVTLRAALLVAPCLILIKCRLKHFRTTVVSHSYCEHMAIVKLAAEDIRVNKIYGLFVAFTILGFDIIFITLS
YIRIFITVFNLPQREARLKAFNTCIAHICVFLEFYLLGFFSFFTHRFGFHIPPYIHILLSNLYLLVPPLLNPIVYGVKTKQIRDRVSKVFHSKDSS*
456 >lcl|XP_542365.2|Plus1complement(28151674..28152627) NW_876273 putative olfactory receptor 52P1 cOR52AE1 __SEG__ Chr21 {Canis lupus familiaris} MADNATHSYISSFFLVGIPGLQAFHCWIGIPVCLLFALALLGNSVIIITIKIEPSLHLPVYFFLCMLAVNDMALVSSTAPKMLGIFWLDAHKFDFSICLAQMYFIHTFCI
IESALLVAMAFDRYVAICIPLRYTTILTTPMVTKMGLAGVIRATFMVLPCPLLIKRLPYYTKYVINHAYCEHMAVVKLASANTLINRAYGISVALSVMVLDLGLIATSYI
KILQAVFRLSSQNARSKALGTCAAHVCTLLGFYTPALFSFLTHRIGKKVPSSIHIIFASLYLLVPPTVNPLVYGVKTKQIRDRVVSLFLSNKIISGN*
457 >lcl|XP_542367.3|Plus128177437..28178378 NW_876273 olfactory receptor 51V1 cOR51X4 __SEG__ Chr21 {Canis lupus familiaris} MSVQSVSKVNNFTFLLTGFPGLEQEYPWLSIPFSCIYAMVLSGNCLVLHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGILWGLSQEIGLDACIAQTFFVHGLS
CMESGVLLAMAFDRFTAICNPLRYTSILTNTRIINMGMAIVGRSFLFITAPIVRLKFFHYCRPHILSHSFCLHQDLLRLACSDIRFNSFYALALVICTLLLDSVLILISY
VLILHSVLTIASREERFKSLQTCVSHICAVLVFYIPIIGLTMVHRFGKHLSPVVHVLMGNIYILFPPLMNPIIYSVKTQQIRSRFQRWFTKQN*
458 >lcl|XP_542370.2|Plus1complement(28240716..28241675) NW_876273 olfactory receptor 52Z1 cOR52Z3 __SEG__ Chr21 {Canis lupus familiaris} MAPFSYNHTNTQDMWYVLIGIPGLEDSHPWISIPICSMYVLAVIGNSFLIFLIVTERSLHEPMYFFLSMLALADVLLSTATAPKMLAIFWFQSMDISFGSCVSQMFFIHF
IFVAESAILLAMAFDRYVAICHPLRYTTILTSSATGKIGIAAVVRSFFICLPFIFLVYRLRYCGRNIIPHSYCEHMGIARLACDSIKVNIIYGLTVALLSTGLDIVFIIM
SYTMILCTVFQIPSWAARFKALNTCASHICVILMFYAPAFFSFFAHRFGGKTIPHHIHILVANLYVVVPPMLNPIIYGVKTKQIQDRVTLLFSFISTCC*
459 >lcl|XP_542379.1|Plus128434018..28435010 NW_876273 olfactory receptor 51M1 OR51M1 __SEG__ Chr21 {Canis lupus familiaris} MPAQYPLSPQFMLLSNITQFSPMLYLTGFPGLETIEHWIFIPFFLMYLVAISGNCFILIIIKTNHRLHTPMYYLLSFLAFTDLGLSVSTLPTTMGIFWFKSRGIYFSACQ
IQMFCIHSFSFMESSVLLIMSFDRCLAICHPLRYSVIITSQRVVRAGLAVIFRGPVALVPLVVLLKTFPYCGPRVLSHSFCLHQEVIHLACTDTSFNNLYGLAVVVFTMM
LDLVLIALSYGVILRTVARLASQEEQLRAFQTCTSHLCAVLIFFVPMVGLSLVHRFGKHVPLAVHLLMANVYLFVPPMLNPIIYSIKTKEIRHVISKLLGLRKVSAESWG
*
460 >lcl|XP_542381.1|Plus128452541..28453476 NW_876273 olfactory receptor 51I2 cOR51K2 __SEG__ Chr21 {Canis lupus familiaris} MFNSSQFNPKYFLLTGLPGLEALYPWFIVPFCSIYLVALVGNSLVLAVIRKNTTLHQPMYLFLAMLAFAELGVSASTLPTVLGIFLFGANEICFEACLLQMFSIHCFSIM
ESGVLLAMSVDRFVAIYNPLRYTAILTRPRIAATGAALGLKSVMLMFPLPFLLKRLPFCGHNVLSHSYCLHSDLIQLPCGDTRPNSILGLCIVTSTFGLDSLLIILSYVL
ILYTVLGITSGEGRCKALNTCVSHMCAVLVYYVPMISVALVHRFMKHTAPALRLLLANIYLLVPPVLNPIIYSVKTKQIRQGLIQLFLPRK*
461 >lcl|XP_542382.2|Plus128464870..28465823 NW_876273 olfactory receptor 51J1 cOR51J3 __SEG__ Chr21 {Canis lupus familiaris} MKNSNSSLESLPTTFILVGIPGLEAEHIWISIPFCLMYIIIFLGNGTILHVIRTDPALHQPMYLFLAMLALAEVGVSATTLPTVLGIFLFGTTEINFDACLFQMFFIHSF
SIMESAVLLAMSVDRFVAIHNPLRYTAILTLPRIFGTGMIMGLKSIILMAPLPMLLRHLPFCGHNVLAHSYCLHPNLIHLPCGDVSINNIYGLFIVTSTFGLDSLLIVIS
YRLILHTVLSITTGKGRRKALNTCGSHICAVLTYYVPMIGLSMVHRLGFHVSPLVHAMMANAYLFFPPVVNPIVYSIKTKEIHCGIVRMLSQKKARI*
462 >lcl|XP_542383.2|Plus128479919..28480866 NW_876273 olfactory receptor 51Q1 OR51Q1 __SEG__ Chr21 {Canis lupus familiaris} MPEVTNTTQAPFYFILTGIPGFEAFHIWISIPFCCLYTISIVGNTTILAVIRTEPSLHQPMYLFLSMLALTDLGLTLTTLPTVMQLLWFNIPKISFEACFAQFFFLHGFS
FMESSVLLAMSFDRYVAICRPLHYDTILTSEVIGRIGLAIIGRCILAVLPSLFLLKRLPFCHSHLLSHSYCLHQDMIRLVCADIRVNSWYGFALVLLIIVMDPLLIILSY
TFILKNILGTASWTERLRALNNCLSHILAVLVLYVPMIGVSMTHRFAKHASPLVHVIMANVYLLAPPVMNPIIYSVKTKQIRQGIFHVLFQRKVY*
463 >lcl|XP_542385.1|Plus1complement(28496247..28497191) NW_876273 olfactory receptor 51I2 cOR51K1P __SEG__ Chr21 {Canis lupus familiaris} MGAESNESLDVLSVFLTGIPGLESQHGWLSIPFSTMYVVAIVGNSLIMIAVQEDPVLHEPMYLFLSMLAVTEVGVSVSTLPTVMGILWFDAHQIDFDGCLAQMFFIHTFS
CMESGVLLAMSYDRFVAIYNPLRYTAILTLPRIICMGLGITLKSVTLMAPLPILLKQLPYCHTNVLSHSYCLHSDLIQLPCADTKLNSILGLAIVLATFGLDSLLIVVSY
VLILYTVLGIASEEGRWKALNTCVSHMCAVLVYYVPMIGVSVMHRAAKHASPLVHTLMSSIYLFVPPVLNPIIYSVKTKPIRQGIFTLFSCKRK*
464 >lcl|XP_542387.3|Plus128524536..28525474 NW_876273 olfactory receptor 51I2 OR51I2 __SEG__ Chr21 {Canis lupus familiaris} MGLFNVSHPASFLLTGIPGLESSHSWLAGPLCVMYAVALGGNTVILQAVRVEPSLHEPMYYFLSMLSFSDVAMSMATLPTVLRTFCLNARSIAFDACLIQMFLIHSFSMM
ESGILLAMSFDRYVAICDPLHYATVLTNGVIAGIGVAVTARSFITLFPLPFLFKRLPVCRSNVLSHSYCLHPDMMKLACADITINSIYGFFVLISTFGMDMFFIFLSYVL
ILRSVMAIASRKERLKALNTCVSHILVVLAFYVPMIGVSVVHRFGEHAPRYIHVFMSNVYLFVPPVLNPLIYSAKTKEIRRAIVRMFHRIKM*
465 >lcl|XP_542388.3|Plus128560793..28561734 NW_876273 olfactory receptor 52H1-like LOC485270 __SEG__ Chr21 {Canis lupus familiaris} MYNLSSYNTGDFTLLGIPGLEQYHVWISIPFCFIYLVAIVGNSILLYLIAVERSLHAPMFFFLSMLAITDVILSTTCVPKSLTVFWLGPQKISFPGCLTQLFFLHYSFVL
DSAILLAMAFDRYVAICFPLRYTAILTSRTTVKIVVGISFRSFCIFAPCVFLVNRLPFCGTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIAVSYTL
ILCAVFRLPSQDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYVVMPPALNPIVYGVKTKSIWDKVVLLLFPRGTQ*
466 >lcl|XP_542394.2|Plus128681094..28682041 NW_876273 olfactory receptor 51I2-like LOC485276 __SEG__ Chr21 {Canis lupus familiaris} MGAFGINASDAPTFILTGFPGMESMESWLSFPLFLFYAVSIVGNTLILLIVKEEQSLHQPMYYFLSLLSINDLGVSFSTLPTVLAALCFHARVISFNACLAQMFFIHLFS
WTESGILLAMSFDRYVAICNPLRYATVLTNACIVAMGLCIVLRSFALILVFPLLLHRLPFCHPQNILSHAYCLHVDMIKLACTDVSLNSHYGLSIVLFTFGLDSALIFIS
YVLILRSVIAIASREELIKTLNTCVSHILAVLIFYVLMVCVSIVHRFGAGLPHAVHILMSILYLFVPPMLNPIIYSIKTKEIRRRLFKMLFRLKS*
467 >lcl|XP_542397.2|Plus1complement(28735878..28736825) NW_876273 olfactory receptor 52H1-like LOC485279 __SEG__ Chr21 {Canis lupus familiaris} MYNLSSYNTGDFTLLGIPGLEQYHVWISIPFCFIYLVAIVGNSILLYLIAVERSLHAPMFFFLSMLAITDVILSTTCVPKTLTIFWLGPQKISFPGCLTQLFFLHYSFVL
DSAILLAMAFDRYVAICSPLRYTTILNPRTTVKIVVGISFRSFCVIVPCVFLANRLPFCGTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIAVSYTL
ILCVVFRLPSLDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYVVMPPALNPIVYGVKTKQIRDKVILLLFPQKVAVI*
468 >lcl|XP_542399.3|Plus1complement(28769868..28770818) NW_876273 olfactory receptor 52H1 cOR52H4 __SEG__ Chr21 {Canis lupus familiaris} MMSTLNLTSVNPSVFMLVGIPGLEQFHIWIGIPFFVIYLVALVGNGILLYLITMDHNLHEPMFFFLSMLASADLILCTTCMPKTLGIFWLKSQKITFPGCLTQLFFLHFS
FFLDSAILLGMAFDRYMAICSPLRYRSVLTPRTIVKIMVGIVGRSFSVILPVVFLVKRLPFCRTRIIPHTYCEHIGVARLACADISINIWYGFAVPVMTIISDLILIGIS
YSLILHAVFHLPSRDARQKALSTCGSHVSVILIFYTPAMFSVLTHRFGHNISLTFHIMFANLYVAIPPALNPIIYGVKTKQIRDKIILLFFPKGMQ*
469 >lcl|XP_542403.2|Plus128909906..28910847 NW_876273 olfactory receptor 52H1 cOR52H9 __SEG__ Chr21 {Canis lupus familiaris} MYNLSCYDPGSFILVGIPGLEKFHIWIGIPFCVIYVLALVGNCTLLYLIAVEHSLHEPMFFFLAMLATTDLILSTATVPKLLTNLWLHSQEITFSGCLTQMFFLHFSFVV
DSAILLAMAFDRYVAICFPLRYTTILTPQVIIKLAASIVVRSFSVILPDVFLLKRLPFCGTRIIPHTYCEHIGVARLASADISINIWYGFSVPLMTVISDVIIIAVSYTF
ILRAVFQLSSQGARQKALSTCGSHVCVILMFYTPAFFSILAHRFGHSVPRNVLILFANLYVAIPPALNPIVYGVKTKQIQDKFILLFSLKKTQ*
470 >lcl|XP_542404.1|Plus128921737..28922684 NW_876273 olfactory receptor 52H1 cOR52H7 __SEG__ Chr21 {Canis lupus familiaris} MVATFNLSSFNPGPFILLGIPGLEEFHVWIGILFFIIYLVALAGNSILLYLISMERTLHEPMFFFLSMLAATDVILSNTCVPKTFSIFWLGPQEITFPACLTQMFFLHYS
FAMDSAILLAMAFDRYVAICFPLRYTNILTRQIITKIVVAIVSRSFCIIFPCVFLLKRLPFCRTLFIPHTYCEHIGIAQLACADISINIWYGLAVPIMTVTSDLILIGIS
YGLILRAVFNLPSRDARKKALNTCGSHVCVILIFYTPAMFSVLTHRFGHNIPRSFHILTANLYVAIPPALNPIIYGVKTKQIREKIILPFFSKGN*
471 >lcl|XP_542406.3|Plus128950482..28951459 NW_876273 putative olfactory receptor 52P1-like LOC485288 __SEG__ Chr21 {Canis lupus familiaris} MTVCNVSLGHPPFFILQGIPGMEDKHRWISIPFCSMYFITILGNCTIIFIICTERSLHKPMFLLLCMLALTDLGMSTTTIPKVLCIFWFRHSEISYVGCLVQMFFIHSIS
AMQSAILMTMAFDRYVAICEPLRYATILSNSRIGLIGLVSLVRAILFILPMPVLLQKMPFHANHVIPTTYCEHMAVVKMVCVDTTVNRIYGLVVALLVAGLDISAIASSY
VLIIKAVLRLSSKEAHHKAVNTCTTHICVMLISYTPSLFSFLTHRFGRGIPLHVHTILGSLYFLVPPMLNPIIYAVKTKEFREKLIKYGYWKKELKTVTHGPKPV*
472 >lcl|XP_542408.3|Plus128974167..28975144 NW_876273 olfactory receptor 52D1-like LOC485290 __SEG__ Chr21 {Canis lupus familiaris} MTVCNVSLGHPPFFILQGIPGMEDKHRWISIPFCSMYFITILGNCTIIFIICTERSLHKPMFLLLCMLALTDLGMSTTTIPKVLCIFWFRHSEISYVGCLVQMFFIHSIS
AMQSAILMTMAFDRYVAICEPLRYATILSNSRIGLIGLVGLVRAILFILPMPVLLQKMPFHANHVIPTTYCEHMAVVKMVCVDTTVNRIYGLVVALLVAGIDISAIASSY
VLIIQAVLRLSSKEAHHKAVNTCTAHIVVMLLYYTPSLFSFLTHRFGRGIPPHVHTILGNLYFLIPPMLNPIIYAVKTKEFREKLTKYGYWMKEHIISNHGQNPF*
473 >lcl|XP_542409.3|Plus1complement(28985359..28986294) NW_876273 putative olfactory receptor 52P1 cOR52AC1 __SEG__ Chr21 {Canis lupus familiaris} MLIFNHSSFLTFTLMGIPGLESQHLWLSLPFSSMFLAILIGNGAILFLVAIEPTLHSPMYLLLALLMVADLISTLALLPKLLCLFLFNDRDIAANACFTQMFFIHGTSVV
RSALFVAMAFDRFVAVCEPLRYNTILSHSLVGRLGLLALAKGVILILPMPLLLRRLTFCQMVIPHTYCDHMAVVKMACGHTRPNRIYGLFVILLVVGLDLLLIGFSYGLI
LQSVVRLNSRDATCKALNTCSAHFFVILVTYVPALFSSLTHRIGHNIPPHAHVLLANLYLLLPSVLNPIIYGIKMKEIRHKVAKCLCRGSA*
474 >lcl|XP_542411.3|Plus129013261..29014226 NW_876273 olfactory receptor 52N4 cOR52N8 __SEG__ Chr21 {Canis lupus familiaris} MLMLNQTDLTPGSFILNGIPGLEDMHMWISFPFCSMYIVAMVGNCGLLYLIHYEDSLHRPMYYFLAMLSLTDLFICSSTIPKALSILWFHFKEISFDGCLVQMFFVHTFT
GMESGVLMLMALDRYVAICYPLHYSTALTNSVIAKAGLSTFLRGVLLIIPFTFLTKRLPYCRGNIIPHTYCDHMSVAKLSCGDIKVNVVYGLTVALLIGGFDILCITISY
TMILRAVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPAMNPVVYGVKTKQIRDCIVKILLGSKDIKSQSI*
475 >lcl|XP_542412.2|Plus129054938..29055903 NW_876273 olfactory receptor 52N4-like LOC485294 __SEG__ Chr21 {Canis lupus familiaris} MIILNKTNWTLVSFILNGVPGLEDMHVWISFPFFSMYIVAMVGNCGLLYLIYYEDSLHRPMYYFLAMLSLTDIVMCSSTIPKALCIFWFHLKDIGFNECLLQMFFIHTFT
GMESGVLMLMALDRYVAICYPLRYSTILTNHVIAKVGLATFLRGVLLIIPFTFLTKRLSYCRGNIIPHTYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITISY
TMILRAVVSLSSADARQKAFSTCTAHICAIVFSYTPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDRVIRILSGSKDIKSHGI*
476 >lcl|XP_542413.3|Plus129067576..29068541 NW_876273 olfactory receptor 52N4-like LOC485295 __SEG__ Chr21 {Canis lupus familiaris} MIILNETDVTPVSFILNGIPGLEDMHMWISFPFCSMYIVAMVGNCGLLYLICYEDSLHRSMYYFLAMLSLTDLVMCSSTIPKALCIFWFHLKKIGFEECLVQMFFIHTFT
GMESGVLMLMALDRYVAICYPLRYATILTNSVIAKVGLATFLRAVLLIIPLIFFTKRLPYCKGNIIHHTYCDQLSVAKLSCGNIKANVIYGLIAALLIGGFDILCITISY
TMILRAVVSLSSADARQKAFSTCTAHICAIVFSYSPAFFCFFFNRFGSRTIPPSCHIIVANIYLLLPPTMNPIVYGVKTKQIRDCIIKIFSGSKNIKSHST*
477 >lcl|XP_542424.2|Plus1complement(29239566..29240507) NW_876273 olfactory receptor 52E8 OR52E6 __SEG__ Chr21 {Canis lupus familiaris} MATPNDTQFHPSSFLLLGIPGLEDVHFWIGFPFFFVYLVALLGNAAVLFVIQTEHSLHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFSLRDISFESCLSQMFFIHFFT
AMESIVLVAMAFDRYIAICKPLRYTMILTSKIIIIIAGIAILRSLCMVIPLVFLLLRLPFCGHHIIPHTYCEHMGIARLACASIKVNILFGLGNISLLLLDVLLIILSYV
RILHAVFCLPSREARLKALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIFLANLYVVVPPAFNPVIYGVRTKQIRERVLRVFFRTDS*
478 >lcl|XP_542426.3|Plus129252038..29252982 NW_876273 olfactory receptor 52E8-like LOC485308 __SEG__ Chr21 {Canis lupus familiaris} MSSLNVTEFHPSSFLLLGIPGLEIAQIWLGFPFCAVYLIALIGNVIILFVIWTDHSLHQPMFYFLAMLSVIDLSLSTTTIPKMLGIFWFNLQELCFGCCVAQVFFVHFFT
VMESIVLLAMGFDRYVAICNPLRYNMILTNRVIGVIAVVVVLRSVFMIAPIIFLLLRLPYCGHRIIPHTYCEHMGVARLACASINANVYYGLGNISILFLDVFLIIISYF
KILYAVFHLSSQDARLKALNTCSSHICVIFAFFGPALFSFLTHRFGHNVPQYIHILLANLYVVIPPALNPVIYGIRTKQIQERVQSFFVEKKIE*
479 >lcl|XP_542436.3|Plus129473208..29474149 NW_876273 olfactory receptor 56A3 cOR56A20 __SEG__ Chr21 {Canis lupus familiaris} MTPHRNGSTGVSEFLLNCFVRSPTWQLWLSLPLSILFLVAMGANAVLLITIWLEASLHQPMYYLLSLLSLLDIVLCLTVIPKVLVIFWFDLKSISFDACFLQMYIINCFY
AMESCTFMVMAYDRYVAICHPLRYPSIITERFVAKAAAFILARNGIVTVTLPILSSRLNYCGRNIIENCICANLSVSKLSCDDVTINRILQFAGGWTLLGSDLILIFLSY
GLILRAVLRLKAEGAMAKALSTCGSHFILILFFSTVLLVFVLTHMMKKKVSPDVPVLLNVLHNVIPAALNPIVYGVRTQEIKQGIQRLLKKGW*
480 >lcl|XP_542438.3|Plus1complement(29496820..29497779) NW_876273 olfactory receptor 56A4 cOR56A24 __SEG__ Chr21 {Canis lupus familiaris} MIRTLYMAPPSNYSTAPVSEFFLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLITIRLEASLHEPMYYLLGLLSLLDIVLSLTVIPKVLAIFWFDLRSISFSACFLQM
FIMNSFLPMESCTFMVMAYDRYVAICHPLRYSSIITDQFVVRAAIFVVARNGLLTMPIPILSSRLRYCAENIIKNCICTNLSVSKLSCDDITFNQLYQFVAGWTLLGSDL
ILIILSYSFILKAVLRIKAEGAMAKALGTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTKDIKQGIQKLLRRL*
481 >lcl|XP_542439.2|Plus1complement(29503699..29504640) NW_876273 olfactory receptor 56A4-like LOC485321 __SEG__ Chr21 {Canis lupus familiaris} MAPPSNYSTAPVSEFLLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLITIRLEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFSACFLQMFIMNCF
LAMESCTFMVMAYDRYVAICHPLRYPSIITDQFVVRATIFIVVRNGLFFLPVPVLSSRLRYCAENIIKNCICTNLSVSKLSCDDITFNRLYQFVAGWTLLGSDLILIILS
YSFILKAVLRIKAEGATAKALSTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTNEIKQGMQKLLRRL*
482 >lcl|XP_542449.3|Plus129723763..29724725 NW_876273 olfactory receptor 52W1 OR52W1 __SEG__ Chr21 {Canis lupus familiaris} MAEGPHPNSTFPRPTFFILTGIPGLGGTQTWLTLVFGPMYLLALLGNGTLLALVQIDSTLQQPMFLLLATLAATDLGLATSIAPGLLAVMWLGPRPVPYGVCLAQMFFVH
ALTAVESGVLLAMACDRAVAVGRPLHYPLLITKARVGYAALALALKAVAIVVPFPLLVARFEYFRAKTIDHAYCAHMAVVELVVGNTQANNLYGLALSLAVSGIDILGIA
GSYGLIAHTVLRLPTWEARAKAFGTCSSHICVILAFYVPGLFSYLTHRFGRHTIPKPVHILLSNIYLLLPPALNPLIYGVRTKQIRDRLLETFTFRKSQL*
483 >lcl|XP_542459.2|Plus130282351..30283301 NW_876273 olfactory receptor 2AG1 cOR2AG1 __SEG__ Chr21 {Canis lupus familiaris} MEYWNSTLGSGFILMGILNDSGSPELLCATITVLYMLALTSNGLLLLVITVDSRLHVPMYFLLGQLSLMDLLFTSVVTPKALVDILQSENTISFGGCALQMFLALTLGGA
EDLLLAFMAYDRYVAICHPLNYMVFMRPRVCSLMVATAWILAFLSALGHTLYTMHYPFCKVRKIRHLLCEIPPLLKLACADTSRYELLVYVTGVTFLLMPLSAIVASYVL
ILCTVLHMPSNEGKQKALVTCFSHLTVVGIFYGAATFMYVLPSSLHSPRQDNIISLFYTVVTPALNPLIYSLRNQEVMGALRRVLGKYMLPTHCTF*
484 >lcl|XP_542462.1|Plus130339753..30340685 NW_876273 olfactory receptor 2AG1-like LOC485344 __SEG__ Chr21 {Canis lupus familiaris} MEYWNSTLGSGFILMGILNDSGSPELLCATITVLYMLALTSNGLLLLVITVDSRLHVPMYFLLGQLSLMDLLFTSVVTPKALVDFLQSEYTISFGGCALQMFLALTLGSA
EDLLLAFMAYDRYVAICHPLNYMVFMRPRVCWLMVATAWILASLSAFVYTTYTMHYPFCKVRKIRHLLCEIPPLLKLACADTSRYELLVYVMGVTFLMPPLFTIISSYTL
ILCTVLHMPSNEGKQKALVTCSSHLTVVGMFYGAATFMYVLPSSLHNPRQDNIISLFYTVVTPALNPLIYSLRNKEVMGALKRVLAKYMA*
485 >lcl|XP_542465.3|Plus1complement(30411811..30412767) NW_876273 olfactory receptor 6-like LOC485347 __SEG__ Chr21 {Canis lupus familiaris} MSKENITHIHEFILVGFPTSPWLQVLLFLLFLITYLFVLLENMIIILTVWVTGSLHKPMYYFLGTMSFLETWYVSVTVPKMLAGFLLHPNTISFLGCMIQLYFFISLACT
ECVLLAAMAYDRYVAICCPLRYPAMMTTEFCVQLTISSWVSGFSISMAKVYFISQVAFCGNNILNHFFCDVSPILKLACMDFSMAEMVDFVLAILILVFPLSATVLSYGF
IVSTILHIPSATGQQKAFSTCASHLTVVIIFYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNKEVKDAIRKTMSSGQALFLRDSFC*
486 >lcl|XP_542469.2|Plus130533317..30534264 NW_876273 olfactory receptor 10A4 OR10A4 __SEG__ Chr21 {Canis lupus familiaris} MTWRNWTVVSEFVLVSFSTLSSEIQALLFFLFLTIYLVTLMGNVLIILVTTADSALQNPMYFFLRNLSFLEIGFNLVIVPKMLDTLIIQDATISFLGCATQMYFFFFFGA
AECCLLATMAYDRYVAICDPLRYPIIMNRRACAQLAAASWFSGFPVATVQTTWIFSFPFCGPNRVNHFFCDSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYV
RILSTIFRMPSAEGKRKAFSTCSSHLLVVSLFYSTAILTYFRPRSSTSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKAALRRVLHRTLGPQKI*
487 >lcl|XP_542472.2|Plus130659590..30660543 NW_876273 olfactory receptor 10A5 OR10B10 __SEG__ Chr21 {Canis lupus familiaris} MAGGNWTRVEEFILMSFSSLPTEIQLLLFLTFLIIYLVTLMGNTLIILVTLADPMLHSPMYFFLRKLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFFFFFGV
DECFLLATMAYDRYVAICSPLHYPVIMNQRTRAKLTVASWLPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTTLFEIYAIVGTILVIMTPCLLILCSYT
RIAAAILKIPSAKGKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNDEVKNALGPTVHKALGLRNCIP*
488 >lcl|XP_542476.1|Plus130739898..30740842 NW_876273 olfactory receptor 2D3-like LOC485358 __SEG__ Chr21 {Canis lupus familiaris} MGEENQTSVAEFIFLGLSQDLQTQILMFVLFLIIYLLTVLGNLLIIILIFMDSRLHTPMYFFLRNLSFADLCLSSSIVPQVLFHFLAKRKAISFLGCMTQIVVSLMIGCA
ECALLAVMSYDRYVAVCKPLHYSSIMTQKVCLQLAIGSWASGALMSLVDTTFTFQLPYQGQKIINHYFCELPALLKVASGDTYSTEMAVFAVGVVMLLVPVCLILVSYWN
IISTVIQMQSGEGRLKAFSTCGSHLIVVVLFYGSAIFNYMKPNSKIVNESDKVISTFYAVVTPILNPIIYSLRNKDVKDGFRKLAGRKLFSERW*
489 >lcl|XP_542477.2|Plus130760693..30761637 NW_876273 olfactory receptor 2D3-like LOC485359 __SEG__ Chr21 {Canis lupus familiaris} MEEENQTTVAEFIFLGLSQDLQTQILLFVLFLIIYLLTVLGNLLIIILIFMDSRLHTPMYFFLRNLSFADLCFSTSIVPQVLVHFLAKKKMISFLGCMAQIVVSLLIGCT
ECALLAVMSYDRYVAVCKPLHYSSIMTQKVCLQLAIGSWASGALVSLVDTTFTFQLPYQGQNIINHYFCELPALLKVASADTYSTEMAIFAMGVVILLAPVCLILVSYWN
IISTVIPMQSGEGRLKAFSTCGSHLIVVVLFYGSAIFNYMKPNSKIMNERDKVVSVFYAVVTPMLNPIIYSLRNKDVKEGLRKLAGRKPFSQRW*
490 >lcl|XP_542479.2|Plus130829288..30830238 NW_876273 olfactory receptor 2D3 OR10F05 __SEG__ Chr21 {Canis lupus familiaris} MGEENQTSVAEFIFLGLSQDLQTQILLFVLFLLIYLLTVLGNLLIIILIFMDSRLHTPMYFFLRNLSFADLCFSTSIVPQVLVHFLVKRKTISLLGCMAQIVVFLLAGCT
ECALLAVMSYDRYVAVCKPLHYSSIMTQQVCLQLAIGSWASGALVSLVDTTFTFQLPYQGQKIINHYFCEPPALLKLASADTYSTEMAIFAMGVVILLAPVCLILVSYWN
IISTVIQMQSGEGRLKAFSTCGSHLIVVVLFYGSGIFAYMRPNSKTTKEHDKMISVFYTVVTPMLNPIIYSLRNKDVAGGLAVGEGEGQVDTLLSG*
491 >lcl|XP_542488.1|Plus131558028..31558966 NW_876273 olfactory receptor 481-like LOC485370 __SEG__ Chr21 {Canis lupus familiaris} MENENHTTVTEFIILGLTDNPTLCAIFFVIFLGVYIITIVGNISIIILIRSSPQLHTPMYLFLSHLAFVDIGYSTSVTPIMLMSFLREKTTIPVTGCIAQLGSDVTFGTT
ECFLLATMAYDRYVAICSPLLYSTQMSPVVCFLLLGASYLGGCMNASSFTGCLMNLTFCGPNKINHFFCDLFPLLKLSCGHVYIAEISPAISSASVLISTLFTIIVSYTY
ILHSILNMRSTEGRKKAFSTCTSHLTAVTLFYGTVLFVYVMPKSTYSADQVKVASVIYTVVVPMLNPLIYSLRNKEVKGAMRKLMAKMHWFS*
492 >lcl|XP_542489.2|Plus1complement(31568016..31568984) NW_876273 olfactory receptor 10R2 cOR10AB2 __SEG__ Chr21 {Canis lupus familiaris} MMGNHTTVSTFLLWGFSSFPDLQTLLFVMIFFSHVTILAANVSVMVAIRLSHNLHTPMYFFLCGLSFSETCTTMAIIPRMLVDLLADCKTISLPECATQMFFFFGLGANN
CFIMAAMSYDRYIAIHNPLHYPILMTHKICFQLLMASWMAGFLVSLCIVIIVFNLSFCDSNIIQHFFCDISPVVCLACDYTFFQKMVLFAFTAFVLVGSFVFIMMSYVFI
ASTVAKMPSAKGRYKAFSTCSSHLTVVCIHYGFAGFVYLRPKDRDLFREDMLMAVTYTVLTPLLNPIVYSLRNKEMQTALRKVLGKTDRFIPQMVNKRTPDS*
493 >lcl|XP_542492.3|Plus131615477..31616412 NW_876273 olfactory receptor 1030 cOR5E1P __SEG__ Chr21 {Canis lupus familiaris} MARGNRTTVTEFVLMGFTDRPELQLPLFVVFLAMYLITLVGNLGMILLIKVDWRLHTPMYYFLSHLAFIDICYSSTIGPKMLQNLLVKKKTISFSGCFAQLYFSSALATT
ECFLLATMAYDRYMAICNPLIYTAIMTQRVCKELVVGVYTYGFLNSVIQTVLTFQLSFCDSNIIHHFYCADPPLLALSCSDTGNKEKQLLIFSAVNLTGSLLTVLISYIC
ILFAIIKIQSSEGKCKAFSTCASHLTVVIIFYGTLFFMYLQQPKAGDSWKYNKVVSVFYSLVIPLLNPLIYTLRNTEVKDTLKKMLHGRGP*
494 >lcl|XP_542493.2|Plus1complement(31650326..31651270) NW_876273 olfactory receptor 10A6-like LOC485375 __SEG__ Chr21 {Canis lupus familiaris} MKRQNQSSVVEFILLGFSNFPELQEQLFGVFLAVYLVTLMGNAIIIVIITLEQTLHVPMYLFLQNLSVVDMSFSAVIMPEMLVVLTREKTSISFVSYFAQMYFILFFGGT
ECFLLGAMAYDRFAAICHPLSYPMIMNKRVFMKLLITSWALGFMLGTVQTSWVSSFPFCGPNEINHISCETPAVLELACADTFLFEIYAFTGTILIIMVPFVLILLSYIW
ILFAILRMPSATGRQKAFSTCASHLTSVTLFYGTASMTYLQPKSGYSPETKKLMSLSYSLLTPLLNPLIYSFRNSEMKRALMKLWRRRVDLHTF*
495 >lcl|XP_542586.1|Plus19335646..9337685 NW_876274 kelch repeat and BTB domain-containing protein 7 KBTBD7 __SEG__ Chr22 {Canis lupus familiaris} MQSREEAPRPRRLASPRGGRRPKRISKPSVSAFFTGPEELKDAAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESHQA
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFADAFDHHKLRSQAQSFIAHNFRQLSRMGSVREESLADLSLA
QLLSILRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFREEDQDYLEGLLTKPIVKKYCLDLIEGALQMRYGDKLCKALAPKPDSSSSCVVPTAENPP
QRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRDP
ITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLYYDPGHNTWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDSE
THNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDD
EVWVQVAPQGNAQDHQGSL*
496 >lcl|XP_542628.2|Plus1complement(36275508..36277598) NW_876274 SLIT and NTRK-like family, member 1 SLITRK1 __SEG__ Chr22 {Canis lupus familiaris} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSA
RNKPPANGLPCPGSCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATIENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
497 >lcl|XP_542630.1|Plus1complement(37863162..37865684) NW_876274 SLIT and NTRK-like family, member 6 SLITRK6 __SEG__ Chr22 {Canis lupus familiaris} MKLWIHLLYSSLFACISSQSQSPMSSARGSCDSLCNCEEKDGTMLINCEEKGIKKLSQISVPPSRPFHLSLLNNGLTMLHTNDFSGLTNAISLHLGFNNIADIETGAFNG
LGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKW
TCNCDLLELKIWLENMPPQSVIGDIVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSISDSRMSTKSTSLLRPATKAPVLIPYITKPFTQLPGPYCP
IPCNCKVLSPSGLLVHCQERNIESLSDLKPPPQNPRKLVLAGNIIHTLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFINLTRLQKLYLNGNHLTKLSRGMFLGLHNLEYL
YLEYNAVKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVSLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWLQKLSKNTVTDDILCTSPE
HLDKKELKALTSELLCPGLVNNPSLPTQASYIIVSAPTTTTTADTILRSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQTDEQMRDNSPVHLQYSMY
GHKTTHHTTERPTASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKDGSETKHLQRSLLERENHSPLTGSNMKYKTTDQSTEFLSFQDASSLYRNILEKERELQQLGI
TEYLRKNIAQLQPDMEVHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
498 >lcl|XP_542646.1|Plus1complement(47317248..47318261) NW_876274 2-oxoglutarate receptor 1 OXGR1 __SEG__ Chr22 {Canis lupus familiaris} MNEPLDNFANASDFSDYAAPFGNCTDEKIPLKRHYLPVIYSIIFLVGFPGNAVAISTYIFKMRPWKGSTVIMLNLACTDLLYLTSFPFLIHYYASGENWVFGDFMCKFIR
FGFHFNLYSSILFLTCFSIFRYFVIIHPMSCFSIHKTRWAVVACAVVWIISLVAVIPMTFLITSTTGTNRSACLDLTSSDDLTTIKWYNLILTATTFCLPLVIVTLCYTM
IIYTLTQGPHNHSCLKQKARRLTILLLLVFYICFLPFHILRVIRIESRLLSISCSVENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAICSMVRCKASGDLEQAKK
ISYSNNP*
499 >lcl|XP_542650.1|Plus1complement(49235262..49236257) NW_876274 N-arachidonyl glycine receptor GPR18 __SEG__ Chr22 {Canis lupus familiaris} MTTPHNQAQPGPSNNSHPEEYKIAALVFYSCIFIIGLFVNATALWVFSCTTKKRTTVTIYMMNVALLDLIFIMSLPFRMFYYAKGEWPFGEYFCQILGALTVFYPSIALW
LLAFISADRYMAIVQPKYAKELKNTGKAMLACVGVWIMTLTTTIPLLLLYEDPDKASTPPTCLKISDITHLKAINMLNFTRLIFFFLIPLFIMIGCYLIIIHSLLHGKTS
KLKPKVKEKSIRIIITLMVQVLVCFMPFHICFAFLMLEGDENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSVRRKSFRSGSLRSLSNVNSEM
L*
500 >lcl|XP_542719.1|Plus19028098..9029165 NW_876276 c-C chemokine receptor type 8 CCR8 __SEG__ Chr23 {Canis lupus familiaris} MDYTLEPNVTKITDYYYPDIISSPCDGELIQRDSKLLLAVFYCVLFVFGLLGNSLVILVLVACKKLQSITDIYLLNLALSDLLFVFSFPFQTHYQLDQWVFGTVMCKVVS
GFYYIGFFSSMFFITLMSVDRYLAIVHAVYAMKVRTARMGTALSLAVWLIAIMATSPLLVLYQVASEDGFLQCYSSYNQQTLKWKIFIHFEMNILGLLIPFTILMFCYIS
ILHQLKSCQNHNKTKAIKLVLIVVIASLLFWVPFNVVLFLTSLFNMNILDGCVLSQRLIYATHVTETISFTHCCVNPVIYAFMGEKFKKHLSEIFRKSCNHILFYIGGQI
PKEGLERSHSSCQHPSRFSTTDYIL*
501 >lcl|XP_542737.1|Plus112002623..12003777 NW_876276 chemokine-binding protein 2 CCBP2 __SEG__ Chr23 {Canis lupus familiaris} MAPTASPLPPTTEVASSENSSSFYDYEYYLDQVAFMLCRKDEVLAFGRIFLPIFYSLIFVLGLGGNLLLLVVLLRYIPRRRMTEVYLLNLAISNLLFVVTLPFWGISMAW
HWVFGNFLCKMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQPHHRLRTRAKSLLLAAMVWAMALAVSIPDMVFVRTHENPMGVWNCYADFGGHATIWKLFLRFQQNFLG
FLLPLLVMIFFYSRIGSVLVRLRPPGQGRALRIVVALVVAFFVLWFPYNLTLFLHSLLDLQVFGECKVARHLDYAMQVTESIAFLHCCFTPILYAFSSRHFRQYLKAFLV
TVLRRHQTPCPAQAPLSSCSESTSLTAQEEMTNMNNLGERQAEHSPNKNDMGKN*
502 >lcl|XP_542758.1|Plus1complement(17345170..17345949) NW_876276 leucine-rich repeat-containing protein 3B LRRC3B __SEG__ Chr23 {Canis lupus familiaris} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
503 >lcl|XP_542820.2|Plus1complement(38602251..38603384) NW_876276 progestin and adipoQ receptor family member 9 PAQR9 __SEG__ Chr23 {Canis lupus familiaris} MARRLQPRGAGTKGPPAATAAASEAGPRPHPSAAAEPLASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGR
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTRLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCSYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIHPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLEAPPAAPTFSGTVGYMLLLVVCLGLVIKKFLNSAESCSKK*
504 >lcl|XP_542837.1|Plus1complement(45835755..45836714) NW_876276 probable G-protein coupled receptor 171 GPR171 __SEG__ Chr23 {Canis lupus familiaris} MTNSSTFCPVYTNLEPFTYFFYLVFLVGIIGSGFATWAFVQNKTNHRCVSIYLINLLTADFLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLMYINMYLSIIFLAFVSI
DRCLQLTYNSKVYRIQEPGFAKMISTVVWLMVLLIMVPNMIIPIKDIKERPNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSVIILISNCLVIRQLYRNKDNENYPYVKK
ALINILLVTTGYIICFVPYHIVRIPYTLSQTEVISDCPTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKVTKTFASRKETKAPKEKSNGENSA*
505 >lcl|XP_542838.2|Plus1complement(45851425..45852447) NW_876276 P2Y purinoceptor 14 P2RY14 __SEG__ Chr23 {Canis lupus familiaris} MTNSSTTQPPEESCSRNTVITQQIVPVLYLVVFVAGILLNGVSGWIFFYVPSSKSFIVYLKNIVVADFLMSLTFPFKILADSGLGPWRIHVFVCRVSAVLFYVNMYVSIV
FFGFISFDRYYKIVKPLLTSFIHSVNYSKLLSVMVWVLMLLLAVPNIILTNQNVSNVKVTRIKCVTLKNELGLKWHKASNYIFVGIFWIVFFLLIFFYTAITRKIFKSHL
KSRRNSISVKRKSSRNIFSIMFVFFVCFVPYHTARIPYTQSQTEAHYSCRSKEILLYVKEFTLLLSAANVCLDPIIYFFLCQPFRETLCKKLHIPFKAQHDSETSKTKRE
NTTHESTDTL*
506 >lcl|XP_543078.1|Plus1complement(44530125..44531024) NW_876277 protein phosphatase 1 regulatory subunit 3D PPP1R3D __SEG__ Chr24 {Canis lupus familiaris} MSGGWGSAALPPGPGARKPAPRSLSCVSDLDGGAAPEPRPCRPPGSPGRAPPPPPAPSGCDPRLRPIILRRARSLPSSPERRQKAGGASGAACRPGCSRQLRVRFADALG
LELAQVKVFNAGEDPAVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFPPPIEAADFAERLAQRLICLERVTCSDLGISGTVRVRNVAFEKQVAVRYTFSDWRSAHEAV
ARWRGPAGAGGTEDVFAFGFPVPPFLLALGSRVHFALRYRVAGAEYWDNNHGRDYSLTCRNHALHMPRGECEESWIHFI*
507 >lcl|XP_543137.1|Plus15041100..5042179 NW_876278 protein mab-21-like 1 isoform 1 MAB21L1 __SEG__ Chr25 {Canis lupus familiaris} MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAG
KQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALENAAKQTWRLAREILTNPKSLEKL*
508 >lcl|XP_543160.2|Plus112725215..12726219 NW_876278 G-protein coupled receptor 12 GPR12 __SEG__ Chr25 {Canis lupus familiaris} MNEDLKVNLSGLPRDYLDAGAAENVSAAVSSQVPVAEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLMAGIGLIINFVFAYLLQSE
ATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLIMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNTAILSVSFLFMFALMLQLYIQI
CKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLSQRARS
PSDV*
509 >lcl|XP_543283.3|Plus1complement(24269939..24270904) NW_876279 G-protein coupled receptor 55 GPR55 __SEG__ Chr25 {Canis lupus familiaris} MSRQLNRSQNCSFSDVDELMKTVQLAVHIPTFLLGLLLNLLAIRGFSTFLRKRRWPDYAATAIYMINLAIFDLLLVLSLPFKMALANVRAPLPSLCTLVECFYFISMYGS
VFTICFISLDRFLAIRFPFLVSHLRSPRKIFGICCTIWVLVWAGSIPIYSFHGKMEKYTCFHNMSDGTWSAQVFFPLEVFGFLLPMAVMGFCSSRSIHILVGRRGLTQDW
VQQKACIWTIAASLAVFVVSFLPVHLGFFLQFLVRNGFIVECRAKQNISLFLQLSMCFSNVNCCLDVFCYYFVIKEFRMDIMAHRPSRVQLVPQDTMTSRA*
510 >lcl|XP_543315.2|Plus14258212..4259162 NW_876280 olfactory receptor 12-like LOC486190 __SEG__ Chr25 {Canis lupus familiaris} MPPKRNGNLSMVHFQDFVLEGFEGGLETQALLFAVFLALYMVTVLGNLLMIIVITLDARLHSPMYFFLKNLSFVDLCYSSVIAPKALANFFSSSKVITFAGCAMQFFFFS
LLGTTGAFLLGVMAYDRFMAICNPLRYPITMCQSACTCLVLGAYCGGCFNSVVQTSFTFHLPFCSSNRINHFFCDVVPLLKLSCGNTAINELLLFGICGLIIVGLAFMVL
ISYGYIIVTILRMGSGARRRKVFSTCGSHMTAVTLFFGTVFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEALRRLGQKPMAL*
511 >lcl|XP_543316.1|Plus14267571..4268521 NW_876280 olfactory receptor 12-like LOC486191 __SEG__ Chr25 {Canis lupus familiaris} MPPKRNGNLSMVHFQDFVLEGFEGGLETQALLFAVFLALYMVTVLGNLLMIIVITLDARLHSPMYFFLKNLSFVDLCYSSVIAPKALANFFSSSKVITFAGCAMQFSFLS
LLGTTEAFLLGVMAYDRFMAICNPLRYPITMCQSACTRLVLGAYCGGCFNSVVQTSFTFHLPFCSSNRINHFFCDVVPLLKLSCGNTAINELLLFGICGLIIVSVTFVIL
ISYGYIIATILRMGSGAGRSKIFSTCGSHMTAVTLFFGTAFFMYAQPRAIESMEQGKVVSVFYTLVIPMLNPLIYSVRNKDVKEALRRLGQKHTAT*
512 >lcl|XP_543326.2|Plus14801173..4801949 NW_876280 G-protein coupled receptor 35 GPR35 __SEG__ Chr25 {Canis lupus familiaris} MRPWTETRVYMVNLAAADLCLLCALPFFLHSLKDTTDTVSCQLSQGIYLANRYLSIGLITAIAVDRYVAVRHPLCARGLRSPRQAAAVCAALWVLVGSSLVLRWALGVQE
GGFCFRNPARQSAGTTLFSLLGFYPPLAVLGFCSLQVVAALAERPASGPHQAQATRRATRMVWANLAVFVLCFLPFHVVLTVYAAAGRPTPALCYALYVTGKLSDANCCL
DAIGYYFVAKEFQEATLLASVPVAKAHRTQDSLSVTLA*
513 >lcl|XP_543378.2|Plus16764994..6766322 NW_876282 LOW QUALITY PROTEIN: hydroxycarboxylic acid receptor 3 GPR109A __SEG__ Chr26 {Canis lupus familiaris} MNLHQQQNHFLEIDKKNCCVFRDDFIANVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFLTDNYVRKWDWRFGDIPCRLMLFMLAMN
RQGSIIFLTVVAVDRYFRVVHPHHVLNKISNRTAALISCLLWGVTIGLTGHLLSKKMLIRNRDANLCSSFSICHTFRWHDAMFLLEFILPLGIILFCSARIIWSLRQRQM
DRHAKIKRAINFIMVVAIVFIICFLPSVAVRIRIFWLLHTTGTKNCDIYRSVDLAFFITLSFTYMNSMLDPLVYYFSSPSFPNFFSTLINRCLRKKRPQELDNNQSTSME
LTGDLNTTRSVPDNLVANSGEPRNPSYLTPASR*ITKPRRELVTKNQGLWIHSLAGCTGYHH*TWPVVSWNFQIQRIRFGEG*WQSGLPGCGASPEDSWGNREESF*NFC
SIS
514 >lcl|XP_543447.2|Plus118560634..18561731 NW_876282 chemokine-like receptor 1 CMKLR1 __SEG__ Chr26 {Canis lupus familiaris} MGDEDYNTSLTYDDEYSDDFDPIMVLDESSPLEGKVARIFLVVVYSIVCFLGILGNGLVIVIATFKMKKTVNAVWFLNLAVADFLFNIFLPIHIAYAAMDYHWVFGTAMC
KISNFLLIHNMYTSVFLLTAISFDRCISVLLPVWSQNHRSVRLASVACALIWVLAFFLSSPSLIFRDTALVHEKISCFNNFSLSASGSAPWPAHSRLDPVGFSRHMVVTV
TRFLCGFLVPVLIITACYFTIVCKLRRNRLAKTRKPFKVIVTIITTFFLCWCPYHMLYLLELHHAAMPGSVFSLGLPLATAIAIANSCMNPILYVFMGQDFKKFKVALFS
RLVNALSEDTVHSSYPSHRSFTKMSSMNDRETSML*
515 >lcl|XP_543571.3|Plus1complement(4701942..4706885) NW_876283 RIMS-binding protein 3A-like LOC486445 __SEG__ Chr26 {Canis lupus familiaris} MTKDSPSPSGGGRATPKKPSSPGPSAAVLEEQRRELEKLRAELEAERARGRAERQRFASQARQLREAAERERQQLVDHLRSKWEAQRGRELRQLQEDVLREREAEIRQLL
RWKEAEMRQLRQLLHRERDGVLRQARELQRQLAEELVNRGYCGRAGAPEVAAAQCSCRLQEVLAQLRWDTDGEQASRIRHLQAALDVERQLFLKYILEHFRWHPALPGSH
DPQASHASEESPPHTAGDAHGPPKSVCGLESLDADSLSSGVRVRSRSLDVVPAGCSTSPDGLLHARAGSLDSLAPARSRSLDSTLSCPKESEEQASSPGASIVGSPSPPP
PPPPPPSEHRRPSDPPGEDSGSQPCEAGTPSPPGLDYQELLKRNSELSEALQVLARRCSSLREENTQLRRAGFQDKSDKVKRLKVKHAELTGLARRLEDRARKLRETNLR
AVSAPVPGESLAGLELCQAFSRQRARDLSEQASALLAKDKEIEELRQECHLLQASVASGFGSGLRPGGGAAQAQAQWLSISELDRLQRESQREVLRLQRQLTRQQATSSA
RAEADGQGAPCEEARRQVQALELELGARRRDCEELGAQAAAARRRSEEAETQLQAALREGARLAQENARLQAQADWTRKVAAENNDVRGQLGRACQERDAAGMLAEQLLQ
QAARGQDRQQQLQHDLQKALHDLQAAREEMLALHGQPGRPLQEAPEAPQAPEVQVRESGRTELQPGPEDQASSQRSRDKRESLEASPLESPVAIGEPGSDPQGPDKVPAN
RPLDSRSQAKKASSQSNSSSEVESVWATVPSCPTLDMDTASEVEDLEPDSVSSTLERGDPEAPLAPKLKIFLARYSYNPFKGPNEHPESELPLTAGDYVYIFGDMDEDGF
YEGELEDGQRGLVPSNLVEQIPDSDILGCLHSKSSDFGPTRLPPGQGTRLKEDTGHSLLPWKAQEAMDKGPCQMVRAGSQAEVATEISDAMIEDSWLGLLRCVEEKGFSR
PLLGPRGVLCMAPTQLHLQSVAATSAKITWVHSSSSYIHMVYLNDQEHALTPAGVSCYTFHSLRPGERYEARVEVQLPWDLLQVHWETMSSTITFNTPLAGPPDPPLDVL
VERHASPGLLVVSWLPVTIDSAGSSNGVQVTGYSVYADGLKVAEVADATAGSILLELSQVQLPMMSQNVSVRTMSLWGESLDSVPAQIPQDCFTCHQLPETSSFNYTCGD
PSICRVTVPVCSQRLALAPVNAKTSSHTPGSCGEPQAKFLEAFTEEPPKRQSPGPSLSPERECASAGSASQAQGLTEAQEVCRKDLLFQQSSPNHRPPLPSGQSRKEEDH
YWHTGTRQSPASGVIHLFPECRLKKELYPEKPALEKILRQKQDPQVFIPPQLDTSQPYVSDFHDILQKEEEAAVCFSLWGTERREQRKEFKTQNGRGQALGGKRECQLPK
SSPALCPAPSSKVIKISRGAPSPLGTGVDTLVRVFVALFDYDPLVMSANPEVAEDELAFQKGQLLRVWGSQDPCGFYHGECNGQVGNIPGHLVAEVKVGTEQTDGRWHLP
VQEYLPPVAHLDDFGELTSPQGSFPIPQGNPRMSPLWTPTTMMAALDYDPKDGCAGGRVKGKLSLRAGDVVTVYGPVDEKGFYYGESGGHRGLVPAHLLDHLSFHGE*
516 >lcl|XP_543605.3|Plus1complement(98597..99535) NW_876284 olfactory receptor 6C74 OR6C74 __SEG__ Chr27 {Canis lupus familiaris} MRNHTTVTTFILLGLTDNPQLQVVIFLLLFFTYMLSVTMNLTIIILTLLDSHLKTPMYFFLRSFSFLEVSFTTVCIPKFLVSMATGDRTISYNSCATQLFFTIVLGAIEF
FLLAAMSYDRYVAICKPLHYTTIMNDRVCNLLVFASWLAGFIVVVPPLLVGLQLDFCAANTIDHFFCDFSPILQLSCTDTDVIELMALLSAILTLLVTLVLVILSYANII
RTILKIPSSQQRKKAFSTCSSHMVVVSISYGSCIFMYVKPSAKDRVSLNKGIALLSTSVAPMLNPFIYTLRNKQVKDAFMHMTKKMEIFSVK*
517 >lcl|XP_543608.3|Plus1complement(142146..143093) NW_876284 olfactory receptor 10A7 OR10A7 __SEG__ Chr27 {Canis lupus familiaris} MICENHTRVTEFVLLGFTNNPEMQVSLFILFLIIYTVTLLGNFLIITVTSVDPALQTPMYFFLRNLSLLEVCFTLVMVPKMLVDLVSLRKIISFVGCGIQMYFFFFFGSS
ECFLLSMMAYDRFVAIGNPLRYSVIMNRSLCLWMAVGSWMSGVPVSMLQTAWLMALPFCGPNTIDHFFCDGPPVLKLVTQDTTMYEMQALASTLLFIMFPFSLILVSYTR
IIITILKMPSATGRQKAFSTCSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTVITPMLNPIIYSLRNNEVKGAVKRTVTRKVLKLDAF*
518 >lcl|XP_543610.3|Plus1complement(253716..254654) NW_876284 olfactory receptor 6C75-like LOC486484 __SEG__ Chr27 {Canis lupus familiaris} MRNHTKVTEFILLGLTDDPKWQVVLFIFLLVTYMCSVTGNLVIIFLTLTDPHLKTPMYFFLRNFSFLEMSFTSATIPRFLVTVVTGDRTISYNDCLAQVFFVILLGVTEF
YLLTAMSYDRYVAICKPLHYMTIMSTRVCILLVFSSWLAGFLVIFPPVILMLKLDFCASNIIDHFVCDSSPIIQLSCTNTHFLELMAFVLAVVTLMVTLTLVMLSYTHII
RTILRIPSTSQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSAKERVSLNKGVAVIITSVTPLLNPFIYTLRNQQVKQAFKNMVHRMVFSSYK*
519 >lcl|XP_543613.3|Plus1complement(331402..332343) NW_876284 olfactory receptor 9K2-like LOC486487 __SEG__ Chr27 {Canis lupus familiaris} MGDKGGDNHSEVTDFILVGIRVRPELHSLLFLLFLVVYGMVLLGNLSMIGIIVTDPRLNTPMYFFLGNLSIIDLSYSTVIVPKAMVNILSQKKTISFAGCVAQLFLYALF
MVTEAFVLAAMAYDRFIAICNPLLYTIRMSRSLCIQLVAGSYLCGWVSSILQISVTFSMSFCASRVIDHFYCDSNPIEKISCSNIFMNKMVSFSLAVLIILPTIVVIVVS
YMYIVSAVLKIRSSEGRKKAFSTCSSHLGVVSLLYGTVSFVYLTPPSNPELRKVASVCYILFTPMLNPLIYSLRNKDVKDAMKKVLWKKKVLL*
520 >lcl|XP_543691.3|Plus1complement(5884149..5885150) NW_876284 LOW QUALITY PROTEIN: olfactory receptor 11A1 cOR11M2 __SEG__ Chr27 {Canis lupus familiaris} MRKQSSGDSENQTTWLILVGFGDLQHLGFLPFTFFLAIYVVTVGGNALIVLAVASSRTLHTPMYFFLCHFSLLEIGYTSNIMPQLLWSFLEGREAISLVSCLVQFYVFAS
LAAVECLLLSAMSYDRYLAICHPLRYPALMSTWLCGCLAAGAWVSGFSFSAFTLALAAPLPLCPGSREIDHYFCDFAPVVGLFCGDVGVMWGAGVSISGFLTLAPFLLIV
APMPSS*GLCCKYLQAMVGRKPSPPVPPTSAWSGCFMAPSLWSM*PQQTTWPPCSERPSLSSILYSLLWSTPSFTASRTKR*RGPFIDSGDSLS*DILLCGG*GSY*LLP
GFQL
521 >lcl|XP_543696.2|Plus1complement(6019352..6020287) NW_876284 olfactory receptor 8S1-like LOC486570 __SEG__ Chr27 {Canis lupus familiaris} MALRNHSTSTEFILLGLSADPKVQALLFVLFLGIYLLTVMGNLAMLLVISADFHLHTPMYFFLSNLSFLDLCFSSVTVPKMLENLLSKRKIISIEGCLTQAFFVFDVGGT
EIFLLSAMAYDRYAAICHPLLYSRMMSNQLCVRLVWASWSLGFLDAVINIPLAMNLNFCEAHTIPHYSCELPSLFPLSCSDVSTNLTVLLCSTLLHGFGTFFLIFFSYAR
IVSTILSISSSLGRSKAFSTCSSHLTAVSFFYGSAFLRHLIPTSGSPLELIFSIQYGVITPLVNPLIYSLKNKEVKAALRRTLGKCLQWHR*
522 >lcl|XP_543697.3|Plus1complement(6032096..6033043) NW_876284 olfactory receptor 8S1 cOR8S15 __SEG__ Chr27 {Canis lupus familiaris} MASANHSRITEFILLGLSADPYVQALLFVLFLMIYLLTLLGNLLIILVIHTDANLHMPMYFFLGHLSFQDLFYSTVTVPKLLENLLSQRKTISVEGCLAQVFFVFATTGI
EACLLSVMAYDRYAAICHPLLYGQVMSKQLCERLVWGSWVVAFLDALMNILLALNMDFCEAQTIHHYSCELPSLFPLSCSDVSTNSAMLLCSALLHAIGTCLLIFFSYVR
IVSTILSISSTTGRSKAFSTCSSHLTAVILFYGSALLRYLMPTSGSPLELILSIQYSVITPLVNPLIYSWKNKEVKAALRRMMIKYLRCLSTEEI*
523 >lcl|XP_543699.3|Plus1complement(6044260..6045216) NW_876284 olfactory receptor 8S1 cOR8S9 __SEG__ Chr27 {Canis lupus familiaris} MVLGNHSTITEFIFLGLSADPHIQILLFVLFLAIYLLTIMGNLMIMIVTMTDTHLHTPMYFFLSHLSFLDLCLTSVIVPKMLENLVSHKKSVSVEGCLTQAFFVFSIAGT
EVFVLSAMAYDRYTAICYPLLYGQLMSKQLCGGLVWVSWALGFLDALINTLMAWNLDFCEVQVIPHFSCELPSLFPLSCSDISTNFTVLVCSAIIHASGTLLLVFFSYTR
IVSTILSISSTSGRSKAFSTCSSHLTAVSFFYGSAFLRYFMPISGSPLELIFSIQYSVVTPLINPLIYSLKNKEVKSALKRMLQKGLKQLREQRTGSG*
524 >lcl|XP_543703.1|Plus1complement(6119237..6120175) NW_876284 olfactory receptor 8S1 OR8S1 __SEG__ Chr27 {Canis lupus familiaris} MDLGNHSTITEFILLGLSADPHIQVALFVLFLGIYLLTVMGNLIMLLVIRTDSHLHTPMYFFLSHLSFVDICFSSVTVPKMLENLLSQKKTISVECCLTQVFFVFVAAGT
EACLLSVMAYDRYAAICHPLLYGQIMNKQLYMQLVWGSWGLSFLDALINIFLAMKMVFCKAQIIPHYSCEMPSLLSLSCSDTSKNLIALLCSTLLHGLGTFLLVFLSYAR
IIATILSISSTSGRSKAFSTCSSHLTAVTLYYGSGLLRHLMPNSGSPLELIFSVQYTVVTPVLNPLIYSLKNKEVKAALTRTMEKYLQHIRC*
525 >lcl|XP_543705.3|Plus16212855..6213772 NW_876284 olfactory receptor 8S1 cOR8T4 __SEG__ Chr27 {Canis lupus familiaris} MRNHSVVSEFILLGLSADPQIQALLFMLFLVIYLLTLMGNLLLLLVIRADSHLHSPMYFFLGQLSFLDLCHSSVTVPKLLENLLSEKKTISVEGCLAQVFFVFATGGTES
CLLAVMAYDRYVAISSPLLYGQMMNRPLCMGLVWGSWSLAFLDALINILVALNLDFCEAQNIHHFSCELPSLYPLSCSDVSASFTALLCSSLLHFFGNFLLIFFSYVRIL
STILSISSTTGRSKAFSTCSSHLTAVIFFYGSGLLRYLMPNSGSTQELIFSLQYSVVTPMLNPLIYSLKNKEVKAAVRRILRKCV*
526 >lcl|XP_543709.2|Plus16358633..6359562 NW_876284 olfactory receptor 8S1 OR12B11 __SEG__ Chr27 {Canis lupus familiaris} MKNVSIITEFVLLGLSSDPQIQTMLFVLFLGIYLLTLMGNLVMILVIRVDSHLQTPMYFFLGHLSFLDLSFSSVTVPKMLQNFLSQKKSISVWGCITQSFFFTLSGGTEA
CLLSAMAYDRYAAICYPLVYTMVINRPLCIVTVSIAWTVGFLISLMNILFIYKLHFCGSNIIPHFSCELPPLFPLSCTDPIVNEILLAVSCAFLGLLTLPLILFSYSRII
SAILNIRSSEGQAKAFSTCSSHLTVVLLFYGTALFRYISPASGSVLERVVSIQYSVITSLVNPLIYSLKNQEVKAALQRMLKQQKCALG*
527 >lcl|XP_543720.3|Plus17518197..7519762 NW_876284 amphoterin-induced protein 2 AMIGO2 __SEG__ Chr27 {Canis lupus familiaris} MSLRIHTRPTPPGVVTPGCRELLCLLVITATVSRGASGVCPTACICATDIVSCTNRNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSLAKLNTLIIRHNNITSISAG
SFSTTPNLKCLDLSSNKLKTVKSAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRILSLPMHHINLVPGKQLR
GIYLHGNPFVCDCSLSSLLIFWYRRHFSPVMDFKNDYTCRLWSDPRHSHQVPLLQDGFLNCTDSVINGSFRALGFIHEAQVGERLIVPCDSKTGDGNTDFVWVGPDNRLL
EPEKELENFHVFRNGSLVIENPRFEDAGVYSCIAMNRQRLLNETVDVTINVSNFTVNRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCKTKRQKNILHQSDAH
SSILNPGPASDAPADDRKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEPVIAEGILKSTRVKSDSDSVNSVFSDTPFVATT*
528 >lcl|XP_543831.1|Plus1complement(37462173..37463627) NW_876284 C3a anaphylatoxin chemotactic receptor C3AR1 __SEG__ Chr27 {Canis lupus familiaris} MEAFSADNNSTDLPSHQWYEPQAILSMVILSLTFLLGLPGNGLVLWVTGLKMQRTVNTVWFLHLTLADFLCCLSLPFSLTHLVLQGHWPYGWLLCKLIPSIIILNMFASV
FLLTAISLDRCLLVLKPIWCQNHRNVGTASTICGCIWVVAFAMCIPVFMYRETFTENNHDRCGYNFYLYSSFDYSDFTIDLLDNGSLDNSIVQLPGEMDDRLESFSLQIN
DLPWTATTTLPSQTFQRPSRESLLMDSTKLSSQHPYYNLFKPTDEVSSTIPSGFLIEDHRNNPLDNSDAFLSTDLKLYSGTSNNSLYLYELSQDFQDDYLGQFSYDNQGL
TILMAITITRLVVGFLLPFILMVTCYGLIIFRMRRGRFTKTRVKALRVAVAVVIVFCICWAPYHIVGVLSLFVDPGTAFGEALLSWDPVSIALASANSCFNPFLYALLGK
DFRKKAKQSMKGILEAAFSEDLTHSTSCPQSKVFPERNSISTTV*
529 >lcl|XP_543851.1|Plus138426960..38428060 NW_876284 lysophosphatidic acid receptor 5 LPAR5 __SEG__ Chr27 {Canis lupus familiaris} MLTASANSSVPPCPDYRVTHRLHMVAYSLVLAAGLPLNALALWVFLRALRVHSVVSVYMCNLAASDLLFTLSLPVRISYYALHHWPFSDLLCQTAGAVFQTNMYGSCIFL
TLINVDRYAAIVHPLRLRHLRRPRVARLLCLGVWALILVFAVPTVLVHRPSPCSYDGGRARLCFESFGDKLWKGGLLPLVLLAEALGFLLPLAAMLYSSGRVFWTLARPD
ATRSRRRRKTVRLLLANLVIFLLCFVPYNATLAVYGLLRGNLVAAGSEASDRVRQVLMVMVLLASANCVLDPLVYYFSAEGFRNTLRGLGTWHRARTLATNGAQGALAER
LTETTCIAGPAPASREPPASSPGGTPLTQRREDSAL*
530 >lcl|XP_543905.2|Plus1complement(2259285..2260271) NW_876285 olfactory receptor 13A1-like LOC486778 __SEG__ Chr28 {Canis lupus familiaris} MNLWVEIHLIALETPLSPRTMSNKTLVTEFILQGFSEHPEYHMLLFSCFLSLYSVALTGNILIILAITFNPGLHTPMYFFLFNLATMDIICTSSIMPKALEGLVSEESSI
SYGACMAQLYFLTWAASSELLLLTVMAYDRYAAICHPLHYSTTMSMAFCSKLATGVWVLCAFNTAIHTGLMLRLNFCGPNVITHFFCEVPPLLLLSCSSTYVNSIMIVLA
DAFYGILNFLMTIVSYGFIISSILKMRTAEGKKKAFSTCSSHLIVVCMYYTAVFYAYISPVSSYSPGKSKLAGVLYTILSPTLNPLIYTLRNKEVKAALRKLFSFSRN*
531 >lcl|XP_544041.2|Plus1complement(28955200..28956312) NW_876285 prolactin-releasing peptide receptor PRLHR __SEG__ Chr28 {Canis lupus familiaris} MASLPTQGPSVPDLFSGLPPAASIPANQSSEASAGNGSAAGAGAQAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMC
TACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHRVRLCEEFWGSQER
QRQLYAWGLLLFTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACY
NPFIYAWLHDNFREELRKLLLTWPRKIAPHGQTVTVSVVI*
532 >lcl|XP_544078.2|Plus14778507..4779502 NW_876288 neuropeptides B/W receptor type 1 NPBWR1 __SEG__ Chr29 {Canis lupus familiaris} MHNGSSSEPGPTNTSCWGPAPGCPNASSPPPPPPLPPPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRTKTVTNLFILNLAVADELFTLVLPINIADFLLQQWPFGEL
MCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGLVTLVVLPFAVFARLDDEQGRLQCVLVFPQPEAFWWRASRLYTLVLGFAIPVS
TICVLYSILLCRLRAMRLDSHARALDRAKKRVTLLVVAILAACLLCWTPYHLSTVVALTTDLPQTPLVIAVSYFITSLSYANSCLNPFLYAFLDDSFRKSLRQLLACRAA
A*
533 >lcl|XP_544088.3|Plus1complement(7515697..7516743) NW_876288 proto-oncogene serine/threonine-protein kinase mos MOS __SEG__ Chr29 {Canis lupus familiaris} MPSPLSRHSYLPSEFSPSVDSRPCSSPSELPSKAGKLFLGGTPPRAPRLPRRLAWCSIDWEQVCFLQRLGAGGFGSVYKATYHGVLVAIKQVNKCTKNRLASQRSFWAEL
NIARLRHDNIVQVVAASTRTPAGFNSLGTIIMEFGGNVTLHQVIYGATSCSEKDVQPHCCAGEQLNLGKCLQYSLDIVKGLLFLHSQNIVHLDLKPANILISEQDVCKIG
DFGCSEKLEDVLCFQTPPYPLGGTYTHRAPELLKGEMITPKADIYSFAITLWQMATKEAPYSGERQYVLYAVVAYNLRPSLSAAVFTDSISGKRLEKIIQCCWRASALQR
PSAELLLVDLNSLRAEFD*
534 >lcl|XP_544274.3|Plus112055139..12055588 NW_876291 calmodulin CALML5 __SEG__ Chr2 {Canis lupus familiaris} MAEELPPEQVAKFKEVFSRFDKNGDNTINTQELGAVMQALGQDISEDELKMLIAQVDTDGDGVISFQEFLEAMVKRMKSWGSEQEMREVFRAFDLNGDGHISVDELKQAM
AKLGELLSQEELDTMIQEADVDKDGQVNYEEFMRILSQK*
535 >lcl|XP_544296.1|Plus11469557..1472013 NW_876292 protocadherin beta-1 PCDHB1 __SEG__ Chr2 {Canis lupus familiaris} MAVARRKFLQSRQVGSLLFLLCISTGSAATIRYSVAEEMESGSFVANVAKDLGLEVGKLAARGARLVSEGSKVHFRLHRKTGDLFVKEKLDRESLCGKADPCVLHFEIVL
VEPLQSFRAEVRVFDINDNAPIFLNKQPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSPNAYFHLHTRFRSQGPKYAELVLDKPLDREEQPEVNLTITAVDGGSP
PKSGIAHIRVEVLDVNDHVPQFSRLVYRVQVPENSANGSLVATVSATDLDEGSNKEITYSLAQNPETILQTFQIDSQTGEVRLRGPLDFEAIETYDIDIQATDGGGLSAH
SKVLVEVVDVNDNPPEVTVSSVSSPLPEDSPLQTVVALFSIRDRDIQVGGKIICFLREDLPFAVKPTFRNSYSLVTDRGLDREEVSGYNVTVVAMDTGPPSLFTETVIEV
LISDINDNPPVFQEDSYILTVRENNSPAIFIGKVHAEDLDLGENAQVTYTLLPPKSGDLAVFAYISINSDNGKLYALRTIDYEAIQDFQFVVKATDGGFLSLSSQVTVRV
VVLDDNDNRPMILYPLQNGTSPCNDLVPRSADVGYLVTKVVAVDGDSGRNSWLSYHLLKATDPGLFSVQQQNGEIRTLRQISERDPMIQKLIVLVQDHGQPVLSTTASLN
ILLVDGFSEPYLQFRNPSKNPTRVNPSTKYLVISLAVLSFLFLLSVTVIFVLHIYQKVKYREKFTVQEHFYDDCNFPNNLVQGGASGSLSQPCPYEMCSATGTSNSEFRF
LKRFMPNFPFPHGTGEAKTEAGSSLPPDSERNRSQGSEDHGRVSDNCM*
536 >lcl|XP_544297.2|Plus11491331..1493706 NW_876292 protocadherin beta-2 PCDHB2 __SEG__ Chr2 {Canis lupus familiaris} MEAGDGKEHFLKQRQVLIFFVLLGVAQAASEPRHYSVAEEMESGSFVANLLKDLGLEVNELAERGARVVSKGKKMRLHLDRQTGDLLLNEKLDREELCGLVEPCVLPFQV
LLENPLQFFQADLRIRDINDHSPVFLDKEIILKISESITPGTTFLIERAQDLDVGSNSLQNYTLSPNSHFHLNLQDSPEGILPQLVLDKALDREERAEIRLTLTALDGGP
PPRSGTALVRIEVLDSNDNAPEFTKLFYEVQVLEDSPIGFQVAMVSARDLDIGTNGEISYVFSQASEEIRKTFQINATSGELFLTQKLDFESIQTYTLNIQATDGGGLSG
SCVVFVQVMDLNDNPPELTMSTFIDHIPENLQETITAVFSVSDPDSGDNGRMVCSIQDDLPFLLKPSVENFYTLVTNGALDRESQAEYNITITVSDLGTPRLKTQHNITV
TVSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRV
LVLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLH
VLLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYQYEVCLAGGTGTSEFKFLKP
IVPNFLGLGEERVSEANPFQG*
537 >lcl|XP_544298.2|Plus11499072..1501414 NW_876292 protocadherin beta-3 PCDHB3 __SEG__ Chr2 {Canis lupus familiaris} MEARGDSFLRQRQVLFLFVFLGVSLAESESRRYSVVEETERGFLIANLAKDLGLGVGELAVRGAQVVSKGNRQHIQLNHQNGDLLLHEKLDREELCGPTEPCVLHFQILL
QNPLQFITYELQVIDVNDHSPVFFEHEMQLKLLENTPPGTIIPLGNAEDLDVGRNSLQNYTVTPNSHFHVLTRSRRDGRKYPLLVLDKALDREEQPELILTLTALDGGSP
PRSGIAQVHIVVLDINDNAPEFTQSLYEVQVLENSPINSVLVTVSASDLDTGNLGTVSYAFFHASEEIRKTFQLNPITGDIQLVKYLNYEVMNTYEVDIEAKDGGGLSGK
TTVIVQVVDVNDNPPELTLSSIASPIPENSPETVVAVFSVSDPDSGDNGRIMCSIESNLPFNLKPSEENFYTLVTNGALDRESQAEYNITITVSDLGTPRLKTQHNITVT
VSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVL
VLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYRYEVCLAGGTGTSEFKFLKPI
IPSGLFQDTE*
538 >lcl|XP_544299.2|Plus11512849..1515236 NW_876292 protocadherin beta-4 PCDHB4 __SEG__ Chr2 {Canis lupus familiaris} METPERIQPNRQVMAFILMVFLSQARGEPIRYSVMEETESGSFVAHLTEDLGLGIGELAARSARVVSDDDKQRLQLDRQTGDLLLREKLDREELCGPVEPCVLHFQVFLE
TPVQFFEGELSIQDVNDHSPVFPTREMLLKIPENSPPGTLFPLKLAQDLDVGSNGLQKYTISPNSHFHVLTRNHSEGKKYPDLVQDKALDREEQPEFSLTLMALDGGSPP
RSGTTAVRILIMDVNDNAPEFVHSPYEVQVLENSPIDSPVLSVSARDADAGNFGSVSYGLFQASDEIKQTFSINEVTGEIRLTKKLDFEQIKSYHVEIEAVDGGGLSGKG
TVVIYVVDMNDNAPELTISSVTSSIPENAPETVVSVFRIRDRDSGDNGKMICSIPENLPFLLKPTFKNFYTLVTESPLDRESQAEYNITITVSDLGTPRLKTQHNITVTV
SDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVLV
LDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHVL
LVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYQYDVCLTGVPRTGEFKFLKPIF
PNLLIEDSEREIKENSNCRNSFVFS*
539 >lcl|XP_544300.1|Plus11527735..1530122 NW_876292 protocadherin beta-5 PCDHB5 __SEG__ Chr2 {Canis lupus familiaris} METALTKTPQKRQVIFLAILLLLWEAGSDAIRYSMPEETESGSFVANLAKDLGLRVGELTTRGARIHYKGNRQLLQLDMETGNLLLYEKLDREVLCAATDPCILYFQLLL
ENPVQFFQADLQLTDINDHSPEFLDKEMLLKIPEIVQPGTIFPLKIAQDLDIGINTVQNYTISSNSHFHVVTRNRGDGRKYPELLLDKALDREEQSEFRLTLTALDGGAP
PRSGTTAVRIEVVDINDNAPEFLQSLYEVQIPENSPLNSLVVAVSAQDLDEGAYGNVVYTLFQGDEVTQPFVIDEITGEIRLTKALDFEATRHYNVEIAGTDGGGLSGKC
TVAIEVVDVNDNAPELTMSTLASSTPENSPETVVAVFSVSDPDSGDNGRMVCSIQNDLPFLLKPTFKNFYTLVTERPLDRESQAEYNITITVSDLGTPRLKTQHNITVTV
SDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLRPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVLV
LDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHVL
LVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYRYEVCLAGGTGTSEFKFLKPVI
PKFSPHGSGEEIEESTTFRNSFGFN*
540 >lcl|XP_544301.2|Plus11540962..1543352 NW_876292 protocadherin beta-6 PCDHB6 __SEG__ Chr2 {Canis lupus familiaris} MEMAQTKVHRKKRQVAILIIWMLLWEAGSEPIQYSVLEESESGTFVANLTKDLGLRKGEMAARGAQVVFKGNRQCLQLDPQTYDLLLNEKLDREELCGSTEPCVLPFQVL
LENPLQFFQATLRVRDINDHAPEFPAREMLLKISEITTPGKLFPLKMAQDLDAGSNSLQSYTISSNPHFHVLTRNRSDGRKFPELVLDKALDREEQPELRLTLTALDGGS
PTRSGTVEIQILVLDINDNAPEFAQELYETQIPENSTLGSLIITVSARDLDAGPFGEVSYALFQVDDVNQPFEIHAITGEIRLRKTLDFEEFQSYHVDIEATDGGGLSGK
CSLVIKVLDVNDNTPQLTMSSFTSAIPENLPEIIVAVFSVSDADSGQNQQVICSIDDNLPFLLRPSVENFYTLVTNGALDRESQAEYNITITVSDLGTPRLKTQHNITVT
VSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLRPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVL
VLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQGYQYEVCLAGGTGTSEFKFLKPI
IPNFVGEGAGRATEENSNFRDHFGFS*
541 >lcl|XP_544302.1|Plus11554523..1556916 NW_876292 protocadherin beta-7 PCDHB16 __SEG__ Chr2 {Canis lupus familiaris} MEAIVAPAVQKRQVFFLCVFLGVSWAGTEPLQYFVAEEMERGTFLANLAIDLGLEPGEVSARGCRIVSDENIRFLLLNPLTGDLLLNEKLDREKLCGPTEPCVLPFQLLL
EKPFQIFRAELWVRDINDHSPVFLDKEISLNILESTTPGVTFLLERAEDSDVGINNLRNYTISSNIYFHIDVRDSGEGNVYPELVLDRVLDREEVSELSLTLTALDGGSP
PRSGTTLIHILVLDVNDNVPEFVQSLYRVQVPENSPVGSLVVAVLARDLDAGSNGEIVYAFSYATDRILKTFRINSTSGKLYLKAELNYEAIQTYTLTIQAKDGGGLSGK
CTVVVHVTDINDNPPELLMSSLTSPIAENSPDTVVAVFRIRDRDSGNNAKMVCSIQDDLPFILKPSVENFYTLVTESPLDRESQAEYNITITVSDLGTPRLKTQHNITVT
VSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVL
VLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYRYEVCLAGGTGTSEFKFLKPI
LPNLPPQCPGKETEENPNFRNSFGFNI*
542 >lcl|XP_544306.1|Plus11584301..1586688 NW_876292 protocadherin beta-15 PCDHB15 __SEG__ Chr2 {Canis lupus familiaris} MEAGGECFPEQRQVLILFLLLGEALAGWESRRYSVMEETESGSFVANLAKDLGLGVGELAARGARVVSEDNEPGLQLDLQTGELVLSEKLDREEMCGSTDPCVMHFQVLL
KNPLGVFRAELLVRDINDHSPEFPEREMTLKILETSPPGTVFALKKAQDLDVGNNNIQNYSISPNSHFRVSTRTRGDGRKYPELVLVKELDREEQAELRVTLTALDGGSP
PRSGAAQVRILVLDVNDNAPEFVQKLYQVQVPENSPVGMLVVKVSARDLDTGTNGEISYSYFYSSQEISTTFELNNFSGEVRLIKKLDFETISSYELEIEASDGGGLSGR
CSVSIEVVDVNDNFPELTISSLTSPIPENSPETEVALFRVRDRDSGDNGKMTCCIQDDLPFLLKPSEENFYTLVTNGALDRESQAEYNITITVSDLGTPRLKTQHNITVT
VSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVL
VLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYQYEVCLAGGTGTSEFKFLKPI
FPNIVSHDLGRKSEGNPTFQSNFPE*
543 >lcl|XP_544312.1|Plus11726926..1729400 NW_876292 protocadherin gamma-A10 PCDHGA10 __SEG__ Chr2 {Canis lupus familiaris} MAARRNRSHRTALVLLCLFLRLSWEAEARQIRYSVPEELEKGSFVGNIAKDLGLEPWELAERGARIVSRGRTQLFALNPRSGSLVTADRIDREELCAQSARCLVNFNILV
EDRVKLFGIEIEVTDINDNAPKFQAENVDVKINENVAPGMRFPLLEAVDPDVGENSLQSYQLSSNKHFSLAVQSRASGVKYPELVLEHALDREEEAVHHLVLTALDGGDP
LLSGTVLISVTVFDTNDNAPVFTLPEYRVSVLENLPVGTHLLRVTATDKDEGANGEVTYSFRKSPDTQLLKFQLNKNTGEIKLSEDLDYEETDFYELEIQAEDGGAYHAM
AKVFITVEDVNDNSPEVTVTSLFSPLLEDSPLGTVIALLNVHDPDSGQNGQVTCSISGDLPFKLEKSIDSYYRLVTHRTLDREQVSSYNITVTAMDGGNPPLLTDTHFTL
QVADINDNPPTFSHISYFTYILENNPRGASIFSVTALDPDSKENAQVIYSLAENTFQEAPLSSYISINSDTGVLYALRSFDYEQFRDLQIQVIATDSGDPPLSSNMSLSI
FVLDQNDNAPEILYPTLPIDGSTGVELAPRYAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFQVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAIADSIPDVLADLGSLEAPRDSQASDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHVSRLLQAAGGGLLGAPASASQFVGVDGVRAFLQTYSHEVSLTAGSRESHV
IFPQPNYVDTLLSQESCEKKDRLSLLDDSKFPIEDTPLAPVSFTLFKNYNWYHF*
544 >lcl|XP_544329.2|Plus1complement(6255371..6256627) NW_876292 probable G-protein coupled receptor 151 GPR151 __SEG__ Chr2 {Canis lupus familiaris} MLAAALAASNSSTMNVSAHLHFVGGYVPSDSKDWRTIVPALLVAVCLVGFMGNVCVIGVLLHSAWKGKPSMIHSLILNLSLADLSLLLFSAPVRATAYFKGVWDLGWFVC
KSSDWFIHTCMAAKSLTIVAVAKVCFMYASDPAKQVSIRSCTIWSVLVAIWAVASLLPLPEWFFSTTRLHAGVEVCLMDVPPMAEEFMATFGKLYPLLAFCFPSLFASFY
FWRAYGQCKKRGTKTQNLRNQLRSKQLTVMLLSIAVTSAVLWLPEWVAWLWIWHVKAGGPAPPQGFIALSQVLLFSISSANPLIFLVMSEEFKEDLKSLWRWMITRKQPT
ASESQKTPAGNSEVPPDNAPSPESPASIPEKEKTGSPSSNTEKTEKAQVPILPDVEQFWHERDTVPCVQENDPIPWEREDQETGDCDK*
545 >lcl|XP_544373.3|Plus1complement(22533950..22535719) NW_876292 ectoderm-neural cortex protein 1 ENC1 __SEG__ Chr2 {Canis lupus familiaris} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
546 >lcl|XP_544399.2|Plus1complement(25781883..25782638) NW_876292 calpain small subunit 2 CAPNS2 __SEG__ Chr2 {Canis lupus familiaris} MFLAKALLEGADRGLGEALGGLLGGGGQRRGGGGGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTNVEANESEEVRRFRQQFAQLAGPDMEVGATDLMNILNKV
LSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDRSGSLGSSQLRAALQAAGFQLNEQLYQMIIRRFADEDGSMDFNNFISCLVRLD
AMFRVFKSLDRDADGLVQVSIQEWLQLTMYS*
547 >lcl|XP_544462.2|Plus137628218..37629249 NW_876292 platelet-activating factor receptor PTAFR __SEG__ Chr2 {Canis lupus familiaris} MAMANDSSHVDSEFRYTLFPIVYSIIFVLGVVANSYVLWVFACLYPSKKLNEIKIFMVNLTMADLLFLVTLPLWIIYYHNQGNWILPSFLCNLAGCFFFINTYCSVAFLA
VITYNRFQAVTRPIKTAQATTRKRGFLVSLVIWVAIVAAASYFFILDSTNVVPSKSGSGNITRCFEHYEKGSVPVLIVHVFLVFGFFLVFLIIFFCNVVIIRRLLMQPVQ
LQHNAEVKRRALWMVCTVLAVFIVCFVPHHLVQLPWTLAELGFQSSSFHQGINDAHQVTLCLLSTNCVLDPIIYCFLTKKFRKHLTEKFHSIRGSRKCSRATSETGTEVV
MPLSQVPVKSLKK*
548 >lcl|XP_544470.1|Plus1complement(38256121..38257110) NW_876292 G-protein coupled receptor 3 GPR3 __SEG__ Chr2 {Canis lupus familiaris} MWGAGSPLAWLSAGSGNVNVSSVGSAEGPTGPGAPLPSPRAWDVVLCISGTLVSCENALVVAIIVGTPTFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLV
LVGVLAMAFTASVGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDARATCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVC
RHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPSLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAICCCCSSSKIPFRSRSPSDV*
549 >lcl|XP_544490.3|Plus139468217..39469263 NW_876292 LOW QUALITY PROTEIN: membrane progestin receptor alpha PAQR7 __SEG__ Chr2 {Canis lupus familiaris} MATMVAQKLSHLLPTLRQAHQEPQPSGQPEPVFTVDRAEVPPLFWKPYIYVGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAVFAGTVDFWGDPHALPLF
IIVLASFTYLSLSALAHLLQAKSEFWHYQLLLPGLRGRGRVPVRQRPGALLLRHRARLARPGADHLPAHGRLSRLAFLHRLLLQQV*PETWPAGPHLPGGALRAGLRAGH
QPRGAPHPGVPRPHGR*PSSSLPQVPGGLLPAGCCVLLSLRA*ALVSWQLPRLWPGPPALPRIPGAVHPGSAGGRGPGLRGPAAHL*ASARPLASQLLWPLPAHGGQQCP
DRVPAEPAGAAQTRPEDPV
550 >lcl|XP_544580.3|Plus1222123..223061 NW_876294 olfactory receptor 4F3/4F16/4F29 cOR4F25 __SEG__ Chr30 {Canis lupus familiaris} MGGANHSVVSEFVFLGLTNSWEIQLLLFVFSSMFYVASMMGNSLIMLTVTFDPHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKRKVISFGGCITQIFFLHVIGGV
EMMLLIAMAFDRHVAICKPLHYLTIINRKMCILLLVAAWVVGLAHSMIQLVFVIKLPFCGPNVLDSFYCDFPRFIKLACTDTFSLEFMVTANSGFISLGSFFILIVSYSF
ILITVRKHSSRGSSKALSTLSAHIMVVILFFGPCIFVYIWPHPTSCLDKFLAVFDAVLTPFFNSVIYTLRNKEMKVAMSKICSQFIIYRRIS*
551 >lcl|XP_544597.1|Plus1complement(980319..981917) NW_876294 muscarinic acetylcholine receptor M5 CHRM5 __SEG__ Chr30 {Canis lupus familiaris} MEEEPYHNTSTVNGTPVSHQPLEHHGLWEIITIAAVTAVVSLVTIVGNILVMISFKVNSQLKSVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWVLGSLACDLWLALD
YVASNASVMNLLVISFDRYFSITRPLTYRAKRTPRRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPPDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRET
EKRTKDLADLQGSDSMAEAEPRKPAQKALLTSCFSCPRPTLAQRERNEASWSSSHRSTSTTGKPSQAMGPSTEWAKAEQLTTCSSCPSSEDEDKSTADPVFQVVYKSQTK
ESPREEFSAEETKETFVEAQAEKNDYDTQKYFLSPGAAHRSKSQKCVAYKFQLVVKADGTQEANNSCHKVKIMPCSFPVSKDPSTKGLDPNLSHQMTKRKRMVLVKERKA
AQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQANSKLP*
552 >lcl|XP_544767.3|Plus137292750..37294993 NW_876294 immunoglobulin superfamily containing leucine-rich repeat protein 2 ISLR2 __SEG__ Chr30 {Canis lupus familiaris} MVPARALWLAWALLGVAAACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNL
ISSFPWSDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCSLVWLQTWAASTRVSLPEPDSIACASPPALQGV
PVHRLPALSCVPPSVRLSAEPPPEAPGSPLPAGLALMLHCVAEGHPTPRLQWQLQIPGGTIVLEPPVPSGEDEGLGAEDREEEGDGDGPTQTEAPTPTPAPAWPAPPANP
RFLALTNGSLLVPLLSAKEAGIYTCRAHNELGANSTSLRVAVAAAGPPKHAPGAGGDSEGQAPTSERKSTAKGRGNSVLPSKPEGKVKGQGLARVALGEAEAGPEEEEEA
EAEAGEGEEAEDQVSAHPVEEQRCGHGDPSRYVSNHAFNQSSELKQHVFELGVIALDVAEREARVQLTPLAARWGSGPGGPGRPGRRPLRLLYLCPAGGGAAVQWSRVEE
GVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFATKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSY
PAGGGADAGGPEEASGEGLDEDAEQGDPGGDLQREESLAACSLAESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYKQTAG*
553 >lcl|XP_544768.1|Plus137326086..37327372 NW_876294 immunoglobulin superfamily containing leucine-rich repeat protein ISLR __SEG__ Chr30 {Canis lupus familiaris} MPELRLLCWALLLGLARACPEPCDCGEKYGFQIADCAYRDLEAVPPGFPANVTTLSLSANRLPSLPEGAFREVPLLQSLWLAHNEIRAVAAGALAPLGHLKSLDLSHNLL
SDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGIFTPLTALSHLQINDNPFDCTCGIVWFKTWALTAAVSIPEQDNITCTSPHVLKGTP
LSRLLPLPCSAPSVQLTYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVEIASPNVGADGRALPGAPAASSRPRFQAFANGSLLIPDFGKPEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDVLGRRFHGKAAEGKGCYTVDNEVQPSGPEDNVVIIYLSRAGAPEAAAAGEGVPGQQPPGLLLLGQSLLLVLLTSF*
554 >lcl|XP_544900.1|Plus1complement(35705578..35708751) NW_876295 zinc finger protein 295 isoform 1 ZNF295 __SEG__ Chr31 {Canis lupus familiaris} MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLAAVQELGYSLG
ISFLTNIVSKTPQAPFPTCPNRKKIFIEDDESSSQKRSVIVCQSRNEAQGKTVSQNQPDLSHTSRPSPSAAAKTSTSKPHVPKAAEPLHSLPLADKSWPKDGSVGYAKPL
EHSGPLDDPSRSSLVKRSAPPPSKPPQDREPMDEKAGLSSQLPKGKAIELALKRPRPPVLSLGGSTETPYVLKETHRGGGPGEDRNLLYYSKLGLVVPSSGSGSGKPGID
RSGPLVKSLLRRSLSMDSQVPVYSPSIDLKPSPGPPSAASDVPGAVFCAVAQKAPVKDCGEKAAPEERSPAPQPHRLRSFSASQSTEREGEPAVTEVRIKTEPRSPLADP
SDIIRVTVGDPAAATRDLPLKTEDDQKDASRLPAKRRLRTDRRPPLKKVREDEPGSPVSAESFQGGPSPPLPDGEFPDSDLNKDEFGELEGTRPNKKFKCKHCLKIFRST
AGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGIVKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRSKPGFQGQSSSQAQAIKRNLRSRAKGA
YICTYCGKAYRFLSQFKQHIKMHPGEKPIGVHRAAKPKEHVALESPVENKEVYQCRLCNAKLSSLLEQGNHERLCRNATVCPYCSLRFFSPELKQEHESKCEYKKLTCLD
CMRTFKSSFSIWRHQVEVHNQNTMAPAENFSLPVLDHNGDVAAASRPQAQPEPGKANHAVTAKDDTAFSDCSEHVNFDSEDSSCLPEDLSLSKQLKIHVKEEPAEEAEEE
APEARAAPKEAGSSKDSSLWPCEKCGKTFTAHKQLERHQELLCSVKPFICHVCNKAFRTNFRLWSHFQSHMSQATEEPAHKDSEACPAPTNSPSPPPLPPPPPLPKIQPL
EPDSPTGLAEHPAPSTEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHRTFKTAFSLWSHEQSHN*
555 >lcl|XP_544925.3|Plus137587328..37588101 NW_876295 leucine-rich repeat-containing protein 3 LRRC3 __SEG__ Chr31 {Canis lupus familiaris} MGPVGRQSPAPLPVPAGGSCLILLFCLRLGAPCPQSCQCPEHAGAVAVHCSARGLQEIPRDIPANAVLLKLDANKIAHVPNGAFQHLNQLRELDLSQNTIETIGPAAFAG
LAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPESVDEIACHTAAREEYVGKPLIQALDSGVSFCSTHHKTTDVAMLVTMFGWFAMVIT
YVVYYVRQNQEDARKHLEYLKSLPSAPVAKDPVSPVP*
556 >lcl|XP_545064.3|Plus15080750..5081673 NW_876298 olfactory receptor 5AC1-like LOC487942 __SEG__ Chr33 {Canis lupus familiaris} MAEENKTQMIEFVLTGLTGHPGPQIPLFLVFLVIYLITMVGNLGLVALIRKDPHLHTPMYLFLGSLAFADACTSSSVTPRMLINFLSKNHVISLFDCMAQFYIFGSSATT
ECFLLVVMAYDRYVAICNPLLYPVMMSNNLCTQLIGVSYFVGFLHSAIHVGLLFRLTFCRSNEIHSFYCEILQLFKISCTDPTVNTLLVLIFSAFIQIFTFMTIMVSYTC
VLFAILKKKSEKGRSKAFSTCSAHLLSVSLFYGTLFFMYVRPGSGHTEDDDKMYSLFYTIIIPLLNPFIYSLRNKEVIDALRRIIKK*
557 >lcl|XP_545065.3|Plus15174163..5175092 NW_876298 olfactory receptor 5H1 OR5H2 __SEG__ Chr33 {Canis lupus familiaris} MEKENATLLTELILTGLTYEPQWHIPLFLVFLVIYLLTIVGNLGLIALIWNDPQLHIPMYLFLGSLALVDAWISSTVTPKMLVNFFAKRKVISLSECMIQFFSFAISITT
ECFLLATMAYDRYVAICKPLLYPVIMSNTLCIRLLVLSLLGGLLHAIIHSSFLFRLTFCDSIIVHHFYCDIIPLLKITCTDPSINYLIVFIFAGSIQMFTILIVLVSYTL
VLFTILRKKSLQGIKKAFSTCGAHLFSVSLYYGALVFMYVRPVAAQSEDQDMMDSLFYTIIIPFLNPIIYSLRNQKVIDSLRKTLKRNS*
558 >lcl|XP_545069.1|Plus15367349..5368431 NW_876298 G-protein coupled receptor 15 GPR15 __SEG__ Chr33 {Canis lupus familiaris} MDPEATPVYLDYFEATSENPDVEDAHSHGPYTSVFLPIFYTAVFVAGVLGNLVLIAALHFKRGSRRLIDIFITNLAVSDFVFLVTLPLWVDKEASFGLWRTGAFLCKGSS
YTISVNMHCSVFLLTCMSLDRYLAIVRPATSRKLRRRDCAHAACALVWLASCLLALPTVLSRELTLIEEKPYCAEKRATSTKLTWALVALVFTFFVPLVSIVTCYCCIVR
KLCAHYQQSGKHNKKLRKSIKIIFIVVAAFVLSWLPFNTFKLLAIVSGLQQEVYFSSAFLQLGMEVSGPLAFANSCVNPVIYYVFDSYIRRAIVRCLCPCVKNYDFGSSS
ETLDSHLTKALSNFIHVEDFTRRRKRSVSL*
559 >lcl|XP_545164.2|Plus119036946..19038790 NW_876299 leucine-rich repeat-containing protein 15 LRRC15 __SEG__ Chr33 {Canis lupus familiaris} MEFKGKPDVGLNPQQCGEVILTRLLSPLAETMPLKHYLLLLVGCQAWSAGLAYYGCPSECTCSRASQVECTGARIVAVPAPLPWNAMSLQILNTHITELNESPFLNISAL
IALRIEKNELSHIMPGAFRNLGSLRYLSLANNKLQVLPIGLFQGLNNLESLLLSSNQLVQIQPAHFSQFSNLKELQLHGNHLEYIPDGVFDHLVGLTKLNLGKNSLTHLS
PRIFQRLGNLQVLRLYENRLSEIPMGTFDGCGNLQELALQQNQIGMLSPGLFHNNRNLQKLYLSNNHISQLPPGIFMQLPQLNRLTLFGNSLKELSPGIFGPMHNLRELW
LYDNHITSLPDNVFSNLHQLQVLILSRNQINYISPDAFNGLVELRELSLHTNALQELDGSVFRMLVNLQNISLQNNRLRQLPGNIFANVNGLMTIQLQNNQLENLPMGIF
DHLGNLCELRLYDNPWRCDSDILPLHNWLLLNKPRLGTDTLPVCFSPPSVRGQSLIIINVNVAVPSVQVPMIPEVPSYPETPQYPDTPSFPDTTSVSTTEFTSPVEDYTD
LTTIEVTDDRSTWGMTQAQSGLAIAAIVIGIIALACSLVACICCCCCKKRNHTVLMQMKAPNEC*
560 >lcl|XP_545165.2|Plus119055407..19057050 NW_876299 carboxypeptidase N subunit 2 CPN2 __SEG__ Chr33 {Canis lupus familiaris} MLPRAWLRWACLLLLARCARPCPAGCDCFAQELFCSDAGLAAVPPDIPPLATDIVFVETSLSALGSRAFSGSPNLTKVVFLNAPLQHLGPDAFGGLPRLQDLEVTGGAFT
NLSSAAFSNLTSLGKFTFNFNLLEALPEGLFGHMEALESLQLQGNRLQSLPRRLFQPLTRLQSLNLAQNLLAHLPEGLFDPLGSLQTLRLSDNALSGLPPGVFGGLHSLR
ELFLDGNSISELPPGVFSRLFRLEQLWLQRNAIGHLPLSVFSSLGNLTFLSLQGNALRVLPAGLFAPTPGLLVLSLSYNKLEAVSEGAFANLSSLSSLTLSHNAITHLPA
GVFRGLEGLVKLYLGSNNLTALHPTLFQNLSNLELLSLSRNLLTTLPTGIFDSNYNLFNLALHGNPWQCDCHLAYLFQWLYQYSDRLFNIQTYCAGPAYLKGQVLPALKE
EQLVCPVTRDHLGFQAPGPGHGDPGSSWDLGVEERAVWSRCTYSNPEGTVVLACDEARCRWLNIQLSPRQGSGPPGMTYNASQGWDLKSSCGSVRVTVAIEAQPGGH*
561 >lcl|XP_545434.2|Plus125213082..25214059 NW_876302 olfactory receptor 2G6-like LOC488312 __SEG__ Chr35 {Canis lupus familiaris} MESSFLHRQSARERANDSTFSGFLLLGFSNRPQLETPLFVLILIVYFLSFLGNGTIILLSWMDPRLHTPMYFFLSNLSFMDLCLTTCTVPQTLANLQGRVKTITYGGCVT
QLFIALGLGGVECVLLAVMAYDRYAAVCRPLHYLAIVHPQLCLWLVLTAWFTGFGNSVLQTALTMILPLCGRNQLDHFFCEVPVMLKLSCADTSFNQAELFTVSVFFLVV
PLSLILLSYGHITRAVLKIKSAQGRQKAFGTCGSHLMVVVIFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLLNPLIYTLRNKEVKGALRRLLRVTMDSRRS*
562 >lcl|XP_545435.3|Plus1complement(25234114..25235073) NW_876302 putative olfactory receptor 2B8 cOR2Y2 __SEG__ Chr35 {Canis lupus familiaris} MEQNNGSSFTGFILLGFSERPQLELVLFVVLLIFYMFTLLGNTTIIALSHLDPLLQTPMYFFLSNLSFLDLCYTTSTVPQLLVHLRRADKSISFGGCVVQLFISLGLGST
ECILLGVMALDRFAAVCRPLHYTVIMHSRLCVLMASASWFIGFANSSLQTVLIFLVPLCGRNKIDHFFCEIPPLLNLACVDTTIYESEIFFVSVIILFIPVTLITVSYGW
IVRAIFRIKSSAGQRKAFGTCGSHLTVVSLFYGTAIYAYLQPSNNYSQDQGKFISLFYTIITPMVNPVIYTLRNKDVTGAMKKVLWRVLTPDDWVGKTL*
563 >lcl|XP_545460.1|Plus126198038..26198976 NW_876302 olfactory receptor 10C1-like LOC488338 __SEG__ Chr35 {Canis lupus familiaris} MSTNSSVVTEFILVGFSHLANLQGWLFTFFLAVYLLTVAGNLLIVLLVSTDSALQSPMYFFLRMLSALEISYTSVTMPLLLHHLLTGQRRIPRSGCALQMFFFLFFGATE
CCLLAAMAYDRYAAICKPLRYTLLLSPRVCLQLAGLAWACGAMVGLGHTSFIFSLPFCGPNAIPHFFCEIQPILQLVCGDTSLNELQIILAAALIILCPFGLILGSYGHI
LATIFRMPSVAGRRKAFSTCSSHLLVVSLFYGTAIFIYIRPKASYNPATDPVLSLFYAVVTPILNPIIYSLRNADVKAALRRTFQKMKPADT*
564 >lcl|XP_545599.2|Plus111055204..11056928 NW_876304 frizzled-7 isoform 1 FZD7 __SEG__ Chr37 {Canis lupus familiaris} MRGPGAAAARSPLGLCTLALALLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC
TVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGGPTAYPTAPYMPDLPFTALPPGAADGRGRAAFPFSCPRQLKVPPYL
GYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQG
TKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFL
LAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWS
GKTLQSWRRFYHRLSHSSKGETAV*
565 >lcl|XP_545614.2|Plus1complement(16123537..16125306) NW_876304 frizzled-5 FZD5 __SEG__ Chr37 {Canis lupus familiaris} MARPDPCAPPSLLLLLLAQLLGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCE
RAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPAGGPASGAECAAGAPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAV
PCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASS
IWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKT
DKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRARRGHKSGGA
TAAGDYEASAALTGRTGPPGAPPAAAAAAYHKQVSLSHV*
566 >lcl|XP_545641.1|Plus124941825..24942817 NW_876304 G-protein coupled bile acid receptor 1 GPBAR1 __SEG__ Chr37 {Canis lupus familiaris} MTPNSTREEPSPVPAGALGLSLALASLIVAANLLLALGIARDRHLRRPPAGCFFLSLLLAGLLTGLALPALPGLWSQSRRGYWSCLFLYLAPNFSFLSLLANLLLVHGER
YVAVLRPLRPRGSPRLALLLTWAGPLLFASLPALGWNHWAPGANCSSQAVFPAPYLYLEVYGLLLPAVGAAALLSARVLAAAHRQLQDIRRLERAVCRGAPSALARALTW
RQAKAQAGATLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLMSLGSASAAAVPVAMGLGDQRYTAPWRAAARRWLQGLQGRAPRGGPGPGSAYHTGSQSSVDLDLN
*
567 >lcl|XP_545681.1|Plus1complement(1164528..1166666) NW_876305 leucine-rich repeat neuronal protein 2 LRRN2 __SEG__ Chr38 {Canis lupus familiaris} MRLLVAPLLLAWVASATAAVPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFLTAVPPGLPAGTQTLLLQSNSIMRVDQSELNYLANLTELDLSQNSFSDARD
CDFRALPRLLSLHLEENRLTRLEDHSFAGLASLQELYLNHNQLYRIAPRAFAGLGNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVL
AGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFIHPRA
FHHLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCVEPPDLQRRPVREVPFREMTDHCLPLISPRSFPPSLQVASGDS
LALHCRALAEPEPEIYWVTPAGVRLTAARAGRKYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADSKTVSVAVGQAPLQPGRDKGWGLELRVQETHPYHILLSWVPPPN
TVSTNLTWSSASSLRGQGAPALARLPRGTHSYNITRLLQATEYWACLQVAFADAHTQLACVWTRTKEATPCHRALGDRPGLIAILALAVLLLAAGLAAHLGTGQPRQGVG
GRALLPAWAFWGWSTPSVRVVSAPLVLPWNPGRKLSRSSEGEMLSPPLLQNS*
568 >lcl|XP_545728.3|Plus123278313..23279257 NW_876305 olfactory receptor 10K2 OR10T2 __SEG__ Chr38 {Canis lupus familiaris} MEQGNETLVREFIFLGFSSLAGLQRLLFVAFLPLYLFTLGTNAIIISTIVLDRALHTPMYFFLAVLSCSETCYTFVIVPKMLVDLLAQKKTISFVGCAIQMFTFLFLGCS
HSFLLAAMGYDRYVAICNPLRYTELMGHRVCVGLVATACACGLTIAQIITSLVFYLPFRSSNQLHHYFCDIPPVLKVASQHTHLSQIVIIMLCALVLVIPLLLILVSYIH
IISAIIQFPSTLGRYKAFSTCASHLIVVTIHYGCASFIYLRLKSTYSSSQDALISVSYTMLTPLFNPLIYSLRNKEFRSALHRAVRKIIFLPQC*
569 >lcl|XP_545729.2|Plus1complement(23249694..23250635) NW_876305 olfactory receptor 10K2-like LOC488612 __SEG__ Chr38 {Canis lupus familiaris} MERGNETLVREFIFLGFSSLAGLQRLLFVAFLPLYLFTLGTNAIIISTIVLDRALHTPMYFFLAVLSCSETCYTFVIVPKMLVDLLAQKKTISFVGCAIQMFTFLFLGCS
HSFLLAAMGYDRYVAICNPLRYTELMGPRVCVGLVAAACACGLTIAQIVTSLVFHLPFLSSNQLHHYFCDISPVLKVASHHSRLSQLVIFMIGVCVLVVPLLLILVSYIR
IISAILKIPSSTGRYKAFSTCASHLIVVTVHYGCASFIYLRPKSSYSSSQDTLISVSYTILTPLFNPMIYSLRNQEFKAAFRRVMGQTLYPPH*
570 >lcl|XP_545732.1|Plus1complement(23135265..23136206) NW_876305 olfactory receptor 10Z1 OR10Z1 __SEG__ Chr38 {Canis lupus familiaris} MGQANATIWRGFVFLGFSSFGELQLLLFALFLSLYLVTLTSNVFIIVVIRLDSHLHSPMYFFLSFLSFSETCYTLGIIPRMLSSLVMGSQAISYEGCAAQMFFSASWACT
NCFLLAVMGFDRYVAICAPLHYTSHMNPTFCAQLVGTSFLTGYLFGLGMTLVIFQLPFCGSHEIQHFFCDTPPVLSLACGDTGPSELGILILSLLVLLVSFCSITISYAY
ILTAILRIPSAKGRKKAFSTCASHLTVVIVHYGCASFMYLRPKASYSLERDQLIAVTYTVVTPLLNPIVYSLRNRAVQTALRSAFRGKLLGRG*
571 >lcl|XP_545735.2|Plus123006522..23007472 NW_876305 olfactory receptor 6N1 OR6N1 __SEG__ Chr38 {Canis lupus familiaris} MSGEPWTPGNWSWVTEFIILGFPHVQGVQAYLFVLLLLIYVTTVLGNLLIFLVVRLDPRLHTPMYHFVSALSLLELGYTAATIPKMLSNLLSEEKTISFSGCLLQIYFFH
SLGAAECYLLTAMAYDRYLAICQPLHYPTLMTPALCARIAVGCWLGGLAGPVAEISLVSRLPFCGPNHIQHIFCDFPPVLSLACTDTSVNVLVDFVINSCKILATFLLIL
SSYVQIIRTVLRIPSVAGKTKAFSTCASHLTVVLIFYGSILFMYVRLKKSYSLDYDRALAVIYSVLTPFLNPFIYSLRNKDIKEAVRRQLRRSGIL*
572 >lcl|XP_545736.2|Plus122994976..22995929 NW_876305 olfactory receptor 6N2-like LOC488619 __SEG__ Chr38 {Canis lupus familiaris} MERHNRSSLVEFVLLGFPKVGHVRGWLFVLLLLAYLFTICGNMLIFLVIRLDAALHTPMYHFVSVLSVLELWYTATTIPKMLANLLSEKKTISFAGCLLQTYFFHSLGAS
ECYLLTAMAYDRYLAICRPLHYPAIMTPTLCSKMAAGCWTCGFLCPISEVILVSRLPFCGYNEIQHIFCDFPPLLSLACKDTSTNVLVDFAINAFIILITFLFIMVSYGR
IIGAVLKIKTAAGRRKAFSTCASHLTVVLIFFGSIIFMYVRLKKSYSLTLDRTLAVVYSVLTPLVNPIIYSLRNKELIKAIKRTVFRKGERASPTHH*
573 >lcl|XP_545741.2|Plus122690585..22691517 NW_876305 olfactory receptor 10J3 LOC488624 __SEG__ Chr38 {Canis lupus familiaris} MPNSTAVTEFLLEGFSSFGWQHRLVFFAVFLTLYLLTLCGNVIIVTIIHLDRHLHTPMYFFLSMLSLSETCYTVAIIPRMLSGLLNPHQPIAVQGCATQLFFYLTFGINN
CFLLTAMGYDRYVAICNPLRYSVIMSKETCVQLAYGSLGIGLSMAIIQVTSVFGLPFCDAFVISHFFCDVRPLLKLACMDTTVNEIINFVVSVCVLVLPMGLVFISYVLI
ISTILKITSAEGRKKAFATCASHLTVVIIHYGCASIIYLKPKSQSSLGQDRLLSVTYTVITPLLNPVVYSLRNKEVKDALHRAVGRNLSS*
574 >lcl|XP_545744.1|Plus122544301..22545260 NW_876305 olfactory receptor 10J5-like LOC488627 __SEG__ Chr38 {Canis lupus familiaris} MQRKNFTEVTDLIFLGFSIFGKHQLTLFVVFLTVYILTLTSNVIIVTIIRVDRHLHTPMYFLLSMLASSETVYTLVIVPRMLSSLLFHNQPISLAGCATQMFFFVTLATS
NCFLLTAMGYDRYLAICSPLWYTVLMSKGVCATLVCGSFGTGLAMAVLHVAAMFNLPFCGTVVEHFFCDIYPVMKLSCVDTTINEMINYAVSSFVILVPVGLIFISYVFI
ISAILKIASAEGRKKAFATCTSHLTVVIVHYGCASIAYLKPKSENSIEQDLLLSVTYTIITPLLNPVVYSLRNKEVKDALRRAVGKNIITDRIALSGDV*
575 >lcl|XP_545745.3|Plus1complement(22485136..22486059) NW_876305 olfactory receptor 10J5 OR12E11 __SEG__ Chr38 {Canis lupus familiaris} MQGHNLTEVTQFVFLGFSRFREHQTILFVVFLILYTFTLAGNAIIVTVVCTDRHLHTPMYVFLSVLAGSETAYTLVTIPRMLSGLLAQNQPISSAGCATQMFFIALAINN
CFLLTAMGYDRYVAICDPLRYTVVMSKRVCVQLMCGVSGIGLAMAVVQVTSIFTLPFCHRVIGHFFCDILPVLKLSCIDTTVNEIINFVVSSFVILVPVGLVFVSYVLII
STILRIRSAQGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENSIEQDLLLSVTYTIITPLLNPVVYSLRNKEVKDALRRAVGRNI*
576 >lcl|XP_545843.1|Plus1complement(12133202..12134971) NW_876307 ectoderm-neural cortex protein 2 KLHL25 __SEG__ Chr3 {Canis lupus familiaris} MSVSVHETRKSRSSTGSMNITLFHKASHPDCVLAHLNTLRKHRMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKH
DLEQRKAHLPELLRSVRLALLPSDCLKEAVSGEALLMADERTRLIIDEALRCKTKILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPAANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPS*
577 >lcl|XP_545942.3|Plus1complement(32372723..32374147) NW_876307 D(1B) dopamine receptor DRD5 __SEG__ Chr3 {Canis lupus familiaris} MLPPGRNGSAYRARFGQQQRAPRGAAGGAEGAAPLGPAQVVTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGA
FCDIWVAFDIMCSTASILNLCVISVDRYWAISRPFRYERKMTQRVALVMVGLAWTLSILISFIPVQLHWHRDKADPWGGVEPPSVLANGTPWEDAGEPEARAENCDSSLN
RTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSRAACAPDTSLRASIKKETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCSGRPEGPRAG
LPCVSETTFDVFVWFGWANSSLNPVIYAFNADFRKVFAQLLGCSHLCARTPVETVNISNELISYNQDTVLHKEIAAAYIHMIPNAVTPGDGEVDKQEESPFDRMSRISQA
SPDGDPAAESLWELDCEGEISLGKITPFTPNGIH*
578 >lcl|XP_546069.3|Plus1complement(506471..508243) NW_876310 muscarinic acetylcholine receptor M3 CHRM3 __SEG__ Chr4 {Canis lupus familiaris} MTLHTNSTTSPLFPNISLSWVHGPLDAGLPPGTVTHFGSYNISQAAGNLSSSNDTTSDPLGGHTIWQVVFIAFLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSL
ACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGE
CFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSLKRSARKKYGRCHFWFATKSWKPSTEQMDPD
HSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNATKLPSADNLQVPDEELGLGDLDRKGSKLQAQKSLDDGGSFQKSFSKLPIQLESAVDPTKM
SEVNSSAGKTTATLPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKT
FRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRMPEQAS*
579 >lcl|XP_546199.1|Plus124516499..24517626 NW_876311 neuropeptide Y receptor type 4 PPYR1 __SEG__ Chr4 {Canis lupus familiaris} MNISHFLALLLPGSPQGQNRSKLRGVPYNFSDHCQDSVDLMVFIVTSYSIETVVGVLGNLCLICVTIRQKEKANVTSLLIANLAFSDFLMCLICQPLTAVYTIMDYWVFG
EALCKVSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIAVIWLTACLLSLPFLVNSVLENVFHRNHSKAVEFLADKLVCTESWPRHHHRIVYTTSLLL
FQYCVPLAFILVCYARVYRHLRKRKRVFRKGTYSSRAWQMKRINGILVAMVVAFAVLWLPLHVFNSLEDWYHEAIPICYGNLIFLVCHLLAMASTCVNPFIYGFLNTNFK
KEVKALVLTCQQSAPVDESEHMPLSTVHTEVSKGSLRLSGRSNPI*
580 >lcl|XP_546227.2|Plus127251024..27252364 NW_876311 D(1A) dopamine receptor DRD1 __SEG__ Chr4 {Canis lupus familiaris} MRTLNTSTMDGAGLVVERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTAS
ILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSSSDGNATSLGETMDNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRI
AQKQIRRISALERAAVHAKNCQTTTGNGNPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGSGETKPFCIDSITFDVFVWFGWANSSLNPII
YAFNADFRKAFSTLLGCYRLCPTTNNAIETVSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGMARPLEKLSPALSVILDYDTDVSLEKIQPVTQ
NGQHPT*
581 >lcl|XP_546435.3|Plus19935755..9936687 NW_876312 olfactory receptor 145-like LOC489317 __SEG__ Chr5 {Canis lupus familiaris} MAAENSSVTEFILSGLTNQPGLQIPLFFLFLGFYVVTVVGNLGLITLIGLNSHLHTPMYFFLFNLSFIDFCYSTVITPKMLMNFVLRKNVISYAGCMTQLFFFLFFVVSE
SFILSAMAYDRYAAICNPLVYTATMSPQVCFLLLLGVYVMGFAGAMAHTVCMVRLTFCANNLVDHYMCDILPLLERSCTSTYVNELVVFIVVGIDIGVPTVTIFISYALI
LSSILRIHSTKGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKIALKKTLSKKPFS*
582 >lcl|XP_546436.3|Plus19952059..9952988 NW_876312 olfactory receptor 8B4 OR8B4 __SEG__ Chr5 {Canis lupus familiaris} MTLRNSSSATEFILVGLSEHPELQLPLFLLFLGIYVFTVVGNMGLITLIGLNSSLHTPMYFFLFNLSFIDLCYASVFTPKMLNGFVSENIISYVGCMTQLFFFCFFINSE
CYVLVSMAYDRYVAICNPLLYTVNMSPQVCSLLMFGSYVIGFAGAMAHTGSILRLTFCNSNIIHHYLCEVLPLLQLSCTSTHVNELVFFIIVGVVITISSISIFISYALI
LSNILRIPSAEGRSKAFSTCGSHIIAVALFFGSGAFTYLTTSFPGSMDQGKFASVFYTNVVPMLNPFIYSLRNKDVKLALGKTLRRVLL*
583 >lcl|XP_546437.3|Plus1complement(9977061..9977993) NW_876312 olfactory receptor 143 cOR8C4 __SEG__ Chr5 {Canis lupus familiaris} MAMENESSVTEFILVGFTDQSQLQLPLFFLFLLNYVVTVVGNLSFINLICLNSHLHTPIYFFTFNLSFIDLCQSLVITPKMLMNFVSEKNIISFTECMTQLVFFCFFAHS
ECYVLTAMAYDRYVAICQLLVYTVTMSPQVCSLLMFGSYVMGFAGAMVHTGDMVRLSFCDSNIINHYMCDIFPLYQLSCSSTYASELVDSIIVITVVIISSSIIFISYVL
ILSSVLHISSALGWSKTFSTCGSHIVTVGLFYGSGLFTHLKTSPSGSMGQGKFFSVFYTNIVPMLNPFIYSLRNKDVKCALKKTLKRIAN*
584 >lcl|XP_546444.1|Plus110159093..10160028 NW_876312 olfactory receptor 145-like isoform 1 LOC489326 __SEG__ Chr5 {Canis lupus familiaris} MDMGNSSLVTEFILVGLTKYSEIQLPLFFLFLGIYIVTVTGNLGLVALIGLNSHLHTPMYYFLFNLSFIDLCYSSVITPKLLVNFVSKLNTISYAGCMTQLFFYCFFVSA
ECYVLTVMAYDRYVAICKPLLYTVTMSPQVCSLLAMIVYVGAFIGAWAHTGCMLRLTFCDANSINHYMCDILPLLELSCTNTHLNELVVLIVVGFDVGVPSLTIIVSYTF
ILASILRIRSMEGRSKAFSTCSSHIIVVSVFFGSGAFMYLHPSSVLSMDQGKVSTVFYTIVVPMLNPLIYSLRNKEVKVALKKSLNRKTFS*
585 >lcl|XP_546448.3|Plus1complement(10205994..10206935) NW_876312 olfactory receptor 8D2 OR8D2 __SEG__ Chr5 {Canis lupus familiaris} MDTENHSSVTEFILEGLTDQPGLQLPLFVLFLLIYMVCIMGNMGLIFLIRISSQFHMPMYYFLSNLSFIDLCYSTVIIPKLLVNFVSEKNLTSFPECMAQLFFFCFFGID
DSYMLTAMAYDRYVAICNPLLYNVTMSNRICFLLVTSVYTVGAIGALVHTSYISSRSFCGTNIIHHYFCDILPLLNISCSRDSTKELLVMILVGFNVFACALAIFISYAF
ILSSILCIHSAEGRSKAFSTCSSHLAAVGVFYGSIIFMYFKPSSSNIIQEKVASVFYTTVIPMLNPLIYSLRNKDVKESLKKVLNNGLLSQSA*
586 >lcl|XP_546450.3|Plus1complement(10302540..10303481) NW_876312 putative olfactory receptor 10D3 OR28D07 __SEG__ Chr5 {Canis lupus familiaris} MEKKNCSVVTEFILLGIPHTKGLETMLFVLFLPFYACTLLGNVSILMAILSSTRLHTPMYFFLGNLSVFDMSFSSVTCPKMLLYLMGLSPLISYKSCVSQLFFFHFLGSI
ECFLYTVMAYDRFTAICYPLRYTVIMSPRICGALAAGTWLLGCIHSSILTFLTFTLPYCGPNEVDHFFCDIPALLPLACADTSLAQRVSFTNVGLVSLLCFLLIILSYTR
ITISILHIHSTEGRRRAFSTCSAHLIAILCAYGPIITVYLQPTPNPMLGTVVQILMNLVGPMLNPLIYTLRNKEVKTALKIILHRTSHIPESQ*
587 >lcl|XP_546452.3|Plus1complement(10333240..10334175) NW_876312 olfactory receptor 149 OR08E10 __SEG__ Chr5 {Canis lupus familiaris} MRNLSVVTEFILLGIPHTEGLETTLFVLFLSFYIFTLMGNLLILLAIISSTRLHTPMYFFLCQLSVCDIFFPSVSSPKMLFYLSGNSRVISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYTVIMSHRVCAILAMGTSFFGCIQATFLTTLTFQLPYCGANEVDYFFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSRIV
YSILQIRSAEGRRRAFSTCSAHLTAILLFYMPVVLIYLRPTPSPWLDATVQVLNNLVTPMLNPLIYSLRNKEVKSSLRKVLYHLGFLPEQL*
588 >lcl|XP_546455.1|Plus1complement(10419926..10420858) NW_876312 olfactory receptor 958 cOR10D5P __SEG__ Chr5 {Canis lupus familiaris} MKNHTPVTEFLLMGIPYTKGLENMLFVLFLAFYFLTLLGNLLILLAILTSSNLHTPMYFFLGNLSVFDIFFPSVSSPKMMLSLVGQSRTISYPGCACQLFFYHFLGCTEC
FLYTVMAYDRFAAICHPLQYTVIMNRRVCTIMTLGTWVGSCLHAAVLTFLIFHLPFCGPNEVDNFFCDIPVVLPLACADTSLAQTVSFTNVGIVALICFLLILTSYIRIV
VSVLKISSSEGRRRAFSTCSAHLTSILLFYGPVVLIYLRPASSPWLDSVVQVLNNIVTPSLNPLIYTLRNKDVKLALRKALIQGVHTCGV*
589 >lcl|XP_546456.3|Plus1complement(10430396..10431328) NW_876312 putative olfactory receptor 10D3-like LOC489338 __SEG__ Chr5 {Canis lupus familiaris} MQNYTSVMEFILLGIPNTEGLENMLFVLFLAFYLFTLLGNLLIFLTILVSSNLHTPMYFFLGNLSVFDIFFPSVSSPKMMLYLMGQSRTISYQGCACQLFFYHFLGGTEC
FLYTVMAYDRFVAICHPLRYTVIMNRRVCTGLTLGTWLGGCLHGSILTFLVFKLPYCGSNEVDNFFCDIPVVLPLACADTSLAQTVSFTNVDVVTLTCFFLILTSYGHIV
LSILKISTAEGRRRAFSTCSAHLMSIFLFYGPVMLIYLRPASSPWLDSVIQVLNNIVTPSLNPLIYTLRNKDVKLALRKVFTQMVHISGV*
590 >lcl|XP_546465.3|Plus110602197..10603144 NW_876312 olfactory receptor 6M1-like LOC489347 __SEG__ Chr5 {Canis lupus familiaris} MAMRNQSTLTEFTLVSFPVIQELQILLFVILLMVYILTITGNIVIISLIWTDNRLQTPMYFFLSNLSFLDILFTTTIAPKLLACLLEKKKTISFAGCITQIYFYFFLGTV
EFILLAVMSFDRYVAICNPLRYTIIMNSRVCLLLVLGCWVGAFLSVLCPTIVVSRLPYCTKEISHFFCDIAPLLQVACIDTHFIEMINFLLSSFVLLTSLVFTIVSYTYI
ISTILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYMRPSQSHSLEFDKVTAVLTTMVTPLLNPFIYSLRNEKVKEILRETISRIVLPYSKGT*
591 >lcl|XP_546467.3|Plus1complement(10637939..10638886) NW_876312 olfactory receptor 6M1 cOR6M5 __SEG__ Chr5 {Canis lupus familiaris} MDVQNQSRVTEFTLTAFPVIRKLQISLFVVLLFTYMLTLTGNTVIISLIWADNRLQTPMYFFLSNLSFLDILYTTSVTPKLLACLLEDKKTISFAGCITQTYFFFFLGTV
EFILLAVMSFDRYVAICNPLRYTVIMNSRVCLLLVLGCWVGAFLSVLCPTIVVSRLPYCYREIGHFFCDIAPLLQVACIDTHFIEMINFLLSSFVLLTSLVFTIVSYTYI
ISTILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLEFDKVTAVLTTMVTPLLNPFIYSLRNKKVKEVLREAILKIMSLWHKRT*
592 >lcl|XP_546468.1|Plus110654674..10655615 NW_876312 olfactory receptor 6M1 OR6M1 __SEG__ Chr5 {Canis lupus familiaris} MGNWSIVTEFTLIAFPVLLELRIFLFVVLLLTYTLTATGNIIIIFLIWTDNRLQTPMYIFLSNLSCLDILYTTVITPKLLDCLLGEKKTISFAGCITQTYFYFFLGTVEF
ILLAVMSFDRYVAICNPLRYTTIMNSRACLLLVLGCWVGAFLSVLVPTIVVTRLPYCRKEINHFFCDIAPLLQVACVDTYLIEQINFLLSALVILSSLAFTAGSYTYIIS
TILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFVYVRPSQNYSLDFDKVAAVLITVVTPLLNPFIYSLRNEKVKEVLRETMNRIMSLILRKT*
593 >lcl|XP_546891.2|Plus1complement(15971026..15972621) NW_876316 [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial PDP2 __SEG__ Chr5 {Canis lupus familiaris} MSSTLPFWILKNSARNSIATLQGGRRLYSRCASNRNESRLRLFSQVLGTRKSIGPCSGSALQKAYRHTSTEEDDFHLQLSPEQVNEVLRAGESAHKMLDLVSGVPNSVLR
FESNQLAANSPVEDRRGIASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYMAVSLMSQQTLEQMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLD
LHMEMGLNIKEALMYSFQRLDSDISLEVQAPLEDEMTRNLSLQVAFSGATACVAHVDGVHLHVANAGDCRAVLGVQEDNGMWSCLPLTCDHNAWNPAELSRLKGEHPESE
DRTVIMDNRLLGVLMPCRAFGDVQLKWSKELQRSVLERGFDTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDVLGNEEVVRLVVEHLAEAGRHK
PDLAQRPANLGLMQSLLLQRKAQGLRAADQNAATRLIRHAIGSNEYGEMEPERLTAMLTLPEDLARMYRDDITVTVVYFNSDSIDAYYKGG*
594 >lcl|XP_546927.2|Plus1complement(6783779..6785563) NW_876317 frizzled-9 FZD9 __SEG__ Chr6 {Canis lupus familiaris} MAVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPA
CRPMCEQARLRCAPIMEQFNFGWPESLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDPASGPGGGGGGGTCENPEKFQYVEKSRSCAPRCGP
GVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMAS
SLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTN
TEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCLAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCHRKMAA
GRARAKACRASGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL*
595 >lcl|XP_546970.3|Plus11053733..1054677 NW_876318 olfactory receptor 1F12 OR08C09 __SEG__ Chr6 {Canis lupus familiaris} MEGENHTSVSEFILLGLSSQPERQELIFGLFLVMYLVGAAGNLLIILAIGSDSLLHTPMYFFLSNLSLVDFCFISATVPKMLVNIQMQTQSISYGGCLAQIYFCILLANM
DNFLLTAMAYDRYVAICHPLHYSTMMSLQICALMLGSSWLIANLHSLLHTALMARLEFCASNIIPYFFCDLIPLLQLSCSNTQLNQLMILLVGGLIVLIPFLSILVSYIR
IVSAVLKVPSAQSKQKAFSTCGSHLTVVLLFYGTITGVYLNPSSSHLADKDSLASVMYMVVTPMLNPFIYCLRNKDMKGALRKLFGVKTLSCGL*
596 >lcl|XP_547014.1|Plus1complement(6424641..6427115) NW_876318 extracellular leucine-rich repeat and fibronectin type-III domain-containing protein 1-like ELFN1 __SEG__ Chr6 {Canis lupus familiaris} MAGCRWGVLWVCMAAATLLHAGGLAHGDCWLIEGDKGFVWLAICSQNQPPYEAIPQQINNTIVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIAYIEDGAFSGQFNL
QVLQLGYNRLRNLTEGVLRGLSKLEYLYLQANLIEVVTPSAFWECPNIINIDLSMNRIQRLHSATFAGLAKLSVCELYSNPFYCSCELLGFLRWLAAFTNATQTYDRMQC
ESPPLYSGYFLLGQGRHGQRSILSKLQSVCTDGSYVAEPHPVPGRLPPGRSPPPPPPPPPPEPSEAPCADDECFSGDGTTPLVALPTLAPQAEARPLMKVKQLTQNSATI
MVQLPSPFTRMYTLEHFNNSRSSTVSRLTKPQEEIRLTNLYTLTNYTYCVVSTSSGLHHNHTCLTIGLPKPPSPPGPVPSPSTATHYIMTILGCLFGMVLVLGAVYYCLR
RRRRQEEKHKKAAAAGSLKKTIIELKYGPEMEAPGLAPLSQGPLLGPEAVTRIPYLPATASEVEQYKLVESGETPKASKGNYMEVRTGDQAERRDCELGRPGPDSQSSVA
EISTIAKEVDKVNQIINNCIDALKSEATSFQGGKSGAVSAAEPQLVLLSEPLAGKHGFLSPVYKDAFGHGLQRHHSVEAATGPPRASTSSSGSVRSPRAFRAEATGTHKA
AATEAKYIEKSSPATDAILTVTPAAAVLRAEAEKGRHYGEHRHSYPGSHPAEPPAPPAPPPHDSLGGRKASILEPLTRPRPRDLAYSQLSPQYHNLSYSSSPEYTCRASQ
SIWERFRLSRRRHKDDEEFMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQHKS*
597 >lcl|XP_547157.1|Plus1complement(20141585..20142523) NW_876321 olfactory receptor 2C1 OR2C1 __SEG__ Chr6 {Canis lupus familiaris} MPEANDSFLEGFILMGISDHPQLEIIFFMVILFSYLLTLLGNSTIILLSWLDARLHTPMYFFLSNLSTLDLAFTTSSVPQMLINLWGPDKTISYGGCVTQLYVFLWLGAT
ECILLVVMAFDRYVAVCRPLHYTTIMNPRLCWLLAAIAWLGGLSNSVIQSTFTLQLPLCGHRRVDNFLCEVPAMIKLACGDTSLNEVVLNGVCTFFTAVPLSVILISYCY
IAQAVLKIHSVEGQRKAFNTCLSHLVVVLLFYGSAIYGYLLPAKTSNQDQGKFISLFYSVVTPTVNPLIYTLRNREVKGALRRLLGKGRSLG*
598 >lcl|XP_547241.2|Plus124666249..24667730 NW_876321 amphoterin-induced protein 1 AMIGO1 __SEG__ Chr6 {Canis lupus familiaris} MQPQRDPRGLWLLLLSLFPLLFEVARAGRPVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLIHLQSLLLSHNHLNFISSEAFSPVP
NLRYLDLSSNQLRTLDEFLFSELQALEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHN
NPLHCDCELYQLFSHWQYRQLSSVMDFQEDLYCMSSKKLHNVFNLSFLNCSEYKERAWEAHLGDTLTIKCDTKQQGMTKVWVTPSNERVLDEVANSTVTVSKDGSLHFQQ
VQVEDGGVYTCYAMGEAFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRR
VAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGPRRMSDPESVSSVFSDTPIVV*
599 >lcl|XP_547254.2|Plus1complement(26795604..26796734) NW_876321 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr6 {Canis lupus familiaris} MSQPKKRKLESGGGGGGGGEGSEEEDGGAPEAAPPRPRRARRERDQLYYECYADISVHEEMIADRVRTDAYRLGILRNWAGLRGKTVLDVGAGTGILSLFCVQAGARRVY
AVEASAIWQQARDVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLRSVLHARARWLKEGGLLLPASAELFVAPVSDQMLELRLGFWSQVKQLYGVDM
SCLESFATRCLMGHSEIVVQSLSGEDVLARPHCFARLELARSGLEQELEAGVGGRFRFSCYGSAPMHGFAVWFQVTFPGGDAEKPLVLSTSPFHPVTHWKQALLYLNEPV
PVEQDTDISGEITLLPSRDNHRLLRVLLRYKVGDQEEKTKDFAMED*
600 >lcl|XP_547259.2|Plus1complement(31205437..31206585) NW_876321 sphingosine 1-phosphate receptor 1 S1PR1 __SEG__ Chr6 {Canis lupus familiaris} MGSTSVPLVKALRSPVSDYVNYDIIVRHYNYTGKLNTSADKENGIKMSSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTY
KLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSFRSFLLISACWVISLVLGGLPIMGWNCIGALASCSTVLPLYHKHYILFCTTVFTLLLLAIVIL
YCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRILSCCK
CPGGDPAGKFKRPIIAGVEFSRSKSDNSSHPQKDDGDNPETVMSSGNVNSSS*
601 >lcl|XP_547492.3|Plus131416350..31417645 NW_876323 beclin-1-like protein 1-like LOC490371 __SEG__ Chr7 {Canis lupus familiaris} MSSIRFICQGCRQPMRLSQSTGTLGLETTQRPAASTFTSAQQEPRETLVRGPTSKVEIDTEKLPDASCSTLPGDGKMFGDSPKNFILLGKFDSARTLSNIQNTTRDIFDI
LTGEKYVDHPLCEDCTDKLLEVLDTQLIIVDSENEHYKYWRGRICEEEMKTLQEELEGLELEEARLVQELKEVENKQERVAEDLEAAQAETEMLEQQDKQYWKDYSNLKW
QQLELQDELKSMERQLRHAQIQWGRLKKTSVFSATFEIRYDGPVGIINSFRLGCLPTVPVSWKEINMAWGQTALLLLALSNKIGLEFRRYQLIPCGNRSYLKSLTNDPVE
LPLFCIMRQSTCLDLKFDQAMMAFLDCMQQFKEEAEKGKWGLCLPCRIHVKNGLMEDSGSTGEFYSIRTYLNTEEQWTKALKLMLINLKCSLTWVSLRYQE*
602 >lcl|XP_547700.2|Plus1405673..406617 NW_876326 putative olfactory receptor 2W6-like isoform 1 LOC490578 __SEG__ Chr8 {Canis lupus familiaris} MARDNDSYQQVFILVGFSDRPQLEIILFAFVLVFYILTLLGNSAIIFLSILDARLHTPMYFFLGNLSFLDLCFTTSIVPQLLWNLWGPEKTITYHGCVAQLYIYMVLGST
ECVLLAVMSYDRYVAVCRPLHYTVIMHPRLCLQLVTVSWFCGFLNSFVMCPQTMQLSRCGHHMVDHFLCEMPALIAMSCEDTMLVEAFAFALGVALLLVPLSLILISYSM
IAATVLRIKSAAGCKKAFNTCSSHLMVVSLFYGTIIYMYLQPANSYSQDQGKFLTLFYTIITPSINPLIYTLRNKDVKGVMRRLLKGEKGAREA*
603 >lcl|XP_547702.2|Plus1complement(459630..460592) NW_876326 olfactory receptor 2C3 OR2C3 __SEG__ Chr8 {Canis lupus familiaris} MMGIANVSSPEVFVLLGFSARPSLESILFIIVLGFYVVSILGNGIIILVSCMDVHLHTPMYFFLANLSFLDISFTTSIVPQLLVNLWGPQKTISYGGCVVQFYISHWLGA
TECVFLAVMSYDRYAAICRPLNYTIIMHPQLCLSLALASWLGGLTTSMVGSTLTMLLPLCGNNRIDHFFCEMPLIMQLTCVDTSLNEVEMYVASFIFVVLPLGLILVSYG
HIAWAVMKIRSAEGRRKAFNTCSSHVAVVALFYGSIIFMYLQPAKSNSHEQGKFIALFYTVITPMLNPLIYTLRNKDVKTALRHIVLEKCCGFAGPWGHI*
604 >lcl|XP_547723.3|Plus1916215..917144 NW_876327 olfactory receptor 6C4-like LOC490601 __SEG__ Chr8 {Canis lupus familiaris} MRNHTTVTEFVLLGLSEACELQMLIFLALLLTYLVTLLGNLLIVSITLIDRCLHTPMYYFLCNFAVLEIWFTSVIFPKMLTNILTGNKTISLAGCFLQSFLYFFLGTTEF
FLLAAMSFDRYVAICNPLRYATIMSKRVCVQLVLCSWMAGFLLIIFPSFITFQQPFCGPNVINHFFCDNFPLLELICADTSLIELLGFIVANFSLLGTLSVTTTCYGYIL
HSILRIPSAKERQKAFSTCSSHIIVVSLFYGSCIFMYIRAGKGNEGEDKNKVVALLNTVVTPMLNPFIYTLRNKQVKQVFRKQMSKLLS*
605 >lcl|XP_547746.2|Plus12128987..2130066 NW_876327 leukotriene B4 receptor 2 LTB4R2 __SEG__ Chr8 {Canis lupus familiaris} MLACYRPPGNETLLSWKASRVTGTAFLLLAALVGLPGNGFVVWSLAGWRPARGRPLAATLALHLALADGAVLLLTPLFVAFLAGQAWPLGQAGCKAVYYVCALSMYASVL
LTSLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAALLLAAPAAVYRHLWGDRVCQLCHPSPAHAAAHLSLETLTAFVLPFGLVLGCYGLTLARLRGARWGAGRQGS
RVGRLVSAIVLAFGLLWAPYHAVNVLQVAAALAPPGGALARLGGAGQAARAGTTALAFFSSSVNPVLYVFTARDLLPRAGPGFLTRLFEGSGDARSGGRSREGTMELRAT
PRLKVVGQGHRGGGDPGDGMEKDGQRWDP*
606 >lcl|XP_547943.1|Plus157231242..57232267 NW_876327 psychosine receptor GPR65 __SEG__ Chr8 {Canis lupus familiaris} MNSTCIEEQHYLDHYLFPVVYIFVVIASVPANIGSLCVSFLQAKKENELGIYLFSLSLSDLLYTLTLPLWIDYTLNNDNWTFSPALCKSSAFFMYMNFYSSTAFLTCIAI
DRYLAVVHPLKFSFVRTRRFAFVASLSIWVLETMFNGVILWEDETAIEYCDAKKSNFTLCYDKYPLEKWQISLNLFRTCTGYAIPLVIIMICNQKVYQAVQHNQATEDGE
KKRIIKLLMSITLTFVLCFTPFHVMLLIRSILEHDVDFNEHIFDHNKSGRQTYKMYRITVALTSLNCVADPILYCFVTETGRSDMWNILKFCTGKLNNSQGQRKRILSMS
TRDTMELDILE*
607 >lcl|XP_548060.2|Plus1complement(699399..701096) NW_876332 frizzled-2 FZD2 __SEG__ Chr9 {Canis lupus familiaris} MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPC
RSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPPGLQPGAGGTPGGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERD
CAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTIL
FMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFR
IRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRK
FYTRLTNSRHGETTV*
608 >lcl|XP_548227.2|Plus114646941..14647885 NW_876332 olfactory receptor 4D2-like isoform 2 LOC491107 __SEG__ Chr9 {Canis lupus familiaris} MEPENLTWVSEFVFLGFSQTRELQLFLFLVFLFVYTTTVVGNLLIMVTVTSDTRLHTPMYFLLRNLAVLDLCFSSVTAPKMLVDFLSEKKTISYQGCMAQIFFFHFLGGA
MVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVQLVVTAWMVGFVHSIAQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLMISNSGLLDIIWFFLLLTSYSV
ILVMLRSHSGQARRKAASTCTTHIVVVSMVFIPSIYLYARPFTPFSMDKAVSISHTVMTPMLNPMIYTLRNQEVQAAVRRLGRRRLLCKRDLGQ*
609 >lcl|XP_548228.1|Plus114658281..14659225 NW_876332 olfactory receptor 4D2-like isoform 1 LOC491108 __SEG__ Chr9 {Canis lupus familiaris} MEPENLTWVSEFVFLGLSQTRELQLFLFLVFLFVYTTTVVGNLLIMVTVTSDTRLHTPMYFLLRNLAVLDLCFSSVTAPKMLVDFLSEKKTISYQGCMAQIFFFHFLGGA
MVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVRLVVAAWVGGFVHSISQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLMISNSGLLDIIWFFLLLISYSV
ILVMLRSHSGQARRKAASTCTTHIVVVSMVFIPSIYLYARPFTPFSMDKAVSISHTVMTPMLNPMIYTLRNQEVQAAVRRLGRRRLLCKRDLGQ*
610 >lcl|XP_548325.3|Plus1complement(28872738..28873679) NW_876332 LOW QUALITY PROTEIN: olfactory receptor 1D2 cOR1D8 __SEG__ Chr9 {Canis lupus familiaris} MHGSNQSEATEFPLLGISESPKEQQILFWMLLSMYLVTVVGNVLIILAIGSNSHLHTPMYLFLANLSFTDLFFVTNIKPKTLVSLQSQNKAISYAGDV*HSSTSWSPW*P
WTTSSWPQWHMTAM*PSAAPSTTPQP*ALDSVFCSSPCAGHFLPSVAFSSRSS*PR*HSVDPGRSTTSSVRCISC*GLHVPTPRSFTQCRLPQAASSSSPH*GS**CPMS
GLSEPSSKYSQPLASTKLSPPVPPIWL*SPSSMGHFVWYICSLSKPTP*RTQ*LQ*CMLW*PS**TLSSTA*GTRTCMGLWEDCS*GKLSRGWH
611 >lcl|XP_548332.3|Plus1complement(29024541..>29025521) NW_876332 olfactory receptor 3A1-like LOC491212 __SEG__ Chr9 {Canis lupus familiaris} FISLDVSLQELMQSKFGANSTAITEFILLGLVDTPGLQPVVFVVFLFAYLVTVGGNLSILAAILVEPKLHTPMYFFLGNLSVLDVGCITVTVPSMLARLLSHKRTVPYRA
CLTQLFFFHLLVGVDCFLLTAMAYDRFLAICRPLTYSTQMSQTVQRILVVVSWALAFTNALTHTVAIATLNFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFAVGFIM
AGTPLALIITSYAHVAAAVLRIRSAEGRKKAFSTCGSHLTVVAIFYGSGIFNYMRLGTAKHSDKDKGVGVFNTVINPMLNPIIYSLRNLDVQGALWRVLRGRQSLA*
612 >lcl|XP_548333.1|Plus1complement(29046216..29047163) NW_876332 olfactory receptor 3A1 OR01E11 __SEG__ Chr9 {Canis lupus familiaris} MDPESRTNGTTVTEFILLGLVETPGLQPVVFVVFLFAYLVTVGGNLSILAAILVEPKLHTPMYFFLGNLSVLDVGCITVTVPSMLARLLSHKRTVPYRACLTQIFFFHLL
AGVDCFLLTAMAYDRFLAICRPLTYSTRMSQTVQKILVAVSWALAFTNALTHTVAIATLNFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPLALIITS
YAHVAAAVLRIRSAEGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVEASDKDKGIGILNTVISPMLNPLIYSLRNPDVQGALWQVLTGKRALA*
613 >lcl|XP_548334.1|Plus129070747..29071694 NW_876332 olfactory receptor 139 OR08H10 __SEG__ Chr9 {Canis lupus familiaris} MEPSAWGNRTTVTEFILLGLTENIRLQPILFVVFLVAYLITVGGNLSILAAIFVEPKLHTPMYYFLGNLSLLDIGCITVTVPPMLACLLAHQCRVPYAACISQLFFFHLL
AGVDCHLLTAMAYDRYLAICQPLTYSTRMSREVQGALVGICCTISFINALTHTVAISVLDFCGPNVINHFYCDLPPLFQLSCSSIHLNGKLLFVGATFMGVFPMILISVS
YAHVTAAVLRIRSAEGRKKAFSTCGSHLTVVCIFYGTGFFSYMRLGSASVSDKDKGIGILNTILSPMLNPVIYSLRNPDVQGALKRVLMGKQPPE*
614 >lcl|XP_548335.3|Plus129123609..29124553 NW_876332 olfactory receptor 1F1 cOR1R4 __SEG__ Chr9 {Canis lupus familiaris} MAPGNATAAAEFLLLGLLDGADVHPLLFLLFLGVYLLNALGNLTMVVVVRWDEALRCPMYYFLGHLSLVDVCFASVTLPRLLAGLLHPGQAVSFQGCFAQMYFFVALGIT
ESYLLAAMAYDRAVAVCRPLHYRAVLTPGRCAALVAASWAVAHLHSLLHTLLISALSYPRPAAVRHFFCDMTVMLSLATSDTAAAETAVFSEGLAVVLTPLLLVSLSYAR
ILGAVLGLRSAGGRRRAFSTCGAHLVVVSLFFGSVLSVYFRPSSAYSARYDRLASVVYAVLTPTLNPFIYSLRNREVKGALKRGLGWRAASQDL*
615 >lcl|XP_548336.1|Plus1complement(29129843..29130790) NW_876332 olfactory receptor family 1 subfamily E OR1E1 __SEG__ Chr9 {Canis lupus familiaris} MKMGNRTVISEFILLGLPIDPDQRDLFYALFLAMYVTTILGNLLIIVLIHLDSHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLTQMYFFLFFADL
ESFLLVAMAYDRYVAICFPLHYTTIMSPKLCFSLLMLSWVLTTFISLLHTLLMARLSFCADNVIPHFFCDMSALLKLACSDILINEMVIFVLGGLIIFVPFLLISLSYAW
IVSSILKVPSARGICKAFSTCGSHLSVVSLFYGTIIGLYLCPSANNSTVKETIMAVMYTVITPMLNPFIYSLRNQDIKGALGRVFSKWTIQLSLG*
616 >lcl|XP_548452.3|Plus1complement(8640209..8641723) NW_876333 zinc finger and BTB domain-containing protein 34 ZBTB34 __SEG__ Chr9 {Canis lupus familiaris} MSVEMDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAA
SFLQMQCVIDKCTQILESIHSKISVGDVDSVTVGAEEATESRNGVKDSSFFANPVEISPPYCSQGRQPTTSSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSEYEIQIE
GDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYSQAASQPTGVSEAFGSLSNSSPSRSMLSCFRGGRARQKRAL
SVHLHSDLQGLVQGSDSEAMMNNPGYESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEICGKC
FPFQGTLNQHLRKNHPGVAEVRSRIESPERTDVYMEQKLENDASASEMALDSRMEIHTVSDAPD*
617 >lcl|XP_548466.3|Plus1complement(12246862..12247791) NW_876333 olfactory receptor 1L6 cOR1AF1 __SEG__ Chr9 {Canis lupus familiaris} MLRENQSHMPEFLLLGLTSDPKQQGWLFASFLAMYLVNVAGNSVIIAAIRRDACLHTPMYFLLSSLSLVDICFTSAIVPRMLANMMSKSKKVPFAQCLTQMCFFVAFGIT
DSFLLAVMAVDRYTAICNPLLYSMTMSPRRYLLLVMVSWVLSHLHSLTHMILMARLSFCGPNVIHHFFCDVQPLLTLSCSDTSINELLAFTEGSFVIMSPFALITVSYIF
ITHAVLRVRSERGRYKVFSTCRSYLIVVALFYGTIIFVYIHPSSTYSVTKDHVVTVIYTVVIPMLNPFIYSLRNKDMKQALKKLLRRVE*
618 >lcl|XP_548488.3|Plus131489748..31490680 NW_876308 olfactory receptor 6C4 cOR6C63 __SEG__ Chr3 {Canis lupus familiaris} MKNQTLLTEFILLGLTEIPEIQFVVFLFLFLTYIFSIIGNLTIITLTLLDSHLQTPMYFFLRNFSFLEISFTTTFTPRLLFSITTGNKSISFAGCFTQYFFAIFFGATEF
YLLAAMSYDRYVAICKPLHYMTIMSNRVCIQLVFFSWLAGFLIIISPIILTSQLDFCASNILNHYYCDYGPLLEISCSDTRLLELVDFILAAVTLVVTLVLVILSYTSII
WTILKIPSAQQRKKAFSTCFSHMIVIALSYGSCIFMYIKPSAKEGVAFNKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKDVIKKVMSIW*
619 >lcl|XP_548595.2|Plus1complement(16134917..16135825) NW_876266 olfactory receptor 140 cOR4X3 __SEG__ Chr18 {Canis lupus familiaris} MDSSRNITEFFMLGLSQNSEVQRVLFVFFLIVYLVSVGGNLLIMITIIFSPTLGSPMYFFLSCLSFIDTCYSSCMTPKLIADSLYEGRAISFEGCLVQFFVAHLLGGTEI
ILLTVMAYDRYVAICKPLHYTTIMTRHLCALLVGVAWLGGFLHSLVQLLLVLQLPFCGPNVINHFVCDLYPLLELACTNTYVIGVLVVANSGVICLLNFLMLVASYAVIL
RSLRCHGAEARRKALSTCGAHFTVVALFFVPCIFIYMQPSSTLSIDKIVAVFYCILTPMFNPLIYTLRNAEVKNAMKNLWKK*
620 >lcl|XP_548628.3|Plus1complement(17325154..17326092) NW_876259 LOW QUALITY PROTEIN: olfactory receptor 4S2 LOC491507 __SEG__ Chr15 {Canis lupus familiaris} MEVANNVTEFIFLGLSQDPGMQLMFFALFLFFYIVIMVGNLLILLTVFSDPRLHTPMYFFLSNLSFVDIAYSSATAPKMIADFVSEKKTISYWGCVTQMFTFHFFGCAEI
FVLTVMAFDRYAAICQPLRYTTIMSANACIMLASLSWLGALGHSFVQTLLTFQLPFCHNQVIDHYFCDVHPVLKLACADTTLVNMLVIANSGLISLGCFLILLASYTVIL
FSLRKRSSESRRKALSTCGSHFTVVTFFFVPCIFIYLRPSTTFPLDKAVSVFYTTITPMLNPLIYTLRNEDVKNAMKRIWNNMVSLKEK*KG*
621 >lcl|XP_548632.3|Plus1complement(28267120..28268079) NW_876273 olfactory receptor 52Z1-like LOC491511 __SEG__ Chr21 {Canis lupus familiaris} MAPFSYNHTNTQDMWYVLIGIPGLEDSHPWISIPICSMYVLAVIGNSFLIFLIVTERSLHEPMYFFLSMLASADVLLSTATAPKMLAIFWFQSMDISFGSCVSQMFFIHF
IFATESAILLAMAFDRYVAICHPLRYTTILTSSATGKIGIAAVVRSFFICLPFIFLVYRLRYCGRNIIPHSYCEHMGIARLACDSIKVNIIYGLTVALLSTGLDIVFIIM
SYIMILCTVFQIPSWAARFKALNTCASHICVILMFYAPAFFSFFAHRFGGKTIPHHIHILVANLYVVVPPMLNPIIYGVKTKQFQDRVMSLFSPISTCC*
622 >lcl|XP_548724.1|Plus1complement(228494..229495) NW_876319 probable G-protein coupled receptor 146 GPR146 __SEG__ Chr6 {Canis lupus familiaris} MWSCSPLNGTGSLEDQLLCQHFHLVLSVFSLLYLVVGVPIGLGYNALLVLVNLYDQNSMTMPDVYFVNMAVAGLVLSALAPVHLLGPTASGWALWGFSSEAHITLLVLFN
VSSLVTMYSTALLSLDYYIERALPRTYMSSVYNTRHVCGFVWGGALLTSFSSLLFYICSHVAARVVECSKMQDTEAADAIMVFIGYLVPTLAVLYALALISRIRKEDTPL
DQDAGRLDPSVHRLLVATVCTQFGLWTPHYLTLLAHTLLALRGKPMDGRYLGILLFAKDVSRFLAFSSSSVMPLLYRYINRNFPGKLRRLIKKMHCGHQSCSPDQVGVQQ
VMA*
623 >lcl|XP_548744.1|Plus128086570..28087520 NW_876273 olfactory receptor 52A5 cOR52A10 __SEG__ Chr21 {Canis lupus familiaris} MFKLNGTIFMPPVLTLIGIPGLESVQFWIGIPFCAMYIIALFGNSLILVIIKSERSLHEPMYLFLAMLGATDIALSTCILPKMLGIFWFHLPDIYFDACLFQMWLIHTFQ
GIESGILLAMALDRYVAICDPLRHATIFTHKLLTQIGVGVMLRAALLGAPCLILIKCRLKHFRTTVVSHSYCEHMAIVKLAAEDIRVNKIYGLFVAFIILGLDIIFITIS
YIRIFITVFNLPQREARLKAFNTCIAHICVFLEFYLLGFFSFFTHRFGFHIPPYIHILLSNLYLLVPPLLNPIVYGVKTKQIRDRVSKIFHSKIPS*
624 >lcl|XP_548745.2|Plus128073627..28074577 NW_876273 olfactory receptor 52A5 cOR52A17 __SEG__ Chr21 {Canis lupus familiaris} MFKLNGTIFMPPVLTLIGIPSLESVQFWIGIPFCDMYIIALFGNSLLLIIIKSERSLHEPMYLFLAMLGATDIALSTCILPKMLGIFWFHLPDIYFDACLFQMWLIHTFQ
GTKSGILLAMALDRYVAICDPLRHATIFTHKLLTQIGVGVTLRAALLVAPCLILIKCRLKHFRTTVVSHSYCEHMAIVKLAAEDIRVNKICGLFVAFTLLGFDIIFITLS
YIRIFITVFNLPQREARLKAVNTCIAHICVFLEFYLLGFFSFFTHRFGFHIPPYIHILLSNLYLLVPPLLNPIVYGVKTKQIRDRVSKVFHSKDSS*
625 >lcl|XP_548746.3|Plus1complement(28057404..28058348) NW_876273 olfactory receptor 51V1 cOR51V6 __SEG__ Chr21 {Canis lupus familiaris} MSPISILNVSSSRFILTGFPGLEVHYLWISIPFSSIYAMVFLGNCMVLHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTMYTVLGVLWGIIREISLDSCIAQSYFIHGLS
FMESSVLLAMAFDRYIAICNPLRYSSILTNDKIMKIGVTILCRSSLLIPPVIIRLKFLNYCHPHILSHSFCLHQDLIRMACSDIRFNSIYGLALVISNLLLDAVLILISY
IMILHAVLAIASREERIKSLQTCVSHICAVSVFYIPIIGLTMVHRFGKHLSPLVHVLMGNIYILFPPLMNPIIYSIKTQQIRRRVQRLFYLKRM*
626 >lcl|XP_548748.3|Plus1complement(28032759..28033712) NW_876273 olfactory receptor 51I2-like LOC491627 __SEG__ Chr21 {Canis lupus familiaris} MELINKSFFQPPTLLLTGIPGLEAIQIWISIPLCVMYLISLLGNCIILFVIKMTSRLHEPQYIFLSMLATTDVGLSLSTLPTVLMVFLLNHREIEFHSCLTQMFFIHTFS
SMESAILLAMAFDRFVAICNPLHYTMVLTSPRIIGMGIAAMVRGVVLMVPLPILLKRLSFCKDVILSHCYCYHPDVMKLACGPVRVNIIYGLSLVLCSFGVDAVFIVISY
ILILKTVLDIASEDGQLKALNTCVSHIFTVCIFYVPLIVLALIHRFGTFTSPLLHVTMANLFLFLTPVLNPLVYSLKTKQIRSVIYKVFKGRGNLFK*
627 >lcl|XP_548754.1|Plus1complement(27956627..27957568) NW_876273 olfactory receptor 51V1 isoform 1 cOR51X2 __SEG__ Chr21 {Canis lupus familiaris} MSASSASIINSSIFILTGFPGLDQYYPWFSIPFSFVYAMVFLGNCLVLHVIRTEPSLHQPMFYFLAMLALTDLCMGLSTVHTVLGVLWGLNQEVSQDACIAQTYFIHGLS
CMESGVLLAMAFDRFTAICNPLRYTSILTNSRVIHFMVTILMRAALSILPVIIRLKFFHYCRPHILSHSFCLHQDLLRLACSDIRFNSFYALALVICTLLLDAVLILISY
ILILHTVLAIASQEERLKSLQTCVSHICAVLVFYIPIIGLTMVHRFGKHLSPSVHVLMGNIYILFPPLMNPIIYSVKTQQIRGRMKKWFSLKM*
628 >lcl|XP_548761.3|Plus127848026..27848976 NW_876273 olfactory receptor 52A1 cOR52AB3 __SEG__ Chr21 {Canis lupus familiaris} MASINMSYLDPTTVMLIGIPGLEHVQFWIGFSFFVVCVVAFLGNIILLIIIPAERSLHQPMYIFLAVLAATDIGLCVAIAPKMLAIFWFGSRSMAFDACLAQLFFIHSLQ
GMESGILLAMAFDRYVAICDPLRHTSILTPFILVTLVLVVAIRAMVLVGILPVLIKRLHFFHSIVIAHSYCEHMAVVKLAAEDIRVNKTCGLLVGFTILGFDMIFIIISY
ILIFQAVFRLHQKEARLKAFNTCTAHIFVFLEFYILAFFSFFSHRFGHVAPPTHILLSTIYLLVPPALNPIVYGVKNKVIRRRVAQIFFLNCQSRQ*
629 >lcl|XP_548762.1|Plus1complement(27834210..27835154) NW_876273 olfactory receptor 52M1 cOR52X3 __SEG__ Chr21 {Canis lupus familiaris} MPPLNTSRPFPVTFLLMGIPGLEHLHVWIGIPFCSMYVVAVVGNVTILAVVRAERSLHEPMFFFLCMLSITDLVLSTSTLPRMLCLFWLGAHDIAFDACLAQMFFIHSFT
TMESGFFLAMAFDRYVAICHPLHHTTILTHARITIMGIIVVIRGVAFFSPHPILLKQLPYCRTRIIAHTYCEFMAVVKLACVDTGATTRYSLSVASIIGSCDAILTVVSY
AFILHSVFSLPSREAGFKALGTCGSHVCVILVFYSTAGFSIFTHRFGKNVPAHIHIFIANMYLLVPPFLNPIVYGVRTKKIREHVLRVLKVNVA*
630 >lcl|XP_548763.2|Plus1complement(27813593..27814537) NW_876273 olfactory receptor 52K1 cOR52AD1 __SEG__ Chr21 {Canis lupus familiaris} MTSCNNSIPQPLIFVLAGIPGLESSHGWFSVPFFLVFVVTIFGNTTILCIIRVEKSLHEPMFLLLAMLSVVDLSLVSVTVPRMLDIFWMNAKEISFNACLTQMFFIPSFY
VMESGILLAMAFDRFVAIWFPLRYTTILANKVLVKMALTVLARAVAVLTPAPILAERLERFQTHIIAYSYCAYMAVVKIACGDISNHIFYGLMVLVASVGLDLFFIILSY
GLILHAVFQIPSWEARGKALNTCGSHLCVIALFYSPVVFSVLAQILGYHMAPHLQIIIDNLYFLVPPMVNPLIYGARTKQMRERMLRIFHCHRN*
631 >lcl|XP_548764.2|Plus127790506..27791534 NW_876273 olfactory receptor 52A1 cOR52AB4 __SEG__ Chr21 {Canis lupus familiaris} MKPFHFSLKFSSEGVRTCSKKTIPTSMASINTSYLNPETVILIGIPGLEHVQFWIGFPFLAVCLVALLGNIVLLIIIPTEHSLHQPMYIFLAVLAATDIGLCAAIAPKML
AIFWFRSCSMAFDTCLTQLFFIHALQCMESGILLAMAFDRYVAICDPLRHTSILTSSILCRMIVIVAIRATVLVGLLPILIKRLHVFHSIVIAHSYCEHMAVVKLAAEDA
QVNKACGLFVGFTILGFDMIFILISYILIFQAVFHLHQKEARLKAFNTCTAHIFVFLEFYILAFFSFFSHRFGHVAPPTHILLSTIYLLVPPALNPIVYGVKNKVIRKRV
AQIFLLSHISHQ*
632 >lcl|XP_548778.2|Plus1complement(27493712..27494671) NW_876273 olfactory receptor 51G1 OR51G1 __SEG__ Chr21 {Canis lupus familiaris} MTISYNSSLQKATFFLTGFQGLEDLHGWISIPFCFIYLTVIVGNLTILHVIRTDVTLHEPMYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREIGIPACFTQLFFIHTLS
LVESSVLLSMSIDRYVAICNPLRYSTVLTPTRIVRMGLTSMLRSALLILPLPFLLKRFQYCRSHVLAHAYCLHLEIMKLACSSIIVNRIYGLFVVACTVGVDSLLIFLSY
ALILRTVLSIASRQERLRALNTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRIVHLLMSYVYLLVPPLMNPIVYSIKTKQIRIRIAKKCDFVKSLRCFR*
633 >lcl|XP_548779.3|Plus1complement(27484524..27485465) NW_876273 olfactory receptor 51G2 isoform 2 OR51G2 __SEG__ Chr21 {Canis lupus familiaris} MTLGSLESSSNISSTFLLSGIPGLEHMHIWISIPLCFIYLVSILGNCTILFIIKTEPSLHEPMYLFLSMLAVTDLGLSLCTLPTVLGIFWIGARDIGHDACFAQLFFIHC
LSFLESSVLLSMAFDRFVAICRPLHYASILTNTVIGRIGLASLGRSVALIFPLPFMLKRFPYCGSPVLSHSYCLHQEVMKLACADIKANSVYGMFVIVSTVGIDSLLILF
SYALILRTVLSIASRAERFKALNTCVSHICAVLLFYTPMIGLSVIHRFGKQGSHLVQVIMGFVYLLFPPLMNPIVYSVKTKQIRDRVTHAFCC*
634 >lcl|XP_548783.2|Plus1complement(27425090..27426043) NW_876273 putative olfactory receptor 51H1 cOR51H3 __SEG__ Chr21 {Canis lupus familiaris} MTMNSNASHVNHHSFILTGIPGMPDKNAWMAFPLGFLYTLTLLGNGTILTVIKVDESLHEPMYYFLSILALTDVSLSMSTLPSMLSIFWFNVPEIPFDACITQMFFIHGF
GVVESGVLVSMAFDRFVAIRDPLRYASILTHGIIGKIGIVVLTRAVCVVFPVPFLIKRLPFCHSNVLSHSYCLHQDAMRLACASTRINSLYGLIIVIFTLGLDAIIILFS
YVLILKTVLGIASRDERLKALNTCLSHICAVLLFYIPLIGVTMIHRFGKHLSPVVHTLMANIYLLLPPVLNPIVYSVKTKQIRRRIIHMFQRRTNRA*
635 >lcl|XP_548784.2|Plus127412641..27413597 NW_876273 putative olfactory receptor 51H1 cOR51H5 __SEG__ Chr21 {Canis lupus familiaris} MADNNYSHFQHPYFVLTGIPGLEQKYYWMAFPLGAIYIIALFGNGVIISTIKSESSLHIPMYYFLFMLALADMGLALCTLPSMLGIFWFNYKSIAFDACLVQMYFIHTFS
AIESGVLVAMAFDRVVAIWDPLRYGTILTNGVVGRTGAIILIRAVFVVFPVPFLIKRLPFYRSNILSHSFCLHQDVMRLACASTRVNSLYGLIAVIFTKGSDSLSILFSY
VFIFRTVMAIASGKGRLKALNTCVSHICAVLIFYVPLIGVSVIHRFGKHLSPLTHALMANAYLLVPPVLNPIVYTVKTKEIRKKIIQIFVQTKITAEG*
636 >lcl|XP_548792.2|Plus1complement(343074..344021) NW_876252 olfactory receptor 2V1-like LOC491671 __SEG__ Chr11 {Canis lupus familiaris} MEIWLNRTSIDGFILLGIFSHSQTDLVLFSVVMVVFTVALCGNVLLLFLIYIDPRLHTPMYFFLSQLSLMDLMLVCANVPKMAVNFLSGRKSISFVGCGIQIGFFVSLVG
SEGLLLGLMAYDRYVAISHPLHYPILMSQKVCLKFAGSSWAFGILDGIIQMVAAMSLPYCGSRIVDHFFCEVPALLKLACTDTSLFDTLLFACCVFMLLLPFSIIVASYA
HILRAVLHMCSAQARKKALATCSSHLTAVSLFYGAAMFIYLRPRRYRAPSHDKAVSIFYTVLTPMLNPLIYSLRNQEVMGALRKGLDHCRIGSQH*
637 >lcl|XP_548814.3|Plus1complement(351232..352164) NW_876287 olfactory receptor 13A1 cOR12J1 __SEG__ Chr28 {Canis lupus familiaris} MSNRTLLTEFILQGFSDAPRLRGPFFALFLCLFVAALGGNLLIVAAIASSPRLHTPMYFFLVNLSVLDVTCACTVVPKLLDILLAERRSISYGGCMAQMYFLSWSVAGEV
LLFTAMAYDRYVAICRPLRYGSLMSPRVCAALAGAVWGISVLGAGVNTCLMTRLSFCGPNVIDHFFCEIPPVLVLSCSSTLVNDIMAVMADIFFAMLNFLLTVVSYGFII
STILKIRTAEGKQRAFSTCSSHLTAVTLYYSTIIYTYLSPGSSYSPGMGKVMAVLYSTVSPTLNPLIYSLKNKEVKAALRKVLTLVVKSL*
638 >lcl|XP_548816.1|Plus1288037..288972 NW_876287 olfactory receptor 287-like LOC491695 __SEG__ Chr28 {Canis lupus familiaris} MAWGRSQNQSAQEPFILLGFPGPLGLHVGLFALFLLMYVLAVAGNLAIIGLVGAHPRLRTPMYFFLCHLAFLEVWFTTACVPKALATLASRRGAISPAGCAAQMYFVFSL
GCTEYFLLAAMAYDRYLAICRPLRYGSVMTPGLCARLALGCWLCGFSAIAVPAALIARLSFCGARVINHFFCDIAPWIALSCSDTRVVELASFGIAFCVILGSCSVTLLS
YACIIATVVRIPAGEGRCRAFSTCSSHLTVVLVWYGSTIFLHVRMSAESSLDLTKAVTVLNTAVTPVLNPFIYTLRNREVREALWGWVQGK*
639 >lcl|XP_548889.3|Plus1complement(17321578..17323533) NW_879562 kelch-like protein 34 KLHL34 __SEG__ ChrX {Canis lupus familiaris} MSYFLSYCKAHGGALLTGYQALRAEGFLCDVTLEAEGSEFPAHRSLLACASDYFRALFKSHTRESRASVIHLHVPSAAGLQRLLDFIYTAWLPLSMDTVEDTLEAASYLQ
VTEALGLCGRYLERQLAPDNCCFAANVAARFGLLHTLGAAERCIARHLRELLLRGAGPAGLLELNPTSLKALLGAPDLARVPESWLLGLALAWLRQEPEAERLAHCASLL
ERVRFGLVPADVLRRVYSGSGLDLPARVKGLIIQALNYHRAPSRQPLLQGEQTSVRSPQTRILLVGGRRAREAVAEEVVVPQRVARGRGAAPEPQEEEEEEEEEEEQVEE
EEDWELTQDVLAFDVYNHRWRSLTRLPAPLLGHSVCTAGNFLFVLGGESPPEAASSPPADGPRPVTAEVHRYDPRFHAWTALPAMREARAHFWCGAVGEGLLAVGGLGAD
GQALASVEMYDLRRDRWTAAAALPRALHGHAGAVGDRGVVYISGGKAGSGEGGASSLRDVYALGPGERAWSKRAPMSTARFGHHMAVLRGAVFAFLGRYEPFSEIERYDP
GTDQWTRLRPLPYDRFCYGLAVVEETALLLGGLKWRESRQVPTRNVVGYDLDLDRWEDIGCALPWAWSGLQCAVLQLAEGGDEEREGGRAGAPDLVLGLMG*
640 >lcl|XP_548956.1|Plus135737709..35739325 NW_879562 nyctalopin NYX __SEG__ ChrX {Canis lupus familiaris} MKVTGKQRGGLRGWEPPCALRSGSRKEATRGARLCRRYGNLVEGRILPHGQVGLYWGDAQADGCSFYFFPRPSHLPAVVFGAWAEEACTRTCPTACACSSTERGCSVRCD
RAGLLRVPAEFPCEAASIDLDRNGLRFLGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGELRYLHARTFAALGRLRRLDLASCRLFTVPERLLAELP
ALRELAAFDNLFRRVPGALRGLANLTHAHLEHSRIEAVASSSLLGMRRLRSLSLQANRVRAVHAGAFRDCGALEHLLLNDNLLAELPAEAFLGLRRLRTLNLGGNALGLV
ARAWFADMAELELLYLDRNSIAFVEEGAFQNLSGLLALHLNGNQLTVLAWAAFQPGFFLGRLFLFRNPWRCDCRLEWLRDWMESSGRVADVPCAAPGSVAGLDLSQVAFG
RSSDGLCVDPEELNFTASSPGPSPEPAATTVSRFSSLLSKLLAPRVPVEEVANTTEGPLDTSLSDSLPSSGLVVSGHDTRFLLSSGFLLSVVFVLSMD*
641 >lcl|XP_548958.1|Plus1complement(36842412..36843038) NW_879562 type-1 protein phosphatase inhibitor 4-like LOC491839 __SEG__ ChrX {Canis lupus familiaris} MAASAASHRPIKGILKNKSSTASSVAASSPQSGGNIQEVQRKKSQKWDESNILATHRRAYRDYDLMKINEPSSPHCGQRDYGEDPGSDLDAKDTMSPDVVAKKLAASGTS
RWSRQVGEPDSDGAHSSKTFFDAQEKQRQFEMKRKLHHNEGLNIQLARRLISNDLQHEKDEDDNGGAPRGASEHSTGLEESSDEVSTSDEPQSQPSHS*
642 >lcl|XP_549010.3|Plus1complement(43923972..43924466) NW_879562 diphosphoinositol polyphosphate phosphohydrolase 3-beta NUDT11 __SEG__ ChrX {Canis lupus familiaris} MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDS
VSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSVAASLPQSDP*
643 >lcl|XP_549057.3|Plus15806197..5807057 NW_879563 OTU domain-containing protein 6A OTUD6A __SEG__ ChrX {Canis lupus familiaris} MEDSQSEQQRVIRRHHREKSELQARIQGMKNSVPKSDKKRRKQLLLDVARLEAEMEQKHQQELEKFQESFPANSNVDSVTEDLAKMDLENQPPRLSRARRRRERRARQER
IAEAETQHLASFRREEEEKLAAILGSKNLELKNIPADGHCMYRAIQDQLVFSVTVESLRSRTADYMRKHVDDFLPFFSDPDTGDAYSREDFLSYCDDIVRSPSWGGQLEL
RALSHVLQTPIEVIQADSPAVLIGEEYTKKPLTLVHLRYACNLGEHYNSVKPLEAGAVGGAAPRLF*
644 >lcl|XP_549206.1|Plus140102055..40103143 NW_879563 type-2 angiotensin II receptor AGTR2 __SEG__ ChrX {Canis lupus familiaris} MKSNITLATISKNITNSLHFGLVNIIGNESTFNCSHKPSDKHLDAIPVLYYIIFVIGFLVNTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWL
FGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFI
IPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCINPFLYCFVGNRFQQKLRR
VFRVPITWLQGKQESVSCRKSSSLREMETFVS*
645 >lcl|XP_549255.1|Plus1complement(52913483..52914490) NW_879563 glucose-dependent insulinotropic receptor GPR119 __SEG__ ChrX {Canis lupus familiaris} MESSFPFGVILAVLASLIIAVNVLVAVAVLLLIHKNDGVGLCFTLNLAVADTLLGVAISGLVTDQLSTPARPTQKTLCSFRMAFVTSSAAASVLTVMLIAFDRYLAIKQP
LRYLQIMNGLMAGACIGGLWLVSYLIGFLPLGVPVFQQTTYHGTCSFFAVFHPRFVLTLSCVGFFPALLLFVFFYCDMLKIASMHSQQIRKMEQAGAGTGACRPPRTPSD
FKAVRTVAVLIGSFTLSWTPFLVTGIVQVACQKCYLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVQQQLYEMVLGVKKGFTSCLLLLSARAGRPERPRENFCPIATISH
SQLDG*
646 >lcl|XP_549287.2|Plus1complement(58703443..58704957) NW_879563 probable G-protein coupled receptor 101 GPR101 __SEG__ ChrX {Canis lupus familiaris} MTSTCPNNTRESNSSHTCMPLSKMPISLAHGIIRSSVLLVFLTASFIGNIVLALVLQRKPQLLQVTNRFIFNLLVTDLLQISLVAPWVVATSVPLFWPLNSHFCTALVSL
THLFAFASVNTIVVVSVDRYLSIIHPLSYPAKMTPRRGYMLLYGTWIVAILQSTPPLYGWGQAAFDQRNALCSMIWGASPSYTILSVVSFIIIPLVVMIACYSVVFGAAR
RQHALLYNVKSHSLEVRAKDRVENEVEEGEKKDVFHGQDRGEVKAKEGSVEAEAGSMHAQNGSMDSSAGSAAAKGSKDVGESSLMLGKGSVEGKDEGTGPASSRKADKGH
VEVSQCNIDLGEDDVEFGEDDINFSEDDIEAVNIPESLPPSRRNSTSDPPLPRCYQCKAAKVIFLIIFSYVLSLGPYCFLAVLAVWVDVQTKVPQWVITIIIWLFFLQCC
IHPYIYGYMHKTIKKEIQDMLKKFFCKEKPPKEDSHPDLPGTEAGTEGGTGGKIVPSHDSATSP*
647 >lcl|XP_549303.2|Plus1complement(64198113..64200629) NW_879563 SLIT and NTRK-like family, member 4 isoform 1 SLITRK4 __SEG__ ChrX {Canis lupus familiaris} MFLWLFLILSALISSTNADSDVSVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRVLPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKSLSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELVPKPLNAKKLHVNGNSIKDVDVSDFAEFEGLDLLHLGSNQITAIKGDVFHNLTNLRRLYLNGNQIERL
YPEIFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFAGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVVKELRCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVIMRNVADKEKDLLHVDSRKRLSTIDELDELFPSRDSNVFIQNFLENKKEYN
SIGVSGFEIRYPEKQQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI*
648 >lcl|XP_549310.1|Plus165983067..65985604 NW_879563 SLIT and NTRK-like family, member 2 SLITRK2 __SEG__ ChrX {Canis lupus familiaris} MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLENLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSTGDSSQRGGHADTHVQRLSPTMNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQTVYRNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLYP
SMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTVLSMNHNTDTPRSLTVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRSANNL
DVSSFQLQYGSYNTETQDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYGNLEEKKEEPATLAYTISASELLEKQATPREPELLYQNIAERVKELPSAG
LVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPDHPLLQAKPQSEPDYLEVLEKQTAISQL*
649 >lcl|XP_549379.3|Plus1complement(73912505..73913467) NW_879563 olfactory receptor 10A7 cOR7R1 __SEG__ ChrX {Canis lupus familiaris} MALLQANHTLNSEFIILGFGDLAELQVFFFGLFLIMHLVTLAGHTTIVLITLIDSCLQTPMYFFLRNLSTIEICYILVIVPNMLANFLSRSQRMPFLGCALQMHLFIALG
GAECFLLAVMAYDRFVAICNPLRYTVIITRALCLQMLTLACISGFTLSLTLTTLIFLLPFCRSHEINHFFCDIPAVLFLACSDTRANEIAVFLVCMLILLIPFLLILLSY
AFIIAAILRIHSAEGRSKAFSTCAGHLLVSVLHYGCAIFIYIRPKSCYTPEQDKVVSLIYTNVTPMLYPMIYSLRNKEVKGALRRLLESYSQMRQLPNAR*
650 >lcl|XP_549391.1|Plus174967717..74968583 NW_879563 protein sprouty homolog 3 SPRY3 __SEG__ ChrX {Canis lupus familiaris} MDAAVTDDFQQILPIEQLRSTHASNDYVERPPVPCKQALSSPSLIVQTHKSDWSLATMPTALPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQ
SIIRTQPGAGAHPKVDGALKGEAEQSAVHPSEHLFICEECGRCKCVLCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFV
RWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV*
651 >lcl|XP_848395.2|Plus1complement(122038..122982) NW_876284 olfactory receptor 6C4 cOR6C33 __SEG__ Chr27 {Canis lupus familiaris} MGNQTSVIEFILLGLTNDAELQAVLFPFLLLTYVLSIMGNLTIIILTLLDYRLQTPMYFFLRNFSVLEISFTSVFVPKMLVNIATGDKTISFAGCFTQYFFAILLGATEF
YLLAAMSYDRYVAICKPLHYTTVMSRKLCIQLVLCSWFSGFLVVVVPHAMTLQLPFCASNVINHYCCDYTVLLHLSCSDTQFIEVMEFIFAAVTLILTLVPVTLSYTYII
RTILRIPSVQQRKKAFSTCSSHMIVVSLSYGSCIFMYINPSVKDAETFNKRVAVLNTSVAPLLNPFIYTLRNKQVKIAFKDMVSKITMFSGKRK*
652 >lcl|XP_848488.1|Plus1complement(5730643..5731575) NW_876260 olfactory receptor 2A2-like isoform 1 LOC482721 __SEG__ Chr16 {Canis lupus familiaris} MEGNQSWITEFILVGFQLSEDIEVLLFCIFSLFYIFNLLANGMILGLIWLDLRLHSPMYFLLSHLAIIDICYASSNLPNMLENLVKHKKTISFVSCTMQIVLFVTFAGAE
CLILVVMAYDRFVAICHPLQYTVIMNWRVCVVLVIATWACGFSLALVHLILFLKLTFCGPQEVNHFFCEILSVLKVACGDTWINEALVFAGGMFVLVGPLSLMLVSYMRI
LWAILKIQTKEGRRKAFSTCSSHFCVVGFYFGIAMMVYLVPDNSQREEQQKILTLFYTLFNPLLNPLIYSLRNAQMKAAFNKALQKKRTI*
653 >lcl|XP_848518.1|Plus1complement(5761450..5762379) NW_876260 olfactory receptor 2A2-like isoform 1 LOC482722 __SEG__ Chr16 {Canis lupus familiaris} MGSNQSWVTEFVLVGFQLSAEMEVLLFWIFSLLYIFSLLANGVILGLIHLDLRLHTPMYFFLSHLAVIDMSYASNNVPKMLVNLVNQKRTISFVPCVMQTFLYLGFAATE
CLVLVVMSYDRYVAICHPLQYTVIMSWRLCTVLAVTSWSCGFFLSLVHAILLLRLPFCGPRKVNHLFCEILSVLKLACADTRLNQMVIFAACMFVLVVPLCLMLVSYMCI
LWAILKIQSKQGRRKAFSTCSSHLCVVGLFFGIAMLVYMVPDSNQREELEKILSLFHSLFNPMLNPLIYSLRNAQMKASLYRVLQKKTM*
654 >lcl|XP_848571.2|Plus1complement(279057..279992) NW_876284 olfactory receptor 12-like LOC606981 __SEG__ Chr27 {Canis lupus familiaris} MKSKLSRNSSGVTEFILLGFRTAPDIQILLFLFFLLVYVVTVVGNVSMIIVIRMDSRLHTPMYFFLRHLSYVDLCYSTVIAPKTLANFLSHEKKISYNGCAAQFFFFALF
VTTESILLAVMAFDRFSAICSPLLYPVHMSQKVCAQLVTGSYICGGLNSMVHTGFTFSLRFCGENHLDHFFCDVSALIKISCVDTSVNEMVLFILSALIIVTTTTVILVS
YAYILSTVLKIPSTHGRGKTFSTCGSHMATVTLFYGTVFFMYAQPGAISSPGQNKVVAVLYTLIIPMLNPLIYSLRNRDVKDAVRRVLHRK*
655 >lcl|XP_848675.1|Plus1complement(368935..369894) NW_876326 olfactory receptor 2B11-like LOC607036 __SEG__ Chr8 {Canis lupus familiaris} MRGENQSFLGGPPKDFILLGVSDRPWLELSLYVVLLVSYLLAMLGNIAIILVSRLDPQLHSPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSTRKTISFGGCTVQYAIFHW
LGCTECIILAAMALDRYVAICEPLQYAIIMYHPLCQKLVAVAWLSGFGNSLVQVVLTVQLPFCGRQVLNNFFCEVPAMIKLSCADTTMNDAMLAVLVAFFVLVPLALILL
SYGFIARAVLRIQSSRGRRKSFGTCSSHLVVVSLFYLPAIYMYLQSPSSYSQEQGKFISLFYSIITPTLNPFIYTLRNKDVKRALRRLLSRTWRFCRRL*
656 >lcl|XP_848871.1|Plus11243277..1245712 NW_876292 protocadherin alpha-1 PCDHA1 __SEG__ Chr2 {Canis lupus familiaris} MLFPRQGGKGCLRLLLSVLFLEAWKAGSGQVRYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRLASKGHGDLLEVNLQNGILFVNSRIDREELCGRTLECSIHLEVIV
DRPLQVFHVEVEVKDINDNPPVFRAREQRLFIPESRLVDSRFPIEGAADEDIGINALLTYTLSPSDYFSLDVQASDELSKSLSLELRKPLDREETPELHLLLTATDGGKP
ELEGRVQLLITVLDVNDNAPLFAQAVYRVHLLEGTANGTLVTTLNASDADEGVNSEIVFSFGSHVTINFQKNFKIDSSSGEIRLIGKLDYEDTKSYEIQVKAVDKGNPPM
SNHCKVLVKVLDVNDNAPQLAITPLSLPVREDTPLGTVIAFVSVSDRDSGANGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRESVANYALVVTARDGGSPSLSATAS
VSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVT
LQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARSPFRVALYTGEISTTRALDEADAPRQRLLVLVKD
HGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAPPSEGACGPGKPTLVCSSAVGSWSYSQQRRQRVCSGEG
PPKADLMAFSPSLPQVPGSTEERQQPSESEHLGKVSLSCQF*
657 >lcl|XP_848879.1|Plus1complement(13111883..13113184) NW_876265 probable G-protein coupled receptor 22 isoform 2 GPR22 __SEG__ Chr18 {Canis lupus familiaris} MCFSPILEINMQSESNITVRDDIDDIDTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMKSNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESN
TALICCFHEACVSFASVSTAINVFAITLDRYDISVKPANRILTMGRAVMLMISIWIFSFFSFLIPFIEVNFFSLQSGNTWENKTLLCVSTNEYYTELGMYYHLLVQIPIF
FFTVIVMLITYTKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHETTDMSQSSGGRNVVFGVRTSVSVIIALRRAVKRHRERRERQKRVFRMSLLIISTFLLCWTPIS
VLNTTILCVGPSDLLVKLRLCFLVMAYGTTVFHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPMPNNAVIHNSWIDPKRNKKITFEDSEIREKCLVPQVVTD*
658 >lcl|XP_848888.1|Plus11250589..1253126 NW_876292 protocadherin alpha-3 PCDHA3 __SEG__ Chr2 {Canis lupus familiaris} MVRLFKKKMRNSNYFLKFGRRQERHNIWKRLAIVFSWREEGSGARRLLLSFLFLTVWKTGSGHVHYSVLEEAKHGTFVGRIAQDLGLELAELVPRLFRLESKGHGDLLEV
NLQNGILFVNSRIDREELCGRTLECSIHLEVIVDRPLQVFHVEVEVKDINDNQPVFPMAVKKLFLFESRPPGSRIPLEGASDADIGANSLLTYSLNSNDYFTLDIKRNDE
NIKSLGLVLKKVLNREDTPEHHLLITAVDGGKPELTGTTQVKITILDVNDNAPEFERTVYKVSLFENAPNGTLAVIVNASDLDEGVNKDVVYSFNTDTSADTLSKFYLDP
VNGYINVKGNIDFEETKLYEIQVEATDKGTPPMSGHCTVLVEIVDTNDNVPELVIKSLSLPVLEDAPLGTVVALISVSDRDSGANGQVTCSLTPQVPFKLVSTFKNYYSL
VLDSALDRESVANYALVVTARDGGSPSLSATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKV
YALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARS
PFRVALYTGEISTTRALDEADAPRQRLLVLVKDHGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAP
PSEGACGPGKPTLVCSSAVGSWSYSQQRRQRVCSGEGPPKADLMAFSPSLPPGPIGGDREQLNVEVDLSPKVSTF*
659 >lcl|XP_848931.1|Plus11276880..1279336 NW_876292 protocadherin alpha-6 PCDHA6 __SEG__ Chr2 {Canis lupus familiaris} MVITLEGRLGSQHLLLSLLILTAWKAGSGQVRYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRLASKGHGDLLEVNLQNGILFVNSRIDREELCGRTLECSIHLEVIV
DRPLQVFHVEVEVKDINDNAPVFHLKEQRVRISESRLPDSLFPLEGASDADVGSNSILTYKLSSSKYFALDVKTNSDDNTQIGLVLRKSLDREEVPEHNLLLTATDEGKP
ELTGTVQVLVTVLDVNDNAPSFEQTEYEVRIFENLGNGTVVIRLNASDRDEGVNGEISYSFNSLVPAMVGDQFRIDPNTGEIVTKGNLDFEKLNLYKIRVDATDKGHPPM
AGHCTVVLRVLDINDNVPQIALTSLSLPIREDAQLGTVIALISVSDLDSGANGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRESVANYALVVTARDGGSPSLSATAS
VSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVT
LQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARSPFRVALYTGEISTTRALDEADAPRQRLLVLVKD
HGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAPPSEGACGPGKPTLVCSSAVGSWSYSQQRRQR
VCSGEGPPKADLMAFSPSHPPCLVVGDMNEHQDLNDEHCTKVSLNFHN*
660 >lcl|XP_848945.1|Plus11287184..1289673 NW_876292 protocadherin alpha-7 PCDHA4 __SEG__ Chr2 {Canis lupus familiaris} MVCSNQGDREHRQLLLFFMMLTAWEPASGQIHYSVLEEAKHGTFVGRIAQDLGLELAELVPRLFRLASKGHGDLLEVNLQNGILFVNSRIDREELCGRTLECSIHLEVIV
DRPLQVFHVEVEVKDINDNAPVFPETQKYLFIAESRMLDSRFPLEDASDADIEENALLTYRLSPNEFFSLDVPTNDEQVKPLGLVLRKPLDREQSPELHLLLTATDRGKP
ELTGTVQLLIKVLDANDNAPAFDRTLYAVKLPENVPNGTLVIKLNASDLDEGLNGDIIYSFFSDISPDIKSKFYIDAVSGEIIAIGHIDFEESKTYKLRVEAIDKGSLPL
AGHCTVLVQVLDANDNAPELTVTSLSLPISENAQPGTVITLISVSDRDSGANGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRESVANYALVVTARDGGSPSLSATAS
VSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVT
LQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARSPFRVALYTGEISTTRALDEADAPRQRLLVLVKD
HGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAGAGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAPPSEGACGPGKPTLVCCSAVGSWSYSQQRR
QRVCSGEGPPKADLMAFSPSLPPCPGSLNATEDPQASLQSSGKVGYSNILFFYLFIFEV*
661 >lcl|XP_848955.1|Plus11295096..1297639 NW_876292 protocadherin alpha-10 PCDHA10 __SEG__ Chr2 {Canis lupus familiaris} MLVYTPSGLIAQHGLLLLLLLAAWKAGSGQVRYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRLASKGHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIV
DRPLQVFHVEVEVKDINDNAPIFSVSEQKLSIPESRLLDSRFPLEGASDADVGENAVLTYRLSPNEFFILDIINKKDKGKFPVLVLGKMLDREENPQLQLLLTATDGGKP
EYTGSVTLLILVLDANDNAPIFDRSVYEVKMYENSANQTLVIWLNASDADEGINKEMIYSFSALVSPSIRRKFLMNEKTGEIRVNDAIDFEDSNTYEIHVDVTDRGNPPM
VSHCTVLVEVLDENDNPPEVVITSLALPVQEDAQVGTVIALISVTDRDSGANGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRESVANYALVVTARDGGSPSLSATAS
VSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVT
LQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARSPFRVALYTGEISTTRALDEADAPRQRLLVLVKD
HGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAGAGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAPPSEGACGPGKPTLVCSSAVGSWSYSQQRR
QRVCSGEGPPKADLMAFSPSLPPCPVPDVEMEGESSGGDYSGKVGYYFLNFHMLLCEEFINRFLPSCPLRISSSFLI*
662 >lcl|XP_848992.2|Plus1complement(1133501..1135636) NW_876250 LOW QUALITY PROTEIN: zinc finger and BTB domain-containing protein 39 ZBTB39 __SEG__ Chr10 {Canis lupus familiaris} MGMRIKLQSTNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYEVAERLG
MEDLLRACHSTFPDLESTAVAKPLSGTGESHPGTQSCSSAEPAYPLGDLRGAGEHFGPDRNYVLPSDGGGSCKEEERNVTGDINQSLPLPQQPLPPKTEEHDAPAPSPRS
WCGDYPAGPGHCQHEHPNQHELLPAIQSSEQRRLQ*KQFLHPGQRDRHYHRDQLLSEQ*RPLQRPQLRSDG*APAGRPGG**LAV*RPH*GDRHSRGGD*VE**Q*G*AD
FWRE*QPRE*GHALPGVQESSRAQHSADPTACSGPRGPADRQLQGLRDPLPGPELPGDPCSVPHWHFPLLLRHV*N*VLYPVAADPPPTGWDI*EQHHRPPQRSPVWEAG
FVFGGGLGRVEMCCLWEGAGQRFPRGAGARP*PSEPEGPGLQRLRPAPPQPLQPHVAHAVPSGHLSLLLLCVCKQLCGLASPREAHGRASKPRRRPLPLPLVQPELQVGG
CLSLPSQPAQMQQWP*RAARFGATAPSFPEAEAASRGVLE*GAGSAGPAWEQQV*LQGLWQKVCPHKRVQLPPADPHGREAVPV*GVPQVLPRPLDHQVPPEDTLRGPHV
PLHCLWPLQLHPEPHEQACGRAQGQPPARLHHRADLHVHYPFQRGGKEPGQL
663 >lcl|XP_848994.1|Plus11312152..1314617 NW_876292 protocadherin alpha-11 PCDHA11 __SEG__ Chr2 {Canis lupus familiaris} MRCSGFQRRGLGTRRLLLSVLLLAVWEPASSQVRYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRLASKGHGDLLEVNLQNGILFVNSRIDREELCGRTLECSIHLEV
IVDRPLQVFHVEVEVKDINDNPPLFSLREQKLLIPESKQPDSYFPLEGASDADIGENALLTYRLSHNEYFSLELPTQSKQTKRLSLKLKKYLDREKTPEFNLLLTAADGG
KPELTGTIQLFVHVLDINDNDPEFEQSEYKVKLTENAAKETLVIKLNATDPDEGVNGEVTYSLMSIKPNGKLLFTLDKNNGEVRVNGTLDYEENKFYEIEVQATDKGNPS
MAGHCTVWIEILDANDNAPEVTITSLSLPVREDAQPSTVIALISVSDRDSGANGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRESVANYALVVTARDGGSPSLSATA
SVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNV
TLQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARSPFRVALYTGEISTTRALDEADAPRQRLLVLVK
DHGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAPPSEGACGPGKPTLVCSSAVGSWSYSQQRRQRVCSGE
GPPKADLMAFSPSLPRGLDGEVGGERQEAGSNHPGQVSSIDSSSFEVYVKF*
664 >lcl|XP_849015.1|Plus11319607..1322045 NW_876292 protocadherin alpha-12 PCDHA12 __SEG__ Chr2 {Canis lupus familiaris} MVFSWRGGPGAPRLLVSLLLLAVWEPGSGQVHYSVPEEAKHGTLVGRIAQDLGLELTELVPRQFRVASKGRRHLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIV
DRPLQVFHVEVEVKDINDNPPVFREGEQKVLISESAPLDSHFPLEGAFDADIGVNSLLTYTLGLNEYFTLKIITKNDKSILPELVLRKSLDREETPELNILLTSQDGGKP
ELTGSVQIKINILDVNDNAPEFGKPGYKVALFENVPNGTRVIQLNASDLDEGVNREISYGIRLILPVSEKCTFTINPETGEIRMYGKLDFEENNEYEIQVNAVDKGIPSM
AGHCTVLVEILDLNDNTPEVMITSLALPVREDAQVGTVIALISVSDRDSGANGQVTCSLTPQVPFKLVSTFKNYYSLVLDSALDRESVANYALVVTARDGGSPSLSATAS
VSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVT
LQVFVLDENDNAPALLPLPLPLPLPGARGGGGALSEPVSRAVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARSPFRVALYTGEISTTRALDEADAPRQRLLVLVKD
HGEPALTATATVLLSLVESGQAPRPSSRVLAGGAGAGAGAGAALVDVNVYLIVAICAVSSLLVLTLLLSTALRCSAPPSEGACGPGKPTLVCSSAVGSWSYSQQRRQRVC
SGEGPPKADLMAFSPSLPQSEVCLNTSSEVSHSYHLNICFLS*
665 >lcl|XP_849187.1|Plus11562245..1564641 NW_876292 protocadherin beta-14 PCDHB14 __SEG__ Chr2 {Canis lupus familiaris} MEIKGELTLRKRQVLIFFVLLGLSQAGPESVQYSVAEETEVGSFVANLARDLGLGVEELSSRETRVVSDDNEKHLHLDLLTGDLLLNKKLDREELCGSTEPCVLHFQMVL
ENPLQFFRAELYVKDINDHSPTFLDKQILIKISESTITGTTFLLESAQDLDVGTNSLQNYTISPNSHFYIKIRDSSDGKIYPELVLDRELDHEEEPELTLTLTALDGGSP
PRSGTTLVLIKVLDINDNAPEFAQSLYEVHVLEDTPVGSWIITIFANDLDAGNYGKISYTFLYASEDIRKTFEINPISGEVHLRSCLDFEVIQFYTISIQATDGGGLSEE
CTLVVKVIDINDNPPEVTISSFTKSIPENASETLVALFSVRDQDSGDNGRMVCSIQDELPFFLKPTFKNFFTLVSEKALDRETRSEYNITITVSDLGTPRLKTQHNITVT
VSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVL
VLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYQYEVCLTGGTGTSEFKFLKPI
IPSLPVPDTGRHTGENENFRNSFGFNIQ*
666 >lcl|XP_849204.1|Plus11572297..1574684 NW_876292 protocadherin beta-18 PCDHB11 __SEG__ Chr2 {Canis lupus familiaris} MEPGEKHSQQIRQVLLFFVFLGGSLVCSEPWRYSVAEELEIGSFIANVVKDSGLSVEDLVARGVRVIFDDYKPYLQLDQQSGNLLLNEQLDREALCHLTEPCILHFQVLL
ENPLQFFRAELWVKDINDHIPTFLDKHILLKISESTAPGTSFQMDSAQDLDVGKNGVQNYTLSPNPYFRLKVQDSDDGRKYPELLLDQSLDREKEPELKLKLTALDGGSP
PRSGTTLVHILVLDINDNAPEFERPVYEVQVPENSPVDSLVVRVSATDLDAGIYGEVSYSFSHVSTDIRKTFEIHPISGEIHLKALLDFELIQSYTINIQATDGGSLSGK
SAILVQVVDVNDNPPEILMTSLTSPIPENSSPEMVVAVFSLRDQDAGNNGRMVCSIQDDLPFLLRPTFKNFYTLVTNGALDRESQAEYNITITVSDLGTPRLKTQHNITV
TVSDVNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRV
LVLDDNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLH
VLLVDGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCAVPEGHFPGHLVDVSGAGTLSQSYQYEVCLTGGSGTSEFKFLKP
AFPNLPPQECKMEESHTFKNSIEFI*
667 >lcl|XP_849218.1|Plus1complement(2712761..2713699) NW_876252 olfactory receptor-like protein DTMT-like LOC607447 __SEG__ Chr11 {Canis lupus familiaris} MDRDNQTTVTEFLLLGLSGQSEQEDILFGLFLGMYLVTIIGNFLIVLAISSDSHLHTPMYFFLANLSCVDICFSSVTTPKMLVNHILGSESISYMECMIQIYFFITFTNM
DGFFLSVMAYDRYVAVCCPLHYTMIMKPKLCMLLVVASWVITNLHALLHTLLMAQLAYCFNNTVHHFFCDPYAILKLSCSSTFINDLMVFTVGGLVFLTPFTCIIISYAY
ILSNVLKLPSAHGIRKAFSTCGSHLTVVSLFYGAILGVYMRPSSSYSVQDTVATVIFTVVTPLVNPFIYSLRNHDMQRALRKLISVSRIRKF*
668 >lcl|XP_849221.2|Plus11578182..1580545 NW_876292 LOW QUALITY PROTEIN: protocadherin beta-15 PCDHB13 __SEG__ Chr2 {Canis lupus familiaris} MEAEEERFPRLRQVLLFVLLAHSCAEQEDYRIAEETESGSFVANLAKDIGLGVKELSWRRARIIFNDDKKHFQLNLQTGDLQINEKLDREELCGSTEPCVLQFQVLLEEP
LEVYRYKLLLSDINDNSPVFPESEMILKIMENTLPGTVFPLKNAQDLDVGINNIQNYTIYPNSHFHVLTRNSGEGRKYPELVLDKALDREEQTELRLTLLAVDGGVPPKT
GTALVLIDVLDINDNAPEFVQPLYRAQIPENSPLGSLIVTVSARDLDTGTNGKVFYSFFYGDEEISRTFALNELTGEIKIIRELDFEKIMSYELDIKASDGAGLSGKCTV
IIEVVDINDNTPELTMASLTSSIPENSPETTIALFSIQDRDSGENGRMVCSIQEDVPFTLKPSLENFYKLVTEGALDRESQAEYNITITVSDLGTPRLKTQHNITVTVSD
VNDNAPAFSQTTYTLRVRENNSPALHIGTVSATDRDAGANAQVTYSLLPPRDPHLPLASLVSINADNGQLFALRSLDYEALQAFEVRVGAADRGSPALSSQALVRVLVLD
DNDNAPFVLYPLQNGSAPCTELVPRAAEAGYLVTKVVAVDGDSGQNAWLSFQLLKATEPGLFGVWAHNGEVRTARLLSERDAVRHRLLVLVKDNGEPPLSASVTLHVLLV
DGFSQPYLPLPDVAAAEARADPLTVYLVIALASVSSLFLCSALAFVAVRLCRRSGAASGGGCGVPEGHFPGHLVDVSGAGTLSQSYQYEVYQRRIWDQGI*VLDVCCLHL
TEVCE*RGGKPKFCK*FL
669 >lcl|XP_849300.1|Plus11640775..1643216 NW_876292 protocadherin gamma-A1 PCDHGA1 __SEG__ Chr2 {Canis lupus familiaris} MVIRRKRPSCSELYLLCFFLGLSLEAWAGKIRYVVPEETEKAFFVGNIAEDLGLQPQEFKERGVRIVSRGRTQLFALNPRSGSLVTADRIDREELCAQRARCLVNFNILV
EDKMKLFPVEVEIIDINDNTPQFQLEEVEFKMNEITAPGTRIPLPFGQDPDVGMNSLQSYQLSSNPHFSLDVQQGTDGSQHPEMVLQSPLDREEKAMHHLLLTASDGGSP
VRSGTLHIRVRVVDANDNPPAFTQAQYHMSVPENVPLGTQLLMVKATDPDEGANGEVSYSFHNIDHKIAHIFQLNSYTGEISNKEALDYEEHKSYPMEIQAQDGAGLMAR
AKVLVKVLDINDNAPEVTMTSVTTAVPENSPPGAIIALISVHDQDSEENGDTTCSIAGNIPFKLEKLDENYYHLVTERTLDRELTSRYNITVTAADHGTPALYTETHISL
QVTDINDNPPVFPQNSYSTFILENNPRGASFFSAIAYDADSNENALVTYSLVEDTIQGMPLSSYVSINSDTGVLYALRSFDYEQFQDLQLRVIACDSGDPPLSSNVSISL
FVLDQNDNAPEILYPVLTTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFQVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAIADSIPDVLADLGSLEAPRDSQASDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHASRLLQAAGGGLLGAPASASQFVGVDGVRAFLQTYSHEVSLTAGSRESHV
IFPQPNYADTLLSQESCGKSEPLLVTQDLLEDKKETFSQVNFS*
670 >lcl|XP_849314.1|Plus11649512..1651983 NW_876292 protocadherin gamma-A2 PCDHGA2 __SEG__ Chr2 {Canis lupus familiaris} MAALQKLPQHGRLMLLCFLLAVLCEARAWQMHYSVPEEIDKDSFVGDIAKDLGLEPLVLAERGVRIISRGRTQLFALNLRSGSLVTADRIDREELCAQSVRCLVNFNILL
EDKLSIYSVEVEITDINDNAPRFGVEELELKISETTTPGFRIPLKSAHDADVGENTLQKYELNPNDHFSLDVRSRVDGNKYPELVLEHSLDREEKAFHHLILVALDGGSP
IRSGTSRIRVTVLDANDNAPVFTQPEYRVSVPESMPIGTRILTVTATDADEGYNAQVAYFQEKNLGETSKVFELESTSGDIIITKSLDYEDAKVHEIDIEAQDGPGLLTR
TKVIVTVLDVNDNAPEFYVTSATSSIPEDSPPGTIIALFNVHDRDSGQNAFITCSLPENLPFKLEGSVDNYHRLVTTRTLDREQFSSYNITVTAKDGGKPSLSTDAHILL
QVADINDNPPTFPHMSYSAYIPENNPRGASIISVVAHDPDSEDNGHVTYSLIEDTLHGAPLSSYISINSDTGILYALCSFDYEQFQDLQLWLTAWDSGNPPLSSNVSISI
FVLDQNDNAPEILYPVLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFQVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAIADSIPDVLADLGSLEAPRDSQASDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHASRLLQAAGGGLLGAPASASQFVGVDGVRAFLQTYSHEVSLTAGSRESHV
IFPQPNYADTLLSQESCGKKDFLSAAPQSLLEEKGEETFSQVNSLHNILTSYC*
671 >lcl|XP_849328.1|Plus11654629..1657244 NW_876292 protocadherin gamma-A3 PCDHGA3 __SEG__ Chr2 {Canis lupus familiaris} MTKYLRFKHRGGLALLCILLGMLCKSGSGQIHYSVQEELDKGSFVGNISKNLGLEPWQLMEHGVRIVSRGRTRLFALNLRSGSLITAGRIDREELCAQITLCLVKFNILV
EDKLKIFEVQIEIKDINDNAPDFLTEELEIKIGELTAPGTRFPLKTAFDPDVGMNSLQNYHLSLNDYFSLTVKHVSGGAKYPELVLERALDREQKKIHQLVLIASDGGNP
VLSGNLCIRVIVLDANDNPPVFTQSEYQVSVQENLPVGTTLLTVNATDPDEGFNAQVSYILDKMPGKVAQIFYLNSVTGDISILRSLDYEDAMFYEIKVEAQDGPGLFSR
AKILVTVLDVNDNAPEVTITSLTGSVPEEATAGREIALINVHDRDSGQNGQVTVFVLGNMPFNLEKSIDQYYRLVTARSLDREQVSEYNITLRATDGGNPPLSTNTHIIV
HVADINDNPPAFSQATYSAYILENNPRGASIFCVTTQDPDSIHNAHITYALMEDTIQGVPLSTYVSINSNTGVLYALCSFDYEQVRDLHLLVTACDNGNPPLSSNVSISI
FVLDQNDNAPEILYPTLPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFQVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAIADSIPDVLADLGSLEAPRDSQASDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHASRLLQAAGGGLLGVPASASQFVGVDGVRAFLQTYSHEVSLTAGSRESHV
IFPQPNYVDTLLSQESCGKSEPLLITQDISETKGNSSLLKVGFFLSWNIIKNNYAGVANIKVLIQIFFENKTTWSSSVLLFKYLFLSSSGLMVELIFLTWL*
672 >lcl|XP_849349.1|Plus11659661..1662117 NW_876292 protocadherin gamma-B1 PCDHGB1 __SEG__ Chr2 {Canis lupus familiaris} MQRSSGKTELMKIQVLFLFLLSLLWGAISQQIQYTIPEEQAKGLRVGNLAKDLKLSVQELPARKLWVSAENFFSVSTESGDLLVNGRIDREEICGRKSECTLEFEMVAEN
PMNVFHVIVEIQDINDNAPRFMAKVIDLEICESALPGVKFPLDSAQDADAESNSLKIYTINPNEHFSVTMKESPDGSKYPELLLEKPLDREQQSSHQLILTAMDGGDPPL
SGTTQIRIQVTDANDNAPVFSQDTYRVSLQENVPWGTSLLQVMATDQDEGVNAEITYAFLSAPTSTSLLFNLNPNTGDITTNGTLDFEKTSRYMLVVEAKDGGVHTAHCN
VQIEIVDENDNAPEVTLMSFSNQIPEDSDLGTVIALFKVRDQDSGQNSLVTCYIQEEGPFKLESTSKNYYKLVIDSALDREQMAEYNVTITATDKGKPSLSSSKSVFLHI
TDVNDNAPVFQQASYVVHVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLV
GDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLLL
VFADSLQEALPDVSERQAPADPQAELQFYLVVALALISVLFLLAVILAVALRLGRSSSPTTWGCLRPGLCVKSGPVVPPNCSEGTLPYSYNLCIASQSAKTEFNFPNLKP
EMVPPRDLLCDDPSMDGCVNNEDPQLVYESAFASHVSFCKPTFILCSA*
673 >lcl|XP_849372.1|Plus139334674..39337550 NW_876274 SLIT and NTRK-like family, member 5 isoform 3 SLITRK5 __SEG__ Chr22 {Canis lupus familiaris} MHTCCPPVTLEQDLHRKMHSWMLQTLAFALTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLNRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLESLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKP
PKGTRQPNKPRVRPTSRQPSKDLGYSNYGPSIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYIAVVRRSDFLEATGLDLLHL
GNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREIQSGTFDPVPNLQLLFLNNNLLQTMPSGVFSGLTLLRLNLRSNHFTSLPVSGVLD
QLKSLIQIDLHDNPWDCTCDVVGMKLWVEQLKVGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPTPSSIQVPARTSAVTPAVRMNSTGAPAGLGAGGGASS
VPLSVLILSLLLVFIMSVFVAAGLFVLVMKRRKKNQSDHTSTNNSDVSSFNMQYSVYSGGGGAGGHPHAHVHHRGPALPKVKTPAGHVYEYIPHPLGHMCKNPIYRSREG
NSVEDYKDLHELKVTYSSNHHLQQQPPPPPPPPQPQPPPPPQLQLQPGEEERRESHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKF
PCSPAAYTFSPNYDLRRPHQYLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQF*
674 >lcl|XP_849379.1|Plus1complement(1337722..1338657) NW_876258 olfactory receptor 2L3 cOR2L17 __SEG__ Chr14 {Canis lupus familiaris} MENFNQTSGFFLLGLFPPSRIGLCFFILIVLIFLMAVFGNLSMIILIFVDTHLHTPMYFLLSQLSLMDLSYISNIVPKMASNYLSGNKSISFIKCGVQSFFFIALAGAEG
LILASMAYDRYVAICFPLHYPIRISKKVCVLMITGSWIVGSVNSCAHTVYAFNIPYCQSRTINHFFCEVPAMLTLACMDTWVYEYTVFVSTTLLIVIPFIGIACSYGRVL
LAIFHMQSTEGKKKAYSTCSTHLTVVTFYYAPFAYTYLRPRSLRTPTEDKALAVFYTILTPMLNPIVYSLRNKEVMGALRRVILKFCSIEM*
675 >lcl|XP_849426.1|Plus11695006..1697474 NW_876292 protocadherin gamma-A7 PCDHGA7 __SEG__ Chr2 {Canis lupus familiaris} MAAPQKGGDYRGFILLSILLGTRRGAWAGHILYSVPEETDKGSFVGNIAKDLGLEPLELAERGARIVSTGRTQLFALNLRSGSLVTADRIDREELCAQSARCLVNFNILM
DKMNLYPIEVEIIDINDNAPRFLMKEMTVKITENTAPGVRYPLNEARDPDVGTNSIQSYQLNSNQHFSLVVQTGDDGAKYPELVLERVLDREEEAVHHLLLTASDGGNPP
RSETARIQVTVVDVNDHAPVFSLPQYQVSVPENMPVGTILLTVHAVDLDEGLNGEVTYSFRKITQKILQIFQLNPHTGELSTLEGLDYEVSNYYEMEVQAQDGPGSMTRA
KVMITILDVNDNTPEVTVTSVSNLIPEDTPLGTVVALFYLQDRDSGENGEVTCTISENLPFKLERSIDNYYRLVTAKNLDREKLSVYNITLKATDGGTPPRSSETHISMN
VADTNDNPPAFPQSSYSVYIPENNPRGASIFSVTAHDPDSQENAHVTYSLSEDTLQGASLSSYVSINSDTGILYALHSFDYELFRDLQLRVTAQDRGDPPLSSNVTLSIF
VLDQNDNAPEILYPTLPIDGSTGVELAPRFAESGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFEVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTLT
VAVADSIPDILADLGSLEPPADPNASGLTLYLVVAVAAVSCVFLAFVMVLLALRLRRWHASRLLQAAGGLLGVPASASQFVGVDGVRAFLQTYSHEVSLTAGSQGSHVIF
PQPNYADMLISLETCEKKDPLSIDFHECKDEAENIQVSSLIYLYVLKEYYFV*
676 >lcl|XP_849461.1|Plus18282044..8283996 NW_876258 leucine-rich repeat-containing protein 4 LRRC4 __SEG__ Chr14 {Canis lupus familiaris} MKLLWQVTVHHTWNAVLLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSI
RQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLE
ELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHA
PLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
STAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVPATDTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKR
HQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI*
677 >lcl|XP_849474.2|Plus11711474..1713897 NW_876292 protocadherin gamma-B5 PCDHGB5 __SEG__ Chr2 {Canis lupus familiaris} MGSGAGERGWAERWPVLLPFLLSLFCWALSEQIRYRIPEEMPEGSVVGNLAKDLGLSVHELPTRQLRISLEKPYFTVSAKSGELLVSSRLDREQMCGKKSACTLEFEAVA
ENPLNFYHVSVDVEDINDHTPKFTQTSFDLQISESTVPGTRFILEAAEDADIGLNGLQIYKLSLSPRFSLINKDKLDGSKYPELALEKRLDREQQSYHCLVLTALDGGDP
PLSGTTELQIQVTDANDNPPVFNQDIYRVSLPENVPPGTAVLQVSATDQDEGINSEITYSFYRTGQVFSLNSKTGEITTLRTLDFEETKEYSIVVEGRDGGGLAAQCTVE
INIQDENDNSPEVTFHSLAEMILENGPPGTLIALIKIHDQDSGENGEVNCRLEGEVPFQITSSSKNSYKLVIDGTLDREQTPEYNVTITATDRGKPPLSSSISITLHIAD
VNDNAPVFQQASYEVHEAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGD
RNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLLLVF
ADSLQEALPDVSERQAPADPQAELQFYLVVALALISVLFLLAVILAVALRLRRSSSSTTWGCLRPGLCVKSGPVVPPNCSEGTLPYSYNLCVAHTGKTEFNFLKCNEQLS
SGQDILLCSDSSGALFPLYNTNESTSHPETLTSVSSI*
678 >lcl|XP_849512.1|Plus11721951..1724410 NW_876292 protocadherin gamma-B6 PCDHGB6 __SEG__ Chr2 {Canis lupus familiaris} MGGSCVRRRPAGRRQVLFPFLLPLFYPAICEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLLFYVDAESGDLLVKDRIDREQICKERRRCELQLEAVV
ENPLNIFHIIVVVEDINDHAPQFHKDEINFEISESVSEGARISLDPATDPDINTNSVKDYQINPNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHRLILTALDGGNP
SKSATTAIEIFVRDANDNFPVFSKNEYTISVSENLPPGSSVLQVTATDKDEGINAEVNYYFRSTAQSTRHMFSLDEKTGTIKNNQPLDFEDTERYTMEVEARDGGGLSTQ
CKVIIEILDENDNDPEIIITSLSDEILEDSLPGMVVALFKTQDQDSGENGEVTCNLSRDIPFKIHSSSNNYYKLVTDGALDREHSPQYNVTITATDRGKPPLSSSISITL
HIADVNDNAPVFQQASYVVHVAENNPPGASIAQVSASDPDLGPNGRVSYSIVASDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRV
LVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATL
LLVFADSLQEALPDVSERQAPADPQAELQFYLVVALALISVLFLLAVILAVALRLRRSSSSTTWGCLRPGLCVKSGPVVPPNCSEGTLPYSYNLCVAHTGKTEFNFLKCN
EQLSSGQDILLCNDSSGALIPLQDGHDLTAHPETFTQVSSTFVSSLIFY*
679 >lcl|XP_849541.1|Plus11732075..1734507 NW_876292 protocadherin gamma-B7 PCDHGB7 __SEG__ Chr2 {Canis lupus familiaris} MGGSCVRRRPAGKRQVLFPFLLPLFYPAICEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLLFYVDAESGDLLVKDRIDREQICKERRRCELQLEAVV
ENPLNIFHIIVVVEDINDHAPQFHKGEINLEISESVTPGTGIILESAEDPDINMNSLNKYQLSPNEYFSLEVKDNPDGGKYPELVLKKTLDRETQSSHHLVLTALDSGDP
PQSSTAQIRILVVDANDNPPVFSQNMYKVSLREGVPPGTLVVKVSATDQDEGFNAEITYSFLGVVNKAQHVFSLDSATGSIITHQPLDFEEVERYTMDVEAKDRGSLSTQ
CKVIVEVLDENDNNPEIIITSLSDQILEDSHPGMVVALFKTQDQDSGENGEVTCNLSRDIPFKIHSSSNNYYKLVTDGALDREHSPQYNVTITATDRGKPPLSSSISITL
HIADVNDNAPVFQQASYVVHVAENNPPGASIAQVSASDPDLGPNGHVSYSIVASDLEPRALASYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRV
LVGDRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATL
LLVFADSLQEALPDVSERQAPADPQAELQFYLVVALALISVLFLLAVILAVALRLRSSSSLATGGCFESVLCSKSGPEIPSNYSEGTLPYAYNLCVPGDQTNVEFNFLTS
VDHFPATQDILNKDSSLGLSASILIPNVEADKKTFKQVSI*
680 >lcl|XP_849553.2|Plus11735555..1738017 NW_876292 LOW QUALITY PROTEIN: protocadherin gamma-A11 PCDHGA6 __SEG__ Chr2 {Canis lupus familiaris} MGNPLLRLDRSGLVLLYIFLRTLQESEAGHIRYSVPEETDKGFFVGNISNDLGLEPWELAERRIRIISRDRMQLFALNPRSGSLITAGRLDREELCETVSSCFLNIEILV
EDTLKIYGVEVEIMDINDNAPSFQEAEIEIKVSEHASPGSRFPLPSARDPDVGMNSLQRYQLNPNSYFSLQMRGGTDGAKNPELVLEGSLDREREAAHHLLLTAFDGGDP
IHQGAVAIHVVVLDVNDHVPKFTQSVYRVSIPEDLSSGTRVLMVNATDPDEGINGEVVYSFRNMESKTSEIFQLDSQTGEVLIRGSLDFEKYRFYEMEIQGQDGGGLSTT
AKVFITVVDVNDNAPEITITSSTNSVLENSPPGTVIALLNVQDQDSGENGQVSCFIPNSLPFKLEKTYGNYYKLITNRMLDREQVHSYNITLVAKDQGFPPLSTETHISI
KVADDNDNPPTFVDSSYSVYIPENNPRGASFFSVMALDLDSRENSQVTYSLVEDTLQGAPLSSYISINSDTGTLYALHSFDYEQFRDLQLWVTAKDSGNPSLSSNVSVSI
FVLDQNDNAPEILYPTLPIDGSTGVELAPRYAEPGYLVTKVVAVDKDSGQNAWLSYHLLKASEPGLFQVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAIADSIPDVLADLGSLEAPRDSQASDLTLYLVVAVAAVSCVFLAFVIVLLALRLRRWHASRLLQAAGGGLLGAPASASQFVGVDGVRAFLQTYSHEVSLTAGSRESHV
IFPQPNYADTLLSQYSCGKSEPLLITENSAADLGNPDSTNNQVRLSASQLL
681 >lcl|XP_849572.1|Plus11848499..1849467 NW_876258 olfactory receptor 2AJ1 cOR2AV2 __SEG__ Chr14 {Canis lupus familiaris} MERNNKTITTDFILLGLWPEFSHLAVLICFILMVYLMAVMGNAVLILLIWLDSRLHSPMYFLLSQLSLIDVALISTTVPKMVTNFFSGKRTISQIGCGAQILFSLTLGIS
ECLLLTLMSYDRYIAICNPLRYSILMSHTTCKQMVVGSWAGGAITSLVHTAYVMHLAICHPREIPHFLCEVMALLKLTCEDISAYVKSVVVSSFLVVLIPLSLILASYIH
IFLAVLRMNSLEGKNKALATCFSHLCVVSLYFGPAILVYMRPGSFKTPKINQSLFMFNAILTPMLNPLIYSLRNKDVIAALKSIIISRILLKKMKRQLGCHT*
682 >lcl|XP_849813.2|Plus12545184..2546143 NW_876258 olfactory receptor 2T6-like LOC607872 __SEG__ Chr14 {Canis lupus familiaris} MDGDNQTSSSDFILTGLFTHSAISVFLFSIICAIFFMAMIANGVMIFLIHIDSHLHTPMYFLLSHLSFIDMMYISTIVPKMLIDYLVGKGTISFIACTAQYFLYMGFVGA
EFFLLGLMAYDRYVAICNPLRYPVLMSHQVCWMILASSWLGGALDSFLLTPITMSLPFCSSHKINHFFCEGPTMLRLACGDKAAYEMVMYICCVMMLLIPFSVVIASYAQ
ILITVHQIKSDEGKKKAFATCSSHIMVVTLFYGAALYTYMLPQSYHTPIKDKVFSAFYTILTPLLNPLIYSLRNTDVTEAFKRILARCQGAPGVTRREF*
683 >lcl|XP_849841.2|Plus1complement(2755919..2757841) NW_876254 zinc finger and BTB domain containing 22 ZBTB22 __SEG__ Chr12 {Canis lupus familiaris} MEPSPLSPSGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASATTTTITPAAATSDTVPGAGVPSGSGATVVPATVGSVRSHASIRASENQSPSSSNYFSPRESTDFSS
SSQEAFPASAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCHDGGDERGPVVPGAGLRRPTYAPPSIMPQKHWVYVKRGGNSPAPAPLVPQDPDLEEDEEEDLVL
TCEDDEDEELGGGSRVPEAGGREATLSISDVRTLTEPPDKGEEQVNFCESSNDFGSYDGGGPGAGLDDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFPSSSSSSSSSS
SSQAPGQPPGNQAEHGAVTLGGTSSGALGMPGGPGGTPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVC
AKKFMWRDSFMRHRGHCERRHRLVGGGGGGGPGPGGPTGPTLPLKRESPGAGGGSGDEASGATPQSSRRVWSPPSVHKVEMGFGGGGGTN*
684 >lcl|XP_849917.1|Plus12798576..2799523 NW_876258 olfactory receptor 2G6-like LOC607953 __SEG__ Chr14 {Canis lupus familiaris} MEESNNSSEKGFLLLGFADDPQLERILFVIILLFYILNILGNTAIILVSYLAPILHTPMYFFLSNLSCVDICFTTSVAPQLLVTMNKKEKNMSYGGCVAQLYVAMGLGSS
ECILLAVMAYDRYAAVCRPLQYITIMHPQLCASLAIIAWLSGLITSLIQCSLTVQLPLCGHRKLDHIVCEVPVLIKLACVDTTINEIELFVASVIFLIVPVSLILVSYGF
ITKTVLRIKSAAGRRKAFGTCSSHLIVVIIFYGTIIFMYLQPAKSSSKNQGKFVSLFYTIVTPVLNPIIYTLRNKDVKGALRTLVMRNVLVSKNT*
685 >lcl|XP_850004.2|Plus15184443..5185372 NW_876298 olfactory receptor 5H2-like LOC608017 __SEG__ Chr33 {Canis lupus familiaris} MEKENATLLTELILTGLTYEPQWHIPLFLVFLVIYLLTIVGNLGLIALIWNDPQLHIPMYLFLGSLAFVDAWVSSTVTPKMLVNFFAKSKMISLSECMIQFFSFAISATT
ECFLLATMAYDRYVAICKPLTYPVIMSNTLCIRLILLSFLGGLLHAIIHSSFLFRLTFCDSIIVHHFYCDIIPLLKITCTDPSINYLIVFIFAGSIQMFTILIVLVSYTL
VLFTILRKKSLQGIKKAFSTCGAHLLSVSLYYSALVFMYVRPVAAQSEDQDMIDSLFYTIIIPFLNPIIYSLRNQKVIDSLRKTLKRNS*
686 >lcl|XP_850053.2|Plus15271802..5272716 NW_876298 olfactory receptor 5K1-like LOC487944 __SEG__ Chr33 {Canis lupus familiaris} MTEDNYSLTTEFILIGFTDHPKLKTILFVVFLTIYLVTMVGNLGLVPLILMERRLHTPMYIFLGNLALMDSCCACAITPKMLENFFSKDRMISLYECMAQFYFLCLAETA
DCFLLAAMAYDRYVAICSPLQYHTLMSKKLCLQMTTGAYIAGNLHPVIHIVFLFRLTFCRSHHINHFFCDVLPLFKLSCVDPYINELLIFIFPGSVLVFSIIIVIISYLC
ILFMIFKMKSKEGRGKALSTCASHFLSVSMFYGSLLFVYVRPNSVKEEDKDISVAIFYTLVIPLLNPFIYSLRNKEVINAMKKK*
687 >lcl|XP_850096.1|Plus114230800..14232695 NW_876292 leucine-rich repeat-containing protein 70 isoform 1 LRRC70 __SEG__ Chr2 {Canis lupus familiaris} MNRKTKNRAMCGLHFSLPCLRFFLLVTCYLIFLFHKEILGCSSVCQLCTGRHINCRNLGLSSIPKNFPESTVFLYLTGNNISHINERELTGLHSLVALYLDNSSIVYVYP
KAFVQLRHLYFLYLNNNFIKRLDPGIFEGLSSLRTLYLQSNQVAFVPRGVFNDLVSVQYLNLQRNRITVLGSGTFFGMIALRILDLSNNKILRISDLGFQHLGNLDCLYL
GGNNLTKVPSNAFEVLKSLKRLSLSHNHIGAIQPFAFKGLVNLEYLLLKNSGIKNVARDGFSGINHLKHLILSHNNLENLNSDTFSLLKNLIYLKLDRNRIISIDNDTFE
NMGASLKILNLSFNNLTDLHPRVLKPLSSLTHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALHYIKWTDFTNCVTSSTNVSRSWAIKSLHIHHKTTA
LMMAWHKVTTNGKHLENTESVTFWERSRTSPASRFIQENTFGNPLEATAVLPVQIQLTSSVNLNLEKNSALPIDDAAVSGKTSLICTQEVEKLNEAFDILLAFFILACVL
IIFLIYKVVQFKQKLKAPENSGENRLEYYSFYQSARYNVTASVCNASPNSLESPGLEQIRLHKQIVPESEAQVILFEHSAL*
688 >lcl|XP_850324.1|Plus1complement(12572306..12573400) NW_876272 probable G-protein coupled receptor 62 GPR62 __SEG__ Chr20 {Canis lupus familiaris} MANSTGLTTSEVVGSVGLVLAAVVEAAALLGNGALLVVVLRTPGLRDALYLVHLCVVDLLAAASIMPLGLVAAPPPGLGRLRLGPAPCRASRFLSAALLPACTLGVAALG
LARYRLIVHPLRPGARPPPGLVLAAVWAAAGLLGALSLLGPPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYSGIFLVARRAALRPPRPARGSPRPRSDS
LDSRLSILPPLRPRLPGGKAALAPALAVGQFAACWLPYCCACLVPAAQAAVAEAPVTWVAYSAFAAHPFLYGLLQRPVRRALGRLARRALPQSPRACTPRAWHLPALLQH
LQGLSESPALPSSEAPEQAPDLPGGENLSMSRAT*
689 >lcl|XP_850325.2|Plus1complement(4205165..4206103) NW_876280 olfactory receptor 6B2-like LOC608264 __SEG__ Chr25 {Canis lupus familiaris} MRGRNATKVSVFVLLGFPTAPRLQYVLFLVFLLTYLFILVENLVIIVTVRRSAPLHRPMYYFLGALSVLEVWYVSVIIPKMLGGLLLQQKLISFAGCMTQLYFFSSLVCT
ECVLLASMAYDRYVAICHPLRYQVIMTTRLCVRLVAFSFVSGFSISMIKVFFVSRATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVSPLVATVLSYGH
ITLAVLRIPSATGRWRAFSTCASHLTVVTIFYTAMIFMYVRPQAIDSRSSNKLISAVYTVLTPIINPLIYCLRNKEFKAALKKALGFGQIPT*
690 >lcl|XP_850432.1|Plus14357045..4357965 NW_876280 olfactory receptor 12 cOR9S10 __SEG__ Chr25 {Canis lupus familiaris} MAYFQDFVLEGFGGGLETQALLFAVFLALYMVTVLGNILMIIVITLDARLHSPMYFFLKNLSFVDLCYSSVIAPNALANFFSSSKVITFAGCATQFFFLSLLATTEGFLL
GVMAYDRFMAICSPLRYPSTMCQSACTRLVLGAYCGGCFNSVVQTSFTFHLPFCSSNRINHFFCDVPPLLQIACGNTAINELLLFGICGFMIVGLAIVILISYGYIIATI
LRMRSGAGRRKIFSTCGSHMTVVTLFFGTLFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNKDVKEAVQRLGQKHMTM*
691 >lcl|XP_850513.1|Plus1complement(3933772..3934848) NW_876283 testis-specific serine/threonine-protein kinase 2-like LOC608391 __SEG__ Chr26 {Canis lupus familiaris} MDDAAVLKQRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRKKAPKDFLEKFLPREIEILAMLNHRSIVKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALHE
DDARRKFHQLSSAIKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLTLSKTFCGSAAYAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSD
IKKMLRIQKEHRVDFPRSKNLTGECKDLIYRMLQPDVNRRLHIDEILSHSWLQPPKPKAMSSASFKREGEGKYRTECKLDTRPGSRPEHRPDHKLGAKTQHRLLVVPENE
DRMEDRLAETSKAKDHHVTGAEVGKAST*
692 >lcl|XP_850631.1|Plus15808428..5809468 NW_876254 galanin receptor type 1-like LOC608496 __SEG__ Chr12 {Canis lupus familiaris} MQPGLEPNATSAAGLAATPEPLLRLVLAGACGLVLLVGLLANGLMLLVVGRGPGASRPLLVLTNSLMVNITLSDLLFLACVVPVLLLSFLRPDWWLGPVVCTTSQATNNA
TMFCTFYSMVATALLRHVAVARPDVALPSGRGARLLLCGAMWVLGLTVSLPNWLFQRVVVEEGAAGARACLLLLSPAQTSCYFTLLGALAFLPCMLGLGCSFSHVGWLLW
TQPRGPIGESILEHQENTGFILVVLVVFVLMWGPCSVLGYVAAVGGLPATPVAFVASSLCTILAYSNCAVSPVLCFYLSRPFQAGLRDLFRRPRAARRPGRVGGASVLLE
SIRDRAPGGLWGLAGV*
693 >lcl|XP_850743.1|Plus1complement(5705814..5706746) NW_876260 olfactory receptor 13-like LOC608585 __SEG__ Chr16 {Canis lupus familiaris} MGDNMTYITEFTLLGFPLGPRIQMVLFGLFTLFYAFTLLGNGLILGLISLDPRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLRPDKPISFAGCLTQTFLFLTFAVTE
CLLLVVMSYDRYVAICHPLRYSVIMSWRVCITLVLTSWTIGVLLSLVHLMLLLPLPFCRFQKINHFFCEIMAVLKLVCADTHINEIMVLAGAISVLVGPFSSIVISYMCI
FCAILRIQSGEGQRKAFSTCSSHLCVVGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLIYSLRNLEVKNALKRVLGIQRAL*
694 >lcl|XP_850826.1|Plus1complement(5883973..5884914) NW_876260 olfactory receptor-like protein OLF3-like LOC608645 __SEG__ Chr16 {Canis lupus familiaris} MGQENKTQTWVSEFVLLGLSSDWETQVFLFLLVLTMYLVTLVGNVLILLLIRLDSRLHNPMYFFLSVLSFVDLCYANSIAPQMLAHLLSAQKSIPFYNCVLQLYTSLALG
GSEFFLLGAMAYDRYVAVCHPLHYTVIMHGELCLGLAAGCLVAGFTNSLMETIITFRLPLCHNVINHFACETLAVLRLACVDVSFNKVMVATSGFLVIMLPCSLVLFSYG
RIVITILHIHSTQGRSKAFGTCASHLTVVCMCFGATIFTYLGPRSASSVEEEKMVALFYAVVAPMLNPLIYSLRNKEVMAALQKVLKKFRDKE*
695 >lcl|XP_850834.2|Plus1complement(5898981..5899916) NW_876260 olfactory receptor-like protein OLF3-like LOC608650 __SEG__ Chr16 {Canis lupus familiaris} MGRENQTWMSEFILLGLSSCWDTQVSLFVLFLIMYLVTVLGNFLIILLIRLDSRLHTPMYFFLSVLSLVDICYTNSTVPQMLVHFLSAWKSIPFHSCVLQLFISLAMGSS
EFFLLGAMAYDRYVAVCHPLHYTVIMHGELCLGLAAGCLGAGFINSMMQAIIIFRLPLCHNVINHFACEMLAVLRLTCVDVSFNKVMVAISGSLVIMLPCFLVLFSYVRI
VAAILHIHSAQGRCRAFETCASHLTVVSMCFGTAIFTYLRPSAGSSAEQEKMVALFYAVVTPMLNPLIYSLRNKEVMSALRRLLGKCSEKR*
696 >lcl|XP_850851.1|Plus129406086..29407030 NW_876273 olfactory receptor 56A3-like isoform 1 LOC485316 __SEG__ Chr21 {Canis lupus familiaris} MTTHQNGTISIEISDFLLNCFVRSPSWQLSFSLPLSLLFLLAMGANGVLLITIWLEASLHEPMYYLLSILSLLDIVLCLTVIPKVLTIFWFDLKSINFYACFIQMYIMNC
FLAMESCTFMVMAYDRYVAICHPLRYPSIITEQFVAKAAIFILARNAISTLPIPILSSRLHYCGGNVIENCICANMSVSKLSCDDVTINRLYQFAGGWTLLGSDLILIFL
SYSLILRAVLRLKAEGAMAKALSTCGSHFILILFFSTILLVFVLTHVAKKKASPDVPVLLNVLHHVIPAALNPIVYGVRTHEIKQGIQRLLNKG*
697 >lcl|XP_851171.1|Plus1complement(17970717..17973656) NW_876301 SLIT and NTRK-like family, member 3 SLITRK3 __SEG__ Chr34 {Canis lupus familiaris} MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGN
NALQDIQSGAFNGLKILKRLYLHENKLDIFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHI
GRSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSSN
KQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLG
NNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEH
LNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHRDVRTIELEVLCPEMLHVPPAGASPAQPGDSHLAGGPTSASPYEFSPPGGPVPLSVLILSL
LVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSVQ
EAGSTERGGPGTQPPGIGEVLLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHPHHPAVGGVSGVVAGPGGDLAGFRHHEKNGGVVLFPPGGGC
GGGSMLLDRERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTYRF*
698 >lcl|XP_851295.1|Plus1complement(6167437..6167946) NW_876253 prothymosin alpha PTMA __SEG__ Chr11 {Canis lupus familiaris} MKANLKVARSPTGCSENPSLHCSCARLPVRRNLLRHRDSRSSLAGGLERCIASPACPIVSDAAVDTSSEMATKDFKEKKEVVEEAENGRDAPANGNANEENGEQEADNEV
DEEEEEGGKEEEEEEERGDGEEEDGDGDEEAEAAAGKRAAEDDEDDDVDPKKQKTDEDD*
699 >lcl|XP_851417.2|Plus1complement(5993944..5994867) NW_876284 olfactory receptor 8S1 cOR8S16 __SEG__ Chr27 {Canis lupus familiaris} MAWRNHSTITEFILIGLSDDPYIEALLFVFFLGIYLLTVMGNLMMLLVIRADSRLHTPMYFFLSNLSFLDLCFSSVTVPKLLKDLLSEKRTISVEGCLTQVFFVFITPGT
EAFLLSVMAYDRYAAICHPLLYGQVMSPQFCVKLVLISWGLACLNAFVIVFLAINLDFCEAQTIHHYICELPSLFPLSCSDISISVDILICSILLHGLGTFLPIFFSYAR
IVSTILSISSTSGRSKTFSTCSSHLIAVTLFFGSGVIRYLMPTTDSSLVLLLSLQYSAVTPLLNPLIYSLKNKEVKAAVRRTLGKYF*
700 >lcl|XP_851428.2|Plus1complement(6009896..6010819) NW_876284 olfactory receptor 8S1-like LOC609127 __SEG__ Chr27 {Canis lupus familiaris} MAWRNHSTITEFILIGLSDDPYIEALLFVFFLGIYLLTVMGNLMLLLVIRADSRLHTPMYFFLSNLSFMDLCFSSVTVPKLLKDLLSEKKTISVEGCLTQVFFVFFSSGT
EACLLSVMAYDRYAAICHPLLYGQVMSGQFCVKLVLISWGLACLNAFVIVLLAINLDFCEAQTIHHYTCELPALFPLSCSDISITTDILLSSSLLHGLGTFLPIFFSYAR
IISTILSISSTSGRSKTFSTCSSHLIAVTLFFGSGFLCYLMPPSGSSLDFLISLQYSAVTPLLNPLIYSLKNKEVKAAVRRTLGKYL*
701 >lcl|XP_851477.1|Plus1complement(7244154..7245098) NW_876260 olfactory receptor 9A4-like LOC482758 __SEG__ Chr16 {Canis lupus familiaris} MLGNQSSATEFYLLGFPGSKDLHHLLFATFFFFYSVTLMGNMVIILIVCADKRLQSPMYFFLSHLSALEILVTSVIVPVMLWGLLLPGMQTISLAACVTQLFLYLSLGTT
EFALLGAMAVDRYVAVCNPLRYNVIMNSRTCIWVVIVSWVFGFLFQIWPVYATFQLTFCKSNVVNNFFCDRGQLLKLSCNNTLFIEFILFLMAVFVLFGSLIPTIISYTY
IISTILKIPSASGRRKAFSTCASHFTCVVIGYGSCLFLYVKPKQTQAADYNRVVSLMVSVVTPFLNPFIFTLRNDKVIEALWDGMKRCCQLFNN*
702 >lcl|XP_851557.1|Plus1complement(12001848..12002906) NW_876333 probable G-protein coupled receptor 21 GPR21 __SEG__ Chr9 {Canis lupus familiaris} MNSTLDGNQSSHPFCLLTFGYLETVDFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLNHHTTSYFIQTMAYADLLVGVSCLVPSLSLLHYPLPVKESLTCQVFGFVVS
VLKSVSMASLACISIDRYIAITKPLTYNTLVTPWRLRLCIFLIWLYSTLVFLPSFFHWGKPGYHGDVFQWCAESWHTDPYFTLFIVVMLYAPAALIVCFTYFNIFRICQQ
HTKEISERQARFSSQSGETGETGEVQSCPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHSNRFVSFLTTWLAISNSFCNCVIYSLSNSVFQRGLKRLSGAMCTSCA
SQTIAKDPYTVRGKDPLNGCHI*
703 >lcl|XP_851567.1|Plus129640906..29641958 NW_876276 c-C chemokine receptor type 11 CCRL1 __SEG__ Chr23 {Canis lupus familiaris} MALEHNQSTDYYYEENEVNGTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFITGIAGNSIVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGRI
MCKVTSALYTVNFVSGMQFLACISIDRYWAVTKAPSQSGVGRTCWLVCFCVWMTAILLSIPQLVFYTVNHKARCLPIFPYYLGTSVKASIQMLEICIGFVIPFLIMGVCY
FVTARTLIRMPDIKKSQPLKVLLTVVIVFMVTQLPYNIVRLCQVIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNPILYVFMGASFKNYIIKVAKKYGSWRRQRRN
VEEIPFDSEDPTEPTSTFSI*
704 >lcl|XP_851573.1|Plus123435526..23436476 NW_876273 olfactory receptor 2AT4-like LOC609254 __SEG__ Chr21 {Canis lupus familiaris} MEATTCNGSLDGSPVFYLVGIPSLPETFFLPVFFIFLLFYLLILMGNVLILVAVVGEPSLHKPMYFFLINLSTLDILFTTTTVPKMLSLFLLGDHFLSFPACLLQMYLFQ
SFTCSEAFILVVMAYDRYVAICRPLHYPVHMTPQTNAVLAACAWLTALLLPIPAVVKTSQMAYNNIARIYHCFCDHLALVQASCSDTMPQTLMGFCIAMVVSFLPLLLVL
LSYAHILASVLRISSREGRSKAFSTCSSHLLVVGTYYSSIAVAYVAYRADLPLDFHIMGNVAYAILTPILNPLIYTLRNKDVKAAITKITCLKTQS*
705 >lcl|XP_851586.2|Plus16251618..6252553 NW_876284 olfactory receptor 8S1 cOR8T2 __SEG__ Chr27 {Canis lupus familiaris} MAMKNYSAISEFILLGLSIDPSIQVILFVLFLLIYLFTLMGNFLMLLVIRADSHLHIPMYFFLQQLSFLDLCHSSVTVPKMLENLLSESKTIFVESCLAQAFFVFATGGT
EACLLAVMAYDRCIAITSPLLYGQVMNNQLCVGMVWSSWGLAFADALINILLAVNLDYCEDQTIPHFSCELSSLFPLSCSDTSTNFTLLLCSSFLHFFGTFLMIVLSYAR
IVFTILSISSTSGRGKAFSTCSSHLTTVILFYGSGFLSYLLPTSGSPLEMMFSLQYSVITPMLNPLIYSLQNKEVKAAMGRIFRKYFYSLM*
706 >lcl|XP_851640.2|Plus1complement(8682817..8684220) NW_876333 zinc finger and BTB domain-containing protein 43 ZBTB43 __SEG__ Chr9 {Canis lupus familiaris} MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFL
QMWHVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGGHADFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGAS
DSAEFHYTRPMYSKPSIMAHKRWIHVKPERFEQACEGMDVHAPYDEHQVTESINTMQTEHSVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERS
DGNLIGHRQEAALASGYSENIEMVTGIKEEASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWR
DSFHRHVTSCTKSYEAAKAEQNTTEAN*
707 >lcl|XP_851691.1|Plus1complement(6539308..6540417) NW_876284 hsc70-interacting protein-like LOC609351 __SEG__ Chr27 {Canis lupus familiaris} MDPHKVSELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKIPPATHKTKSEDNVKEEKTDSKKAEENIKTDEPSSEESDLEIDNEGVIEPDTDAPQEMGDENVEITEEM
MDQANDKKVAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAM
LKEVQPRAQKIAEHRRKYERKREEQEIRERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPSNFPGGMPGMAGGMPGMAGMPGLNEILSDPEVLAAMQDPE
VMVAFQDVAQNPANMSKYQSNPKVMKLISKLSAKFGGQV*
708 >lcl|XP_851891.1|Plus1complement(17381027..17382052) NW_876272 c-X-C chemokine receptor type 6 CXCR6 __SEG__ Chr20 {Canis lupus familiaris} MADDDYIDSEFFNTSSDSSEGHKHFLEFHKFFLPCVYVVVFICGLLGNSLVLVIYLFYQKLKSLTDVFLMNLPLADLVFVCTLPFWAYASIHEWVFGKVMCKTLLGIYTL
NFYTSMLILTCITMDRFIAVVQATKAYNQQAKRMAWGKAICLLIWVISLLVSLPQIIYGKVCYLDKLICGYHDEDISTVVLATQMTLGFFLPLLAMIVCYSVIIKTLLHA
RGFQKHKSLKIIFLVVAVFLLTQTPFNLVKLIRSTRWEHYTMTSFHYAIIITEAIAYLRACLNPVLYAFVGLKFRRNFWKLMKDIGCLPYLGVLGQWKSSEDASKTYSAS
HNVEATNMFQL*
709 >lcl|XP_852017.1|Plus1complement(3031213..3031746) NW_876271 platelet glycoprotein IX GP9 __SEG__ Chr20 {Canis lupus familiaris} MPAWGALLLLWAATEATNDCPAECTCQTLETMGLWVDCRGRGLKALPALPVHTRHLLLANNSLRSVPPGAFDHLPGLQILDVMHNPWHCDCSLTYLRLWLEDHTPEALLQ
VRCASPALATTRPLGWLTGYELGSCGWQLQAPWTYPGVWWDVALAGVAALGLALLAGLLCTTTEMLG*
710 >lcl|XP_852139.1|Plus1complement(16619451..16621106) NW_876285 inositol 1,4,5-triphosphate receptor-interacting protein-like ITPRIP __SEG__ Chr28 {Canis lupus familiaris} MALGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALEHVAEEGQQQNENRTAWDLWSTLCMILFLVIEVWRQDHQDG
PSPECLGGDEDELPGLDGAPLRGLTLPNKATLHHFYEHCIRGATADAARTREFVEGFVDDLLEALRSLCNRDTDMELEDFIGVDSMYENWQVDRPLLCELFVPFVPPEPY
HFRPELCCSRRSVPLGRQGYGQIRVVRADEGALGCVCGKTTLGDDMLCLLHGRSSVARPGGELESLLCAGDSPYLDTARVMKWFQMALTRAWHRIAHKYEFDLAFGQLDR
PGSLKIKFRSGKFMPFHLIPVIQCDDSDLYFVSHLPREPSGEAPASSSDWLLSFAVYERHFLRVTSKALPEGACHLSCLQIASFLLSKQSRLTGRSGLGNYHLKTALLHL
LLRRRPADWRAGQLDARLRELLRFLEKSLLEKKLHHFFIGNREVPDGMGLPEAVRRAEPLNLFRPFVLQRSLYRKTVDAFYEMLKNAPVLISEYSLHVPSDPGLPHKAAA
L*
711 >lcl|XP_852148.2|Plus1complement(11954018..11954953) NW_876266 olfactory receptor 4D9-like LOC609729 __SEG__ Chr18 {Canis lupus familiaris} MEEGNYTRVKEFIFQGLTQSRELSLVLFLFLFLVYTSTVMGNLLIMVTVTCESRLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSRTKTISFNGCITQMFFFHLLGGA
DIFSLSVMAFDRYMAISKPLHYVTIMSRGRCTALIVASWVGGFVHSIVQISLLLPLPFCGPNVVDGFYCDVPQVLKLACTDTLVLEVLMISNNGLISTLWFVFLLVSYTV
ILTMLRSHAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPMDRAVSITFTVIIPVLNPMIYTLRNQEMKSAMRRLKRRLGPSKKE*
712 >lcl|XP_852165.1|Plus1complement(26641538..26642569) NW_876273 olfactory receptor 52B2 cOR55B3 __SEG__ Chr21 {Canis lupus familiaris} MGEDGNTSTFNISYTNFFLVGFPGFREWRPLLVLPLTFLYVTVISANALVIHTVVAQRSLHQPMYMLIALLLAVNICAATAVMPKMLEGFVHYANPISLHSCLAQMFFIY
FTLLLDYNLLLAMALDRYVAICHPLRYTDLMTSHLLGVLAILALTQSLGVAVPLVVLTSQARFCRTMVIPHFTCEYIALLSIACGDLTFNNRLGLAMRLVTVTFDLALLG
TSYTRIIYAAFRISSGGARAKALHTCGSHLLVILTIYLSGLSTSIVFRVAKTVSQDVQNLLSAIYLLLPGTLNPVIYGVRTREIRQHVEKMLFSKISAQEVGEKPERMQN
MRGNCQGERTLST*
713 >lcl|XP_852173.1|Plus1complement(11988800..11989735) NW_876266 olfactory receptor 4D9-like LOC483451 __SEG__ Chr18 {Canis lupus familiaris} MELKNCTRVKEFAFLGLTQNQGLSLVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMYFLLRNLSVADICFSSITAPKVLMDLLSQRKTISFNGCFTQMFFFHLVGGV
DVFSLSVMALDRYVAISKPLHYVTIMSRGRCIGLIVASWVGGFTHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLKLACTDIFMLELLMISNNGLLTTLWFFFLLVSYMV
ILVVVKSQAGEGRRKAISTCTSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMRRLKRRLMPSDRE*
714 >lcl|XP_852184.2|Plus1complement(12005716..12006651) NW_876266 olfactory receptor 4D9 cOR4Z4 __SEG__ Chr18 {Canis lupus familiaris} MALRNHSKVSKFIFCGLTQSQELSLLLFFFLSVVYVTTVLANVAIMVTVTCESRLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSRTKTISFNGCITQMFFFHLLGGA
DIFSLSVMAFDRYMAISKPLHYVTIMSRGRCTALIVASWVGGFVHSIVQISLLLPLPFCGPNVVDGFYCDVPQVLKLACTDTFVLEVLMISNNGLVTTLWFVLLLVSYTV
ILMMLRSHTGEGRRKAISTCTAHITVVTLHFVPCIYVYARPFTALPMDRAVSITFTVIIPVLNPMIYTLRNQEMKSAMRRLKRRLMFSERT*
715 >lcl|XP_852218.2|Plus112068701..12069639 NW_876266 olfactory receptor 5AN1-like LOC609788 __SEG__ Chr18 {Canis lupus familiaris} MTGGGNTTEITYFILLGFSDFPRILAVLFAVFLLIYILTLTWNLGLIILIRMDSHLHTPMYFFLSNLSFIDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGL
SESCLMTAMAYDRYTAICNPLLYSSVMSPTLCIQMVLGSYLAALSASISQLCAMFQLHFCGPNVINHFFCDMPQLLILSCTDTFLVQLLLAILAMIFGIINAFIIMISYG
FIVMSIMKITSAKGRSKAFNTCASHLTAVSLFYTSSIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKKRWYC*
716 >lcl|XP_852234.1|Plus1complement(12209430..12210380) NW_876333 olfactory receptor 1K1-like LOC609804 __SEG__ Chr9 {Canis lupus familiaris} MDAANESSEGAPFILLGLTTSPGQQQPLFVLFLALYVAGILGNGLIVAAIQASPALHAPMYFLLAHLSFADLCFTSVTVPKMLANLLAHDRSISLAGCLTQMYFFFALGV
TDSCLLAAMAYDRYVAIRHPLHYATRMSRAMCTALVGTAWLVSHLHSLLHILFMARLSFCASHQVPHFFCDHQPILRLSCSDIRHIQLLIFTEGAAVVVTPFLLILASYG
AIAAAVLRLPSASGRLRAVSTCGSHLAVVGLFYGTVIAVYFQPTSRYEAERGRVATVMYTVVTPMLNPVIYSFRNRDMQGALRSLFTGRRISSSDS*
717 >lcl|XP_852245.2|Plus112172264..12173202 NW_876266 olfactory receptor 5AN1 cOR5AN3 __SEG__ Chr18 {Canis lupus familiaris} MTGGGNTTEITYFILLGFSDFPRILAVLFAVFLLIYILTLTWNLGLIILIRMDSHLHTPMYFFPSNLSFIDVCYVTSTAPKMLSNFFQEQQTITFVGCAVQYFVFSTMGL
SESCLMTTMAYDRYTAICNPLLYSSVMSPTLCIQMVLGSYLAALSASISELCALFQLHFCGLNVIDHFFCDMPQLLVLSCTDTLFVNLLTAILTMIFGIINAFIIVISYG
FIVMSIMKITSANGRSKAFNTCASHLTAVSLFYTSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKDALKRLQKKRWYC*
718 >lcl|XP_852409.2|Plus114636557..14637498 NW_876332 olfactory receptor 4D1-like LOC609961 __SEG__ Chr9 {Canis lupus familiaris} MEAQNITQVFQFVLLGFSQTQELQKFLFLVFLFVYVTTIVGNILIIVTVTSDSRLHTPMYFLLRNLAVIDLCYSTVTSPKMLVDFFHEVRTISYQGCMAQIFFFHLLGGG
TVFFLSVMAYDRYIAISRPLHYVTIMNPRLCVGLVVAAWVGGFVHSIVQLALMLPLPFCGPNILDNFYCDVPQLLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTV
ILVMLRSHSGQAKKKAASTCTTHIIVVSMIFIPCIYIYSRPFTPFPMDKAVSISYTVMTPMLNPMIYTLRNQEMQAAMKRLGKRLMVCNREWT*
719 >lcl|XP_852415.2|Plus1complement(12697753..12698691) NW_876266 olfactory receptor 5B3-like LOC483470 __SEG__ Chr18 {Canis lupus familiaris} MGNRTEVTQFILLGLTNDPELQVPLFIMFTFIYLITLVGNLGITVLILLDSRLHTPMYFFLSNLSLADFGYSTAVTPTVMAGLLRGDQVISYSACAAQMFIFAVFATVEN
YLLASMAYDRYAAVCKPLHYTTTMTTGVCACLAIGSYVCGFLNASIHIGGTFSLSFCMNNEVHHFFCDIPAVMVLSCSDRHVSELALVYATTFNIIFALLVIFVSYIFIF
ITILKMHSSSVYLKAISTCASHLTAVSIFYGAVIFMYTQPSSSHSMDTDKMASVFYTMVIPMLNPVVYSLRNKEVKNAFMKIVLESKLSLGL*
720 >lcl|XP_852418.1|Plus110008128..10009060 NW_876312 olfactory receptor 8B3-like LOC609966 __SEG__ Chr5 {Canis lupus familiaris} MAIGNDSSVTEFILLGLTQQPELQLPLFFIFLGFYVVTMVGNMGLILLIGLNSHLHTPMYYFLFNLSFIDFCYSSVIIPRMLMSFVKQNIISYPECMTQLCFFAFFVISE
CCILTSMAYDRYVAICKPLLYKAIMSHQVCLMFMAGTYGMGFVGAMAHTGCMLRLSFCDGNIINHYMCDIPPLLQLSCTSTYINEVVVFIVVGINVIVPSLTISISYTLI
LSNIFHIRSTEGRSKAFSTCSSHVVTVSLFFGASAFMYLKPSPAGSLDRDKVSTVFYTIVGPMMNPFIYSLRNKDVKIALSKTLKKRVFS*
721 >lcl|XP_852440.2|Plus112736158..12737102 NW_876266 olfactory receptor 5B2-like LOC609981 __SEG__ Chr18 {Canis lupus familiaris} MDNRTEGTQFILLGLTNAPELQIPLFIMFTLIYLITLAGNLGMMMLILLDSRLHTPMYFFLSNLSLVDFGYSTAVTPKVMAGLLRGDQVISYNACAAQMFFFVAFATVEN
YLLASMAYDRYAAVCKPLHYTTTMTTGVCARLAIGSYICGFLNASFHVGDIFSLSLCNSNPVHHFFCDVPAVMALSCSDKHISEVFLVFMSSFNALFALLVILISYLFIF
ITILKVQSAQGHQKALSTCASHLTTVSIFYGTVIFMYLQPSSSHSMDTDKIASVFYSMVIPMLNPLVYSLRNKEVKCAFKKVVEKAIFSIGLAI*
722 >lcl|XP_852455.2|Plus112763658..12764596 NW_876266 olfactory receptor 5B3-like LOC483474 __SEG__ Chr18 {Canis lupus familiaris} MGNRTEVTQFILLGLTNDPELQVPLFIMFTFIYLITLVGNLGITVLILLDSRLHTPMYFFLSNLSLADFGYSTAVTPTVMAGLLLGDQVISYSACAAQMFVFAVFATVEN
YLLASMAYDRYAAVCKPLHYTTTMTTGVCARLAIGCYIFGFLNASIYIGDTFSLSFCMNNEVHHFFCDIPAVMVLSCSDRYVNELILIYVVSFNIFFALLVILISYIFIF
ITILNMHSSGGYQKAIATCASHLTAVSIFYGTVIFMYTQPSSSHSMDTDKMASVFYTMVIPMLNPMVYSMRNKEVKNAFKKIVLESKLSLGL*
723 >lcl|XP_852478.2|Plus112815461..12816405 NW_876266 olfactory receptor 5B2-like LOC483477 __SEG__ Chr18 {Canis lupus familiaris} MENNTKVTEFILVGLTNTPELQIPLFIMFTLIYLFTLAGNLGMVVLILLDSCLHTPMYFFLSNLSLVDFGYSTAVTPKVMAGLLRGDQVISYNACAAQMFFFAAFATVES
YLLASMAYDRYVAVCKPLHYTTTMTTGVCARLAIGSYMSGFLNASVDVGDTFHLSFCNSNVIHHFFCDIPAVMALSCSNRHVSELVLVFVASFHIFLALLIILISYLFIF
ITILKIPSVEGYLKAVSTCASHLTAVSIFYGTVIFMYSQPTSNHSMDTDKIISVFYTVIIPMLNPMVYSLRNKEVKNAFKKVVEKVKLSLSFTS*
724 >lcl|XP_852500.2|Plus112852969..12853886 NW_876266 olfactory receptor 10W1-like LOC610022 __SEG__ Chr18 {Canis lupus familiaris} MEFGFLAYPSHPELRVLSFLGVSLIYTLIISGNVLIVVAIQTEARLHTPMYYFLGSLSGIEICYTAVVVPHILANILRPEKTITLLGCATQMIFFIGLGSADCFLLAAMA
YDRYVAICHPLQYPLTMTLTLCVRLVMASVVIGLFLSTQLVAFIFSLPFCRARSIEHFFCDVPPVMRLVCANSHVHEQSVLVAATLAIAMPFFLIATSYTFIVAAVLKIH
STAGRHRAFSTCSSHLSVVLLQYGCCAFMYLRPNSSYYPKQDQFISLVYTLGTPLLNPLIYTLRNSEMKGTLGRVLTRNCLSQNN*
725 >lcl|XP_852558.2|Plus112982146..12983090 NW_876266 olfactory receptor 9I1-like LOC483485 __SEG__ Chr18 {Canis lupus familiaris} MAKNNLTTVAEFILMGFTDYHMWEITLFLMFLIFYIVTLLGNVGMIILIQVDVQLHTPMYFFLSHLALLDACYASVITPQILDTLATGKTVISFGQCATQFFFFTICAGT
ECFLLAVMAYDRCVAISNPLLYTVVMNPRICWGLVVGAYVCGVSGAILRTTCTFTLSFCDHNQINFFFCDVPPLLKLACSDTTNTEIVIVFFGNFVILANALVILISYLL
IIKAILKVKSPGGKVKTFSTCASHLTAVTLFFGTLIFMYLRSSSNKSLEEDKVVSVFYTVFIPMLNPLIYSLRNKDVKAAFRKVTGRFQVSQSV*
726 >lcl|XP_852594.2|Plus1complement(27506100..27507041) NW_876273 olfactory receptor 51A4 cOR51A16 __SEG__ Chr21 {Canis lupus familiaris} MSIINTSNVEITTFFLVGMPGLEYAHIWISIPICSMYLFAILGNCTILFVIKTEPSLHEPMYYFLSMLAMSDMGLSLSSLPTVGRIFLFNAPEISANACFAQEFFIHGFT
AVESSVLLIMSFDRFLAIHSPLRYSSILTPVRVAKIGIVLSLKSVLLVLPFPFTLRSLKYCSKSQLSHSYCLHQDVMKLACSDNRIDVIYGFFGALCLMVDFMLIAISYI
LILKTVLGIASLNEQLKALNTCASHICAVIIFYLPIINLAIVHRFVRHVSPLFNVLMANVLLLVPPMMNPIVYCVKTRQIRVRVLAKLCQKQM*
727 >lcl|XP_852609.2|Plus127559917..27560864 NW_876273 olfactory receptor 51L1-like LOC610109 __SEG__ Chr21 {Canis lupus familiaris} MVVWNNNNTLEPIFILKGFPGLECVHSWFSIPFCLAYLVAFIGNVTILSVIWIESSLHQPMYYFLSILALTDLGMSMSTLPTMLAVLWLDAREIQASACYAQLFFIHTFT
FLESSVLLAMAFDRFVAICRPLHYTTILNNSVIGKIGLACLLRSMGVVLPTPLLLRHYHYCHVNALSHAFCLHQDVLKLSCSDARISSVYGLCVVITTLGMDSVFILLSY
VLILNAVLGIASHEERLKALNTCVSHICVVLIFFVPVIGVSMVHRFGKHLSPIVHIIMADIYLLFPPVLNPIVYSVRTKQIRIRIFHKLRLGRRL*
728 >lcl|XP_852622.2|Plus1complement(10455815..10456750) NW_876312 olfactory receptor 10G9-like LOC489340 __SEG__ Chr5 {Canis lupus familiaris} MTNRSLVTTFILIGLPHAPALDIPLFTIFLVIYVLTVMGNLLILLVIMVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLGSPGGRMISFHSCMAQLYCFHFLGSTE
CFLYTVMSYDRYLAISHPLRYASMMRGRTCALLATSTWLSGSLHSAVQTTLTFRLPYCGPSQIQHYFCDAPPILRLACADTSVNEIVIFVNIGVVASGCFLLIVLSYVSI
VCSILKIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKITQSQSK*
729 >lcl|XP_852632.2|Plus110474155..10475090 NW_876312 olfactory receptor 10G9-like LOC489341 __SEG__ Chr5 {Canis lupus familiaris} MTNRSFVTTFILMGLPHAPALDIPLFTIFLVIYVLTVMGNLLILLVIRVDSHLHTPMYYFLTNLSFIDMWFSTVTVPKMLMTLGSPGGRMISFHSCMAQLYCFHFLGSTE
CFLYTVMSYDRYLAISHPLRYTSMMRGRTCALLATGTWLSGSLHSAVQTTLTFRLPYCGPSQIQHYFCDGPPILRLACADTSVNEMVIFVNIGVVASGCFLLIVLSYVSI
VCSILKIRTSEGRHRAFQTCTSHCIVVLCFFVPCVFIYLRPGSRDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLKLKDKITQSQSK*
730 >lcl|XP_852678.1|Plus1complement(10530909..10531841) NW_876312 olfactory receptor 8B3 cOR8C5 __SEG__ Chr5 {Canis lupus familiaris} MAIGNDSSVTEFILLGLTQQPELQLPLFFIFLGFYVVTMVGNMGLIFLIGLNPHLHTPMYYFLFNLSFIDFCYSSVIIPRMLMSFVKENIISYAECMTQLCFFSFFVIDE
CYVLTSMAYDRYVAICKPLLYKVTMSHQVCLMLMVGTYVMGFVGAIAHTGCMLRLSFCDGNIVNHYMCDIPPLLQLSCTSTYINEVMVFIVVGINVIVPSLTISISYTLI
LSNIFHIRSTEGRSKAFSTCSSHIVTVSLFFGASAFMYLKPSPAGSLDRDKVSTVFYTIVGPMMNPFIYSLRNKDVKIALSKTLKKRVFS*
731 >lcl|XP_852681.1|Plus1complement(16272533..16273498) NW_876250 olfactory receptor 4K14 OR4K14 __SEG__ Chr10 {Canis lupus familiaris} MDSEHSLKLEIMKLQNYSLVSEFVLYGLCTSRHLQHLFFIFFSGIYVASVLGNLIIVVTIISDSHLHSSPMYFLLGNLSFLDIWLASFATPKMLRDFLSDRKLISFGGCM
AQIFFLHFIGGAEMVLLVSMAYDRYVAICKPLHYMTVMRRQTCVGLVLVSWVIGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACMDTYILGILMISDSGLLSM
SCFLLLLVSYTVILITVRQRTAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFSRFSVDKLLSVFYTIFTPLLNPLIYTLRNKEMKIAMKKLCNHHVTSR*
732 >lcl|XP_852724.2|Plus110620709..10621656 NW_876312 olfactory receptor 6M1 cOR6M4 __SEG__ Chr5 {Canis lupus familiaris} MDVQNQTRVTEFTLTAFPVIRKLQISLFVVLLFTYMLTLTGNTVIISLIWADNRLQTPMYFFLSNLSFLDILYTTSVTPKLLACLLEDKKTISFAGCMTQVYFFFFLGTV
EFILLAVMSFDRYVAICNPLRYTVIMNSRVCLLLVLGCWIGAFFSVLCPIIVVSRLPYCYREIGHFFCDIAPLLQVACIDTHFIEMINFLLSSFVLLTSLVFTIVSYTYI
ISTILRIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLEFDKVTAVMTIMVTPLLNPFIYSLRNEKVKEVLREAIFKIMSLWHKRT*
733 >lcl|XP_852749.2|Plus127800776..27801723 NW_876273 olfactory receptor 52A1-like LOC610217 __SEG__ Chr21 {Canis lupus familiaris} MGSINMSYLNPKTVTLIGIPGLEHVQFWIGFPFLGVCLVALLGNIFLLIIIPIERCLHQPMYIFLAVLAATDLGLCVAIAPKMLAIFWFGSYSMAFDACLTQLFFIHALQ
GMESGILLAMAFDRYVAICDPLRHTSILTPLFLVQMVLMVAIRATVLVGILPILLKRLQLFHSVVIVHSYCEHMAVVKLVAEDVHINKSYGLFVAFAILGFDMIFVFISY
ILIFQAVFRLPQKEARLKAFNTCTAHIAVFLEFYILAFFSFFSHRFGHVSPYVHILLSTIYLLVPPALNPIIYGVKTKEIRMRVAQICILRSDNE*
734 >lcl|XP_852801.1|Plus1complement(13760809..13761738) NW_876266 olfactory receptor 5AK2-like LOC483500 __SEG__ Chr18 {Canis lupus familiaris} MEQNNGTKVTEFILLGFAGQHKSWHILFIVFLVIYVATLMGNIGMILLIKIDSRLHTPMYFFLQHLAFVDLCYTSAITPKMLQNLVETEQSISFIGCMVQLLVYGAFATT
DCYILAAMAVDRYVAICNPLRYPTVMSQAVCIQLLIGSYFVGFLNASVNTSFAFSLNFCKSNKINHFFCDEPPLLALSCSNIDFNIMLLTVFVGFNLMFTVLVVIFSYIY
ILAAILKISSAAGRKKAFSTCASHLTAVIIFYGTLSYMYLHHGTKESQEQEKMASVFYGIMIPMLNPLIYSLRNQDVKEALKGIPKKAF*
735 >lcl|XP_852841.2|Plus113911394..13912338 NW_876266 olfactory receptor 1002-like LOC483503 __SEG__ Chr18 {Canis lupus familiaris} MDYGNQTLVTEFFFVGLTNQLQHQVVLFVIFLLVYLVTLLGNVGMITLIWLDPRLHTPMYFFLSHLSFVDVCSSSAIGPKMLTDIFVEKKVISFFGCAAQICFFGQFVVT
ECFLLASMAYDRYMAICKPLLYTLIMSQRVCVQLVVGPYAMGLMSTMTHTTLAFNLPYCGPQIINHFFCDLLPVLSLACADTQVNQFLLFILAGALGVLSGVIILVSYTY
IVITILRIRSAAGRHKAFSTCSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSVFYTSVTPMLNPLIYSLRNREVKDSFRRTFEKKQFLMSR*
736 >lcl|XP_852861.2|Plus113969712..13970647 NW_876266 olfactory receptor 1013-like LOC610298 __SEG__ Chr18 {Canis lupus familiaris} MDEKNFTEVKEFILLGFTEDLWLQKVLFVIFLFIYVTSLSGNMTLISLICADSRLHTAMYFFIGNLSFLDLWYSSVYAPQILRTCMAEDKSISFAGCLAQFFFSAGLAYS
ECYLLAAMAYDRYVAISNPLLYSQTMSSRLCASLVAASYLGGFLNSTIITSETFTLSFCGSNVIDDYFCDLPPLVKLACDVKESYQAVLYFILASNVIAPTVLILASYLF
IIAAILKIRSTQGRLKAVSTCGSHLTAVTLYYGSILFIYSRPSTSYALERDKVVSVFYTVVIPLLNPLIYSLRNKDVKEALKKMLDKAPFS*
737 >lcl|XP_852886.1|Plus1complement(22603618..22604553) NW_876305 olfactory receptor 10J4-like LOC488626 __SEG__ Chr38 {Canis lupus familiaris} MPKPNTTAVTEFTFEGFSALGWQRRLLLFVVFLALHLVTLGSNALILAAVRLSRHLHTPMYFLLSALSLSETCYSVAIVPRMLSGLLSPREAVSVAGCATQLFFYLTFGV
TNCFLLAAMGYDRYVAICDPLRYAVVMGQRTCVHLACGSWSVGLSTAIIQVSSVFSLPFCDASVISHFFCDIRPLMKLACADTTIKELLTLLISLCVLVLPMVLIFISYV
LIVSTILKMASAEGQRKAFATCASHLTVVIVHYGCTSFIYLKPKSQNSLQDRLLSVTYTVITPLLNPVVYGLRNKEVKQALLRAVGRKPLP*
738 >lcl|XP_852904.2|Plus114039054..14039971 NW_876266 olfactory receptor 9G1 OR9G1 __SEG__ Chr18 {Canis lupus familiaris} MERSNNTVTEFILVGFTTDPVMQLVLFVVFLGVYSLTVVANATLIVLICNDSRLHTPMYFFIGNLSFLDLWYSSVYTPKILLTCISEDKSISFAGCVCQFFFSAGLAYSE
CYLLAAMAYDRYMAISKPLRYAQAMSIKLCAFLVASSYLGGFINSSIITKRTFDLNFCSGNIIDDFFCDLYPLVKLACGRKDGYQTVLYLILCSNVITPTVLILASYQFI
IATILRIRSTQGRLKAFSTCSSHLVSVTLYYGSILYIYSRPRSSYSLDTDKIVSTFYTVVFPMLNPMIYSLRNKDVKEALNKLIK*
739 >lcl|XP_852906.1|Plus128104842..28105792 NW_876273 olfactory receptor 52A5 cOR52A8 __SEG__ Chr21 {Canis lupus familiaris} MFKLNGTIFMPPVLTLIGIPGLESVQFWIGIPFCAMYIIALFGNSLLLVIIKSERSLHEPMYLFLAMLGATDIALSTCILPKMLGIFWFHLPDIYFDACLFQMWLIHTFQ
CIESGILLAMALDRYVAICDPLRHATIFTHKLLTQIGVGVMLRAALLGAPCLILIKCRLKHFGTTVVSHSYCEHMAIVKLAAEDIRVNKICGLFVAFTILGFDIIFITLS
YIRIFITVFNLPQREARLKAFNTYIAHICVFLEFYLLGFFSFFTHRFGFHIPPYIHILLSNLYLLVPPLLNPIVYGVKTKQIRDRVSKVFHSKDSS*
740 >lcl|XP_852925.1|Plus1complement(28128359..28129303) NW_876273 olfactory receptor 51V1-like LOC610350 __SEG__ Chr21 {Canis lupus familiaris} MPAFPAYDTNSSTFLLTGFPGLEQEYPWLSIPFSCIYAMVLSGNCLVLHVIRTEPSLHQPMFYFLATLALTDLCMGLSTVHTVLGILWGLSQEVSLDACIAQTYFIHGLS
LTESGVLLAMALDRFTAICNPLRYTSILTSARITKIGLGILVRSFVFIMAPIIRLKFFHYCHSHILSHSFCLHQDLLRLACSDIRFNSFYALALVICTLLFDSMLIIVSY
ILILHSVLAIASREERLKSLQTCVSHICAVMVFYIPIIGLTMVHRFGKHLSPMVHVLMGNIYIIFPPLMNPIIYSVKTQQIRGRIQKWFSMKKE*
741 >lcl|XP_852998.2|Plus114192378..14193313 NW_876266 olfactory receptor 5M8-like LOC610404 __SEG__ Chr18 {Canis lupus familiaris} MRRNFTSVTEFILLGLTSRLELQIVLFLLFLAIYLVTLAGNLGMIVLIQVNAQLHKPMYFFLSHLSFVDLCFSSNVTPKMLEVFLSEKKTISYPACLVQCYFFITLVHVE
IYILAVMAFDRYMAICNPLLYGSKMSKSVCTSLITGPYVYGALTGLMETMWTYNLVFCGPNEINHFYCADPPLIKLACSDTYNKELSMFVVAGCNLSFSLLIILISYLYI
VPAILKIRSTEGRHKAFSTCGSHLTAVTIFYATLFFMYLRRPSKESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEALTKELLGNKRFS*
742 >lcl|XP_853036.2|Plus1complement(28359671..28360606) NW_876273 olfactory receptor 51B2-like LOC485258 __SEG__ Chr21 {Canis lupus familiaris} MWLNISTAPFLLTGFPGLEAAHHWISIPFFAVYISVLLGNGTLLYLIKDDHSLHEPMYYFLAMLAGTDLMVTLTTMPTVMGVLWMNHREMSHGACFLQAYFIHSLSIVES
GVLLAMAYDRFIAIRTPLRYNSILTNSRVMKVGLGVLLRGFLSLVPPIVPLYWFPYCRSHVLSHAFCLHQDVMKLACADITFNRVYPVILVALTFFLDALIILFSYILIL
KTVMGIASREERAKALNTCVSHISSVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPVIYSIKTKQIQRSIIYLLSVHRRP*
743 >lcl|XP_853083.1|Plus1complement(21966410..21967399) NW_876272 olfactory receptor 7C2-like LOC484873 __SEG__ Chr20 {Canis lupus familiaris} MERGNQTGVGNFLLLGFTEELDLQPFFFGLFLSMYLVTFTGNLLIILAICLDSHLHTPMYFFLANLSSADICFTSTTVPKMLLNIQTQSKTITYEGCLSQIFFFIVFGCL
DNLLLTVMAYDRFVAICHPLHYTVIMNPQLCELLVLGSWCISVTGSLLETLTLLRLSFCTNMEIPHFFCDLPEVLKLACSDILINNIVVYFVTIVLGVFPLSGTLFSYSE
IFSSILRISSARGKYKAFSTCGSHLLVVSLFYGTGLGVYLSSAVTSFSKMSLMASVMYTIVTPMLNPFIYSLKNRDMKGALGRLLSRVVPVSIRTLMSSWGHNNEDEKS*
744 >lcl|XP_853106.2|Plus121998866..21999795 NW_876272 olfactory receptor-like protein OLF4-like LOC484875 __SEG__ Chr20 {Canis lupus familiaris} MEPKNDTRISEFLLLGFSEEPELQPFLFGFFLCMYLVTILGNLLIILAVSSDSHLHTPMYFFLANLSFVEICFISTTVPKMLMNIHAKKKVITYKSCIMQMYFFLLFVGL
DNFLLTVMAYDRFMAICNPLHYMVIMNPGLCGLLVLVSWVVSVLHSLLQTLMVLRLSFCTEVEIPHFFCELNQVIQLACSDTFLNNMVMYLATVLLAGGPLAGVLYSYSK
IVSSIRKIQSAKGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAATQSSHSSAEASVMYTVVTPMLNPFIYSLRNRDIKRVLNVFFRRKP*
745 >lcl|XP_853112.2|Plus1complement(22007286..22008254) NW_876272 olfactory receptor 7A17-like LOC610500 __SEG__ Chr20 {Canis lupus familiaris} MDPGNYTGISEFYLMGFSEELELQPLVFGLFLSMYLVTVFGNLLIILAVSSDPHLHTPMYFFLTNLSFVDICFTSTTVPKMLQNIQTQSKVITYARCLTQMYFFILFTGL
DIFLLTVMAYDRFVAICHPLRYTVIMNPWLCALLVLVSWVVSVLYSLLQTSMVLQLSFCTEVEIPHFFCELNQMIQLACSDTFLNNMVMYLATVLLAGGPFFGILYSYSQ
IVSSIHRISSAQGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAATQSSHSSAVASVIYTVVTPMLNPFIYSLRNRDIKEALMRFSGMPALKGPIVLGLKKCP*
746 >lcl|XP_853119.2|Plus1complement(22019838..22020806) NW_876272 olfactory receptor 7A17-like LOC484877 __SEG__ Chr20 {Canis lupus familiaris} MDPRNDTGISEFYLMGFSEELELQPLVFGLFLSMYLITVFGNLLIILAVSSDPHLHTPMYFFLTNLSFVDICFTSTTVPKMLQNIQTQSKVITYARCLTQMYFFILFTGL
DIFLLTVMAYDRFVAICHPLRYTVIMNPWLCALLVLVSWVLSVLHSLLQTSMVLQLSFCTEVEIPHFFCELNQMIQLACSDTFLNNMVMYFAAMLLAGGTFLGILYSYSR
IVSSIHRISSAQGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAATQSSHSSAVASVMYTVVIPMLNPFIYSLRNRDIKEALMRFSGMPALKEPIILGLKRCP*
747 >lcl|XP_853126.2|Plus1complement(22043452..22044384) NW_876272 olfactory receptor-like protein OLF4-like LOC610512 __SEG__ Chr20 {Canis lupus familiaris} MEPGNDTRISEFLLLGLTEEPELQTLIFGLFLTMYLITVFGNLLIILAIGSDSHLHTPMYFFLDNLSFVDICFTSTTIPKMLLNIQTQSKVITYEGCISQIYFLILFAVS
DIFLLSVMAYDRYVAICHPLHYMVIMNPHLCKLLVLVSWIMSILNSLLHSLMMLRLSFCTHFQIPHFFCELNQMIQLACSDTFLNNLVMYFAAVLLAGGPFAGILYSYSK
IVSSIHRISSAQGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAATQSSHTSAVVSVMYTLVAPMLNPFIYSLRNKDIKRALKRIIGVPEM*
748 >lcl|XP_853127.1|Plus128574467..28575423 NW_876273 olfactory receptor 52H1-like LOC610513 __SEG__ Chr21 {Canis lupus familiaris} MSAMIIFNLSNYNPGPFILVGIPGLEHCHVWIGIPFCIIYVVALVGNCTLLYLITVERSLHEPMFFFLSMLAMTDLILSTAGVPKSLSIFWLGAREITFPGCLTQMFFHH
CSFVLDSAILMAMAFDRYVAICSPLRYATILTPRTITKIAVGISCRSFCIILPVVFLLTRLPFCRTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIA
VSYTLILCAVFRLPSRDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYVVIPPALNPIVYGVKTKQIRERVILLFSTKSSE*
749 >lcl|XP_853135.1|Plus1complement(14420936..14421883) NW_876266 olfactory receptor 8J2-like LOC610521 __SEG__ Chr18 {Canis lupus familiaris} MASGNLTHLTEFILRGVSDHPDLQMPLFFVFLVIYGLTVAGNLGIITLTSVDSQLQTPMYFFLRHLAIINLGDSTVIAPKMLVNFLASKKTISYYGCAAQLGGFLVFIVG
EIFMLAAMAYDRYVAICNPLLYMVVVSPQICLLLVSLTYLYSLTTALTVSSCVFSVSYCSSNVINHFYCDTVPLLALSCSDAYIPETVVFAFSGTNLFFSMIIVLTSYFH
IVLAILRIRSSEGRRKAFSTCASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNKDVKDAFKRFLKSPCQAFKLV*
750 >lcl|XP_853136.2|Plus128585235..28586176 NW_876273 olfactory receptor 52H1-like LOC610522 __SEG__ Chr21 {Canis lupus familiaris} MYNLSSYNTGDFTLLGIPGLEQYHVWISIPFCFIYLVAIVGNSILLYLIAVERSLHAPMFFFLSMLAITDVILSTTCVPKSLTVFWLGPQKISFPGCLTQLFFLHYSFVL
DSAILLAMAFDRYVAICFLLRYTAILTSRTTVKIVVGISFRSFCIFAPCVFLVNRLPFCGTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIAVSYTL
ILCAVFRLPSQDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYVVMPPALNPIVYGVKTKSIWDKVVLLLFPRGTQ*
751 >lcl|XP_853147.2|Plus1complement(22062934..22063887) NW_876272 olfactory receptor-like protein OLF4-like LOC610532 __SEG__ Chr20 {Canis lupus familiaris} MEPGNLTGVSEFLLLGFSEGPELQPFIFGLFLSMYLITVFGNLLLILAVSSDSHLHTPMYFFLANLSFVDICFTSTTVPKMLINIQTQSKVITYEGCLSQMYFFILFAGL
DIFLLTVMAYDRFVAICHPLHYLVIMNPRVCGLLVLVPWIMSILNSLLESIMVLRLSFCTVLEIPHFFCELNQMIQLACSDTFLSNMVMYFAAVLLGGVPFAGILYSYSK
IVSSIRGISSAQGKYKAFSTCASHLSVVSLFYCTVLGVYLSSAAPQSSNSSAVASVMYTVVTPMLNPFIYSLRNRDIKRTLMRFSRMSALKWPTVLG*
752 >lcl|XP_853148.1|Plus128598912..28599868 NW_876273 olfactory receptor 52H1-like LOC485271 __SEG__ Chr21 {Canis lupus familiaris} MSAMIIFNLSNYNPGPFILVGIPGLEHCHVWIGIPFCIIYVVALVGNCTLLYLITVERSLHEPMFFFLSMLAMTDLILSTAGVPKSLSIFWLGAREITFPGCLTQMFFHH
CSFVLDSAILMAMAFDRYVAICSPLRYTTILTPRTITKIAVGISFRSFCIILPVVFLLTRLPFCRTRIIPHTYCEHIGVARLACADISINIWYGFCVPIMTVISDVILIA
VSYTLILCAVFRLPSRDARQKALGTCGSHVCVILMFYIPAFFSILAHRFGHNVPRTFHILFANLYVVIPPALNPIVYGVKTKQIRERVILLFSTKSSE*
753 >lcl|XP_853164.2|Plus1complement(14453499..14454419) NW_876266 olfactory receptor 5T2-like LOC610544 __SEG__ Chr18 {Canis lupus familiaris} MKNVTEVTTFVLKGFTDKLELQIILFFLFLTIYVFTLMGNLGLVALVIGDSRLHNPMYYFLSVLSSVDACYSSVITPNMLVDFMSKNKVISFLGCAAQMFLAVTFGTTEC
FLLAAMAYDRYVAIYNPLLYSVSMSPRVYVPLIIASYVGGILHASVHTVATFSLSFCASNEIRHVFCDIPPLLAISCSDTHTNQLLLFYFAGSIEITTILVVLISYGFIV
LVILRMHSAEGRRKIFSTCGSHLTGVSIFHGTVLFMYVRPSSSYALDHDMIVSIFYTIVIPMLNPIIYSLRNKDVKDAMQKVFRKN*
754 >lcl|XP_853165.2|Plus122112276..22113205 NW_876272 olfactory receptor-like protein OLF4-like LOC610545 __SEG__ Chr20 {Canis lupus familiaris} MELENDTQISEFLLLGFSEEPELQPFLFGLFLFMYLVTILGNLLIILAVSYDTHLHTPMYFFLANLSFVDICFTSTTVPRMLVNIQTQRKVIIYESCIMQMYFFLLFAGL
DNFLLSVMAYDRFVAICHPLHYMVTMNPQLCGLLVLVSWIMSALHSLLQTLMVLRLSFHTEVEIPHFFCELNQMIQLACSDTFLNNMVLYFAAMLLAGIPMAGVLYSYCK
IVSSIRRISSAQGKHKAFSTCASHLSVVSLFYCTSLGVYLSSAATQSSHSSAVASVMYTVVTPMLNPFIYSLRNKDIKEALSVFFRGKT*
755 >lcl|XP_853171.2|Plus128620073..28621092 NW_876273 olfactory receptor 52D1-like LOC610550 __SEG__ Chr21 {Canis lupus familiaris} MELDPALPVLNQTVLTSGPGPFVLLGVPGLQTLHAWLSVPVCLLYMAALAGNALLLGLVATDKTLQTPMYQLLGLLAAADLVLATSTVPKALAVLWGLSGEISFAACLAQ
LFVTHVTFIAESSVLLAMAIDRYVAICQPLRYGALLTQRVVGIVAVAAVTRGACVMAPPVALLQRLPYCGQRELPHTYCEHMGVARLACGDTRPNVWYGLATTLLSPALD
LGLIAASYALILRAVCRLPSHGARCKALGTCGAHASVITLFYTPALFSFLAHRFGRHTVPSHIHILLANLYVVVPPALNPVVYGVRTQQIAQRLRYLLRLWWARAVRDVG
PERASRGSE*
756 >lcl|XP_853186.2|Plus122175621..22176583 NW_876272 olfactory receptor 7C1-like LOC610566 __SEG__ Chr20 {Canis lupus familiaris} MESGNQTHTSEFLLLGFSGKLEIQFMLFGMFLSVYLVTFAGNLLIILAICSDSHLHTPMYFFLANLSFADICFTSTTIPKMLLNIQTQSKTITYEGCLSQIFFFIVFGCL
DNLLLTVMAYDRFVAICHPLHYLVIMNPQLCGLLALGSWCVSVMGSLLETLTLLRLSFCTNMKIPHFFCDLPEVLKLACSDTLINNIVVYSTTGLLAVIPFHGILFSYYQ
IVSSVLSISSAAGKYKAFSTCLSHLLVVSLFYGTGLGVYLSSAVTSSSRMSLVASVMYTIVTPMLNPFIYSLKNRDMKGALRSVLGSVVPVSIGTIIGFS*
757 >lcl|XP_853197.2|Plus122228345..22229277 NW_876272 olfactory receptor-like protein OLF4-like LOC484882 __SEG__ Chr20 {Canis lupus familiaris} MESGNDTQISEFYLLGFSEKPELQPLIFGLFLSMYLITVFGNLLIILSISTDPNLHTPMYFFLANLSFVDICFTSTTIPKMLWNIQTQSKVISYAGCITQIYFLILFAVL
DVFLLSVMAYDRYVAICHPLHYMVIMNPLLCGLLVLVSWIICILNSLLQSLMMLRLSFCTHLNIPHFFCELNEMVQLACSDTFLNNLVMYFAALLLGGGPFAGILYSYSK
IVSSIRGISSAQGKYKAFSTCASHLSVVCLFYCTMLGVYLSSAATQSSHASAVASVMYTVVTPMLNPFIYSLRNRDIKMALRRIIGVPVM*
758 >lcl|XP_853209.2|Plus122244445..22245395 NW_876272 olfactory receptor 7C1-like LOC610582 __SEG__ Chr20 {Canis lupus familiaris} MKSGNQTHASEFLLLGFSEKSEIQFMLFGLFLSIYLVSFTGNLLIILAICSDSRLHTPMYFFLANLSFADICFTSTTVPKMLVNIQTQSKTITYEGCLSQIFFFFVFGCL
DNLLLTVMAYDRFVAICHPPHYSLIMNPQLCGLLALGSWCISVMGSLFETLTLLRLPFCTNMEISHFFCDLPEVLKLACSDTLINNIVVYFVTIVLGVFPLSGILFSYSQ
IFSSILRISSTADKYKAFSTCGSHLSVVCLFYGTSLGDYLSSAATTSSRTSLVASVMYAIVTPMLNPFIYSLRNGDMKGALGRLVPLSIRTITGLS*
759 >lcl|XP_853221.2|Plus123171070..23172026 NW_876305 olfactory receptor 6P1-like LOC610594 __SEG__ Chr38 {Canis lupus familiaris} MMGNLSGGHIADFILVGFPTSPPLQLLLFVLFFAIYLLTLLENALIVSTIWLTPSLHRPMYFFLGHLSFLELWYINVTVPRLLGAFLTQDRRVSYVGCMTQLYFFIALAC
TECVLLAVMAYDRYLAICEPLRYPSLMPSSLAIRLAASSWGGGFFSSMMKLLFISRLSYCGPNIINHFFCDISPLLNLTCSDKEQAELVDFLLALVMILLPLLAVVSSYA
AIIATILRIPTAQGRRKAFSTCASHLAVVVIYYSSTLFTYARPRAMYTFNHNKIISVLYTVIVPFLNPAIYCLRNKEVKDALRKLVLGRCHYPSDVPD*
760 >lcl|XP_853251.2|Plus1complement(23231172..23232113) NW_876305 olfactory receptor 10R2-like LOC610621 __SEG__ Chr38 {Canis lupus familiaris} MANSSRVTEFLLLGFSSFGELQPVLFVLFLGLYLIILSGNFTIISVIRLDRSLHTPMYFFLCVLSTSEVFYTIVILPKMLINLLSVLRTLSFTSCATQMFFFLGFAVTNC
LLLGVMGYDRYTAICQPLRYPVLMSWRVCAQLAATCIVSGFLVSLVATTLVFSLPFCGSNRVNHYFCDISPVIRLACAETYINELVIFICGVLVLVVPLIFICISYGFIV
RTILKIPSADGKRKAFSTCASHLIVVIVHYGCASSVYLRPSAKSSSGKDRLVTVTYTIITPLLNPMVYSLRNKDVQLAIRKVIRKTAVSLKTL*
761 >lcl|XP_853255.2|Plus1complement(23242967..23243908) NW_876305 olfactory receptor 10R2-like LOC610629 __SEG__ Chr38 {Canis lupus familiaris} MANSSRVTEFLLLGFSGFGELQPVLFVLFLGLYLIILSGNFTIISVIRLDRSLHTPMYFFLCVLSTSEVFYTIVILPKMLINLLSVLRTLSFTSCATQMFFFLGFAVTNC
LLLGVMGYDRYTAICQPLRYPVLMSWRVCAQLAATCIVSGFLISLVGTTLVFSLPFCGSNRVNHYFCDISPVIRLACAETYINELVIFICGVLVLVVPLIFICISYGFIV
RTILKIPSADGKRKAFSTCASHLIVVIVHYGCASSVYLRPSAKSSSGKDRLVTVTYTIITPLLNPMVYSLRNKDVQLAIRKVIGKTAVSLKTL*
762 >lcl|XP_853264.2|Plus122423171..22424103 NW_876272 olfactory receptor 7A17-like LOC610635 __SEG__ Chr20 {Canis lupus familiaris} MQPENDTWVSEFFLLGLSEEPELQSIIFGLFLSMYLITVFGNLLIILAISSDSHLHTPMYFFLANLSFADICVTSTTVPKMLLNVQTQSQVITYAGCITQMHFFIIFSGL
DIYLLAVMAYDRFVAICHPLQYMVIMNPRLCGLLLLVSWITNVLHSLLQTSIVLQLSFCRKAEISHFFCELNQMIQLACSDSFLYNMVMYFVAVLLGGGPLPGILYSYSR
IVSSIVGISSAQGKYKAFSTCASHLSVVSLFFCSGLGVYLSSAAPQNSHTSAVASVMYTVVTPMLNPFIYSLRNRDIKRALKRVTGVPVM*
763 >lcl|XP_853276.2|Plus123265672..23266616 NW_876305 olfactory receptor 10T2-like LOC610646 __SEG__ Chr38 {Canis lupus familiaris} MRRQNQSMITEFILIGFSNLGDLQILLFFLFLLVYLTTLMANATIMTVIRLDRTLHTPMYFFLFVLSCSETCYTLVIVPKMLTNLLSTSQTISFPACAAQLYFFVGLACT
NCFLIAVMGYDRYVAICNPLNYTLVVSRATCVQLVLASSCCGFLISVVVNVLVFSVPFCASNRINHFFCDIFPVIKLGCTDTNVKEMVIFFLSILVLLVPLVLIFISYVF
IVSTILKIASAEGQRKAFATCASHLTVVIVHYGCASFIYLRPTSLYSSEKDRLVAVTYTVITPLLNPLVYTLRNKEVKTALSKVLSRYSFPKTV*
764 >lcl|XP_853291.2|Plus123296229..23297176 NW_876305 olfactory receptor 10T2-like LOC610659 __SEG__ Chr38 {Canis lupus familiaris} MHSFNRTTMVTRFVLVGFSSLGELQLLLFVIFLLLYLTILLANATIMAVIRCSRTLHTPMYGFLFILSFSESCYTFVIIPQLLVHLLSATKSISFVACAAQLFFFLGFAC
TNCFLIAVMGYDRYVAICQPLRYTLVMNKRLGLGLVSLSGVTGFFIALVATNLICDMPFCGPNRVNHYFCDMAPVIKLACTDTHVKELALFSLSILVIMVPFLLILISYG
FILNTILKIPSAEGKRKAFATCASHLTVVIVHYGCASIIYLRPRSKSASDKDQLVAVTYTVVTPLLNPLVYSLRNQEVKTALKRVLGMPVATKVI*
765 >lcl|XP_853349.2|Plus1complement(22580321..22581253) NW_876272 olfactory receptor-like protein OLF4-like LOC484896 __SEG__ Chr20 {Canis lupus familiaris} MQPNNDTWISEFFLLGLSEEPELQPLIFGLFFSMYLITVFGNLLIILAVSSDSHLHTPMYFFLTNLSFIDICVTSTTIPNIVINIQTQSKVITYAGCITQMYFFIIFSGL
DIYLLSVMAYDRFVAICHPLQYMVIMNPQLCGLLLLVSCIANILHSLLQTSIMLQLSFCREVEISHFFCELNHMIQLACSDTFLNNMVMYSAALLMGGGPFAGILYSYSK
IVSSILGISSAQGKYKAFSTCASHLSVVSLFFCSGLGVYLSSAAPQSSHSSAVASVMYTVVTPMLNPFIYSLRNRDIKRALKRFFGVPVM*
766 >lcl|XP_853354.2|Plus1complement(14856540..14857478) NW_876266 olfactory receptor 5D14 OR5D14 __SEG__ Chr18 {Canis lupus familiaris} MAVRNLSVEMTFALLGFADYPELQIPLFLLFLIMYIITVVGNLGMIVIIKINPKFHTPMYFFLSHLSFVDFCYSSIVTPKLLENLVMEDKNIFYFSCMLQYFLSCTAVVT
ESFLLAVMAYDRFVAICNPLLYSVVMSQRLCALLVSGSYLWGMFGPLVLLCYALQLNFSGHNTINHFFCEYTALIAVSSSDILIPHLLPFGFATFNEVSTLLIILTSYTF
IFVTVLNIHSASGHRKAFSTCASHLTAITIFHGTILSLYCVPNSKNSRQTVKVASVFYTVVNPMLNPLIYSLRNKDVKDALRKLIDTKVPFH*
767 >lcl|XP_853369.2|Plus1complement(22602734..22603654) NW_876272 olfactory receptor 7A17-like LOC610732 __SEG__ Chr20 {Canis lupus familiaris} MEQRNQSRVSQFILLGLSEVGELQPLLFWLFFSMYLITFSGNLLIILAIVMDSHLHTPMYFFLSNLSFVDICFTSTTVPKMLLNIQTQSKVITYEGCLSQMYFFMLFGGL
DNFLLTVMAYDRFVAICHPLYYMVIMNPKFCGILLLACWLLSVMDSLLHDLMVFQLSFCTQLEISHFFCELKQMIQLACSDTFLNNLAIYLASGLLGVLPLIGILFSYSR
IVASILKISSSGGQYKAFSTCGSHLSVVSLFYGTGFGVYLSSTALRNSRASAIASVMYTVVTPMLNPFIYGLRNRDLKQALRKLFS*
768 >lcl|XP_853374.2|Plus1complement(14865187..14866131) NW_876266 olfactory receptor 5D13-like LOC610735 __SEG__ Chr18 {Canis lupus familiaris} MLLAEGNQSVGATFTLLGFSEYPDFQVPLLLVFLTIYTVTVVGNLGMIMIIRVSPRLHTPMYFFLSHLSFVDFCYSTTVTPKLLENLVVEDRSISFVGCIMQFFLACVCA
VAETFMLAVMAYDRFVAVCNPLLYTVVMSQKLCALLVAGPYIWGIASSLTLTCFLLTLSFCGSNTINNFVCEHSVIVSVSCSDPYISQMLCFVIAIFNEVSSLVIIFTTY
IFIFVTVIKMSSAGGRQKAFSTCASHLTAITIFHGTILFLYCVPNSQNSWLIVKIGSLFYTVVIPMLNPLIYSLRNKDVKESVKKLINHSIQVC*
769 >lcl|XP_853401.2|Plus1complement(14951574..14952557) NW_876266 olfactory receptor 4P4-like LOC610757 __SEG__ Chr18 {Canis lupus familiaris} MENRNNITMFILLGLSQNKNIEIFCFVLFLFCYLAIWVGNLLIMISIMCSQLIEQPMYFFLNYLSLSDLCYTSTVTPKLLTDLLAERKIISYSNCMTQLFILHFLGGVEI
FVLTGMAYDRYVAICKPLHYTIIMSRQRCNAIITACCTGAFIHSASQFLLTIFLPFCGPNEIDHYFCDVYPLLKLACTDTRRIGLLVIVNSGLIALLTFVILMVSYFLIL
YTIMAYPAESRTKALSTCSSHITVVVLFFVPVLFIYIRPATTFPEDKVFALFYTIIAPMFNPLIYTLRNMEMKNALRKVWCHRLFLEGRELILKAFQNFTLGFYPEP*
770 >lcl|XP_853436.2|Plus115019812..15020741 NW_876266 olfactory receptor 4C46-like LOC483566 __SEG__ Chr18 {Canis lupus familiaris} MENRNNVTEFVLLGLTENPKMQKIVFVVFLIIYIVSVVGNVLTVAAITASPLLGSPMYFFLAYLSFIDACYSSVNNPKLIVDSLREKKTTTFNACITQIFGEHFFGGADV
ILLTVMAYDRYVAICKPLHYMIIMNRQVCGLLMAVVWVGGFLHAAIQILFIIPLPFCGPNVIDHFMCDLNPLLNLACTDTHTLGFFVAANSGFICALNFLLLMVSYVVIL
HSLRNHSLEARLKALSTCVSHITVVVLFFVPCIFVYMRPAATLPIDKAVAVFYTMITPMLNPLIYALRNDQMKNAIRKLCSRKVISDAK*
771 >lcl|XP_853437.1|Plus129169949..29170920 NW_876273 olfactory receptor 52N2-like LOC485302 __SEG__ Chr21 {Canis lupus familiaris} MCGENSSSLAPGFFVLNGIPGLEAAHTWITLPFCFMYITAVLGNCGLIYLISHEEALHRPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIHFNACLAQMFFVHMLT
GMESGVLMLMALDRYVAICHPLRYSTILTNPVITKAGLATFLRGVLLILPFTFLTKRLPYCRSNFIPHTYCDHMSVAKVSCGNFKVNAIYGLMVALLIGVFDICCISVSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPAFFTFFAHRFGGHNIPHHIHVIVANIYLLLPPTMNPIVYGVKTKQIREGVIKFLVGDRLSLPKTNKS*
772 >lcl|XP_853447.1|Plus1complement(49263663..49264175) NW_876253 calcineurin subunit B type 2 PPP3R2 __SEG__ Chr11 {Canis lupus familiaris} MGNEASYPEEMCSHFSQDEIKRLGKRFKKLDLDCSGSLSVDEFLSLPELQQNPLVQRVVDVFDTDGNGEVDFREFILGASQFSVRGDEEQKLRFAFSIYDMDKDGYISNG
ELFQVLKMMVRDNLKDWQLQQLVDKTIITLDRDGDGKISFEEFSAVVGGLEVHKKLVVIV*
773 >lcl|XP_853467.1|Plus151659468..51660412 NW_876253 olfactory receptor 13D1-like isoform 2 LOC610556 __SEG__ Chr11 {Canis lupus familiaris} MKMENYSAVTEFFLVGLSQYPELQLFLFMLCLIMYVIILLGNSLIIIISILDSRLHTPMYFFLGNLSFLDICYTSSSIPPMLIMFRSETKSISFIGCALQMVASLGLGST
ECVLLAVMAYDRYVAICNPLRYPIIMNRVLYVHMAAWSWIIGCLNSLVQTALTMVLPFCGNNVIDHLTCEILALLKLICSDISMNVLIMTVASIVLLVLPLLLIFISYVF
ILSSILRINSAEGRKKAFSTCSAHLTVVILFYGSALFMYMKPKSKDTKASDEIIGLSYGVITPMLNPIIYSLRNKEVKEAVKKVLSRHLHLWKI*
774 >lcl|XP_853498.1|Plus115150094..15151023 NW_876266 olfactory receptor 4C46-like LOC483573 __SEG__ Chr18 {Canis lupus familiaris} MGNRNNVTEFVLLGLTENPKMQKIVFVVFLIIYIISVVGNVLTVAAITTSPLLGSPMYFFLAYLSFIDACYSSVNNPKLIVDSLREKKTTTFNACITQIFGEHFFGGADV
ILLTVMAYDRYVAICKPLHYMTIMNRQVCGLLMAVVWVGGFLHAAIQILFIIPLPFCGPNVIDHFMCDLNPMLNLACTDTHTLGFFVAANSGFICALNFLLLMVSYVVIL
RSLRNHSLEAKRKALSTCVSHITVVVLFFVPCIFVYMRPAATLPIDKAVAVFYTMITPMLNPLIYALRNDQMQKAIRKLCSRKVISDEK*
775 >lcl|XP_853500.1|Plus129314020..29314979 NW_876273 olfactory receptor 56A3-like LOC610853 __SEG__ Chr21 {Canis lupus familiaris} MLPYNSSCLSTEVSDFILNCFVRSPSWQHWLSLPLSILFLMAMGANAVLLITIQLEASLHEPMYYLLGLLSLLDIVLCLTVIPKVLAIFWFDLRSISFSACFLQMFIMNS
FLPMESCTFLAMAYDRYVAICKPLYYPTIITDQFVVKAVLFIVARSTFLTTPTPILSARLHYCGKNIIENCICANLSVSKLSCDNVTLNKIYQLIVAWTLLSCDLILIFL
SYILILKTVLRLKAKGAAAKALSTCGSHFILILFFSTILLVLVFTHIAKKKVSPEIPILLNVLHHVIPAALNPIVYGIRTQEIKEGIRKLLRRVVERCK*
776 >lcl|XP_853501.2|Plus1complement(31379011..31379958) NW_876308 olfactory receptor 6C2-like LOC488680 __SEG__ Chr3 {Canis lupus familiaris} MRNYTAITTFILLGLTDDPQLQILLFIFLFLTYILSVTGNRTIITLTLVNSHLKTPMYFFLRNVSFLEVSFTTVCIPRFLYSISTGANTITYNACASQISFVILFGATEF
FLLAAMSYDRYVAICKPLHYMTIMSNRVCSLLVFCCWVSGLMIILPPLSLCLQLEFCDSNAIDHFSCDAGPLLKISCSDTWMIEQMVILVAVFALIITLVCVFLSYTYII
RTILRFPSVQQRKKAFSTCSSHMIVVSITYGSGIFIYIKSSAKEEIAINKGVSVLTTSVAPLLNPFFYTLRNKQVKQAFNDFIKKMTFHSKKLKF*
777 >lcl|XP_853518.1|Plus129344369..29345316 NW_876273 olfactory receptor 56A3 cOR56A9 __SEG__ Chr21 {Canis lupus familiaris} MLPYNSSCLSTEVSDFILNCFVRSPSWQHWLSLPLSILFLVAMGANAVLLITIQLEASLHEPMYYLLGLLSLLDIVLCLTVIPKVLAIFWFDLRSISFSACFLQMFIMNN
FLPMESCTFLAMAYDRYVAICNPTIITDQFVAKAVLFILARNTFLTAPIPILSARLHYCGKNIIENCICANLSVSKLSCDNVALNKIYQLIVAWTLLGSDLVLIFISYIL
ILRAILRLKAKGAAAKALSTCGSHFILILFFSTILLVFVFTHMAKKKVSPDIPILLNVLHHVIPAALNPIVYGVRTQEIKEGIRKLLRRVAERCK*
778 >lcl|XP_853541.1|Plus129449466..29450413 NW_876273 olfactory receptor 56A3-like LOC485317 __SEG__ Chr21 {Canis lupus familiaris} MTAHPNGTISIEVSDFLLNCFVRSPSWKLWLSLPLSFLFLLAMGANSVLLVTIQLEASLHEPMYYLLSLLSLLDIVVCLTVIPKVLAIFWFDLKSINFYACFIQMYIMNC
FLSMESCTFMVMAYDRYVAICHPLRYPSIITEQFVAKAAAFILARNGILTVPIPILSSRLNYCGRNVIENCICANMSVSKLSCDDVTINRLYQFAVGWTLLGSDLILIFL
SYSLILRAVLGLKAEGAMAKALSTCGSHFILILFFSTILLVFVLTLVVKKKVSPDVPVLLNILHHVIFSALNPIVYGVRTQEIKQGIQRLLKKGW*
779 >lcl|XP_853565.2|Plus1complement(29526078..29527022) NW_876273 olfactory receptor 56A1-like LOC610901 __SEG__ Chr21 {Canis lupus familiaris} MASPSNYSTAPVSEFLLICFPNYQSWQHWLSLPLSLLFLLAMGANATLLITIRLEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFSACFLQMFIMNSF
LPMESCTFMVMAYDRYVAICHPLRYPSIITNQFVAKASAFIVTRNALLTAPIPILTAQLHYCGKNVIENCICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDFILIFLS
YTFILRAVLRFKAEGAAVKALSTCGSHFILILFFSTILLVVVLTNVARKSVPMDILILLNVLHHLIPPALNPIVYGVRTKEIKQGMNKLLWKRM*
780 >lcl|XP_853574.2|Plus1complement(29541958..29542902) NW_876273 olfactory receptor 56A1-like LOC485323 __SEG__ Chr21 {Canis lupus familiaris} MTSPSNYSTAPVSEFLLICFPNYQSWQHWLSLPLSLLFLLAMGANTTLLITIWLEASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFSACFLQMFIMNSF
LPMESCTFMVMAYDRYVAICHPLRYPSIITDQFVAKASVFIVIRNALLLSPVPILTAQLHYCGKNVIENCICANLSVSKLSCDNFTLNRIYQFVVVWTLLGSDFILIFLS
YTFILRAVLRFKDEGAAAKALSTCGSHFILILFFSTILLVVVLTNVARKSVPMDIPILLNVLHHLIPPALNPIVYGFRTKELKQGCQKLLRWGL*
781 >lcl|XP_853585.2|Plus1complement(15507444..15508370) NW_876266 olfactory receptor 4P4 OR10H12 __SEG__ Chr18 {Canis lupus familiaris} MGHENITEFILLGLFSDKDEKTACFVLFVLCYIAILSGNLLILLTIRGSRLREQPMYFFLSYLSFMDVCFTSTVAPKLIIDLLAQQKTISYNGCMAQMFYAHFFGATEIF
ILVAMAYDRYAAICRPLHYMVIMSRQVCYVLVMASILGAFTHSIMQVLIVIELPFCGPNQIDHYFCDVFPLLKLACMDTSLLVIVIITTTGVLSILTFVALVISYIIILS
TLRTYSSQGCRKALSTCGSHITVVFMFFLPLIFTYVPMADSVSNDKVFALFYTMIAPMFNPLIYTLRNTDMKNAMRKMWCRDARFEGK*
782 >lcl|XP_853591.1|Plus117503197..17504138 NW_876259 olfactory receptor 11G2 cOR11J4 __SEG__ Chr15 {Canis lupus familiaris} MTSEARNASRSGQDFILLGFPCSREVQFLLFSIFFVTYTLTLLGNTVIVCAVHGDRRLHTPMYVLLANFSFLEICYVNSDVPNMLANLLSQTKTISFARCLLQLYFFFSL
GTTECLFLSIMAYDRFLAICRPLHYPTVMTIKFCVRLVIFCWVYGFLWFLIPVILVTQLPFCGPNVIDDFLCDLGPLLALASACVPIPGTVLICGTMSSLLIFATFLYII
GSYSLVVWVVVQVPSRAGRKKAFSTCCSHLAVVFLFYGSVMMTYVSPGSGQAEGMQKFTTLFYSVLTPFFNPMIYSLRNKEMKAALKKILGGS*
783 >lcl|XP_853592.1|Plus115542017..15542943 NW_876266 olfactory receptor 4C6-like LOC491531 __SEG__ Chr18 {Canis lupus familiaris} MENPKNVTEFILLGITENPELRKMLSAVFLIMYVSTVLGNLVIVVTVITSQSLRSPMYFFLIFLSLLDVTYSSVIAPKMIVDSLSKSTVISLEGCMAQLFAEHFFGGVGI
ILLIVMAYDRYVAICKPLHYLTIMSPRMCCLLLGGAWVGGFIHAAIQLLFMYQIPFCGPNVIDHFICDLFPLLKLACMDTHTLGLLVILNSGVMCMTIFLILIASYVVIL
CSLKSCSSEGRRKAFSTCGSHLTVVVLFFVPCIFLYVRPVATYPIDKAMAVSDSIITPMLNPLIYTLRNSEVKNAMRKLGKQRSFVGK*
784 >lcl|XP_853599.2|Plus1complement(15550476..15551390) NW_876266 olfactory receptor 4C11-like LOC491529 __SEG__ Chr18 {Canis lupus familiaris} MVMNSTVNEFILFGLTQDPRKQKAVFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFFLFYLSFTDACLSTTIAPRLIVDAISQRKTISYNECMTQVFSAHFFGCMEI
FVLILMAFDRYVAICKPLRYTTIMNRHVCSVLVILGWVGSCIHSSAQIFLASRLPFCGPNVIDHYFCDLQPLLKLACMDTYVINLLVVSNSGAICTVSFIILLISYVIIL
YSLRNYSAEGRRKALSTCTSHFIVVVLFFGPCIFIYTRPATTFPVDKVVAVFYTFGTPLLNPLIYTLRNAEVKNAMKKLWCSKV*
785 >lcl|XP_853606.2|Plus1complement(15569400..15570314) NW_876266 olfactory receptor 4C11 cOR4C30 __SEG__ Chr18 {Canis lupus familiaris} MSMNSSVNEFILLGLTQDPRKQKAIFGVFLMLYLATLLGNFLIVVTIKRSRTLGSPMYFFLFYLSFADACFSTTIAPRLIVDAISQQKTISYNECMTQVFSAHFFACMEI
FVLILMAFDRYVAICKPLRYTTIMNRHVCSVLVILGWVGSCIHSSAQIFLASRLPFCGPNVIDHYFCDLQPLLKLACMDTYVINLLVVTNSGAICLVSFIILLISYVVIL
YSLRNHSAEGRRKALSTCTSHFIVVVLFFGPCIFMHTRPATTFPVDKVVAVFYTIGTPLLNPLIYTLRNAEVKNAMKKLWCSKG*
786 >lcl|XP_853612.1|Plus1complement(29692207..29693175) NW_876273 olfactory receptor 52B2 OR52B2 __SEG__ Chr21 {Canis lupus familiaris} MTHTNFTIFHPAVFVLLGIPGWEAYHIWLSVPLCLMYITAVLGNTILIVVIITDRNLHEPMYFFLSMLAITDILLSTTTVPKALAIFWLHAHNIAFDACVTQVFFVHVMF
VGESAILLAMAFDRFVAICAPLHYTTVLTWRVVGRIALAIVTRSFCIIFPVIFLLKRLPFCRTNIVPHSYCEHIGVARLACADITINIWYGFSVPIVMVILDVILIAVSY
SLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFTLLTHRFGRNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQIREGVAHRFLDIKTWCCASPLG*
787 >lcl|XP_853620.2|Plus1complement(15634562..15635476) NW_876266 olfactory receptor 4C11 cOR4C32 __SEG__ Chr18 {Canis lupus familiaris} MAMNSSVNEFILFGLTQDPRKQKAIFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFFLFYLSFADACFSTTTAPRLIVDAISQQKTISYNECMTQVFSAHFFGCMEI
FVLILMAFDRYVAICKPLRYTTILNRHVCSVLVILGWVGSCIHSSAQIVLALRLPFCGPNVIDHYFCDLQPLLKLACMDTYVINLLVVSNSGAICTVSFIILLISYVIIL
YSLRNYSAEGKRKALSTCTSHFIVVVLFFGPCIFMYTRPATTFPVDKVVAVFYTIGAPLLNPLIYTLRNAEVKNAMKKLWCSKL*
788 >lcl|XP_853626.2|Plus1complement(15656576..15657490) NW_876266 olfactory receptor 4C11 cOR4C38 __SEG__ Chr18 {Canis lupus familiaris} MAMNSSVNEFILFGLTQDPRKQKAIFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFFLFYLSFADACFSTTTAPRLIVDAISQQKTISYNECMTQVFSAHFFGCMEI
FVLILMALDRYVAICKPLRYTTIMNRHVCSVLVILGWVGSCIHSSAQIVLALRLPFCGPNVIDHYFCDLQPLLKLACMDTYVINLLVVTNSGAICMVSFIILLISYVIIL
YSLRNYSAEGRRKALSTCTSHFIVVVLFFGPCIFIYTRPATTFPVDKVVAVFYTIGTPLLNPLIYTLRNAEVKIAMKMLWCSKV*
789 >lcl|XP_853645.1|Plus1complement(17823432..17825048) NW_876251 ankyrin repeat domain-containing protein 57 ANKRD57 __SEG__ Chr10 {Canis lupus familiaris} MEGPAELSVEAVLRFLRERGGRAPHAELVQRFRGALGGDPEQRARARARFKELVNAVATVRTDPADGSKFVHLKKRFLEGAPPDLPRAAGTAEPAEPAEPAEPEASRGAP
PEVPDGGQRSEAASPEASPRPGGGPGDGGPPGVDRESGSGPPPSAGARPRHPRRDAQPHPRGPGPGPSEDPAPPPPPPPHGCAETDAGTAPGGVGTPRPPRQSLRDLVMG
SSPQLKRSVCAGGSSPGSSSGGGRGKGGGKADSASVASSSAEEDSCGGSLTLDPLEHAWMLSASDGKWDSLEGLLTCEPGLLAKRDFITGFTCVHWAAKHGRQELLAMLV
NFANKHQLPVNINARTSGGYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGRKASQYLSPSIAEEIKNLVGALDEDDGDCAAGGGGGRWRLSKVLPSHLITYKLSHVL
EDGGDHHHHHHHHHHHLTDGWAGGKVKDPGRKAPGSSSGRIKPRLNKIRFRTQIIHTTPSFRDPEQPLEEEGEEEEEDRALKGHSSSFKLRPKSNVFG*
790 >lcl|XP_853665.2|Plus1complement(15755064..15755987) NW_876266 olfactory receptor 4C46-like LOC610972 __SEG__ Chr18 {Canis lupus familiaris} MDHFTPPNNVTEFILLGLTQNPHLQKIFFVVFLFIFLFTVLANLLIVLTISLSSTLSAPMYFFLTYLSFIDASYTSVTTPKMIIDLLYQRRTISLGGCLTQLFVEHFLGG
SEIILLIVMAYDRYVAICKPLHYMTIMRHGLCQLLVVVAWIGGILHATVQILFMVNLPFCGPNVIDHFMCDLFPLLKLACSDTYRLGMVVAANSGAMCLLIFSMLLISYT
VILSSLSSHGSEGRHKALSTCCSHFTVVVLFFVPCIFTYMRPVVTYPVDKLVTVFFAILTPMLNPIIYTVRNSEVKNAMRSLLKRVI*
791 >lcl|XP_853671.2|Plus1complement(15762118..15763050) NW_876266 olfactory receptor 4C46-like LOC610976 __SEG__ Chr18 {Canis lupus familiaris} MKEERMNVTVFILMGLTQNPQMQRILFLVLLVTYIVTVSGNLLIVVTIIRSQTLDSPMYFFLAFLSLIDACYSSSIIPKMLADLLFDSKSVSFSGCMTQLFVEHFLGASE
IVLLVVMAYDRYVAICRPLHYVTIMNHHTCCLFVGMCWVVGFLHSIGQILVTFWLPFCGPNIMDHFMCDIFPLIQLACTDTFFVGFLVAANGGAISVITFVMLLISYVVI
LCSLKTHSSVGKKKALSTCSSHITVVVLFFVPCIFMYLRPVATFPMDKAIAVFYTLVTPMLNPVIYTVRNTEVKNAMRMLLTRNAISDNK*
792 >lcl|XP_853761.1|Plus130291646..30292596 NW_876273 olfactory receptor 2AG1-like LOC611042 __SEG__ Chr21 {Canis lupus familiaris} MEYWNSTLGSGFILMGILNDSGSPELLCATITVLYMLALTSNGLLLLVITVDSRLHVPMYFLLGQLSLMDLLFTSVVTPKALVDILQSENTISFGGCALQMFLALTLGGA
EDLLLAFMAYDRYVAICHPLNYMVFMRPRVCSLMVATAWILAFLSALGHTLYTMHYPFCKVRKIRHLLCEIPPLLKLACADTSRYELLVYVTGVTFLLMPLSAIVASYAL
ILCTVLHMPSNEGKQKALVTCSSHLTVVVMYYGAATFMYVLPSSLHNPRQDNIISLFSTVVTPALNPLIYSLRNQEVMGALRRVLGKYMLPTHCTF*
793 >lcl|XP_853777.1|Plus130313630..30314580 NW_876273 olfactory receptor 2AG2-like LOC611057 __SEG__ Chr21 {Canis lupus familiaris} MEYWNSTLGSGFILMGILNDSGSPELLCATITVLYMLALTSNGLLLLVITVDSRLHVPMYFLLGQLSLMDLLFPSVFTPKTLMDFLQSENMISFGGCALQMFLVLTLGGT
EDLLLAFMAYDRYVAICHPLNYMVFMRPRVCWLMVATAWILAFLSALGHTLYTMHYPFCKVRKIRHLLCEIPPLLKLACADTSRYELLVYVTGVTFLLMPLSAIVASYAL
ILCTVLHMPSNEGKQKALVTCSSHLTVVVMYYGAATFMYVLPSSLHSPRQDNIISLFYTVVTPALNPLIYSLRNQEVMGALRRVLGKYMLPTHCTF*
794 >lcl|XP_853785.1|Plus130329657..30330607 NW_876273 olfactory receptor 2AG2-like LOC485343 __SEG__ Chr21 {Canis lupus familiaris} MEYWNSTLGSGFILMGILNDSGSPELLCATITVLYMLALTSNGLLLLVITVDSWLHVPMYFLLGQLSLMDLLFTSVVTPKALVDFLQSEYTISFGGCALQMFLALALGSA
EDLLLAFMAYDRYVAICHPLNYMVFMRPRVCWLMVATAWILAFLNALGHTLYTMHYPFCKVRKIRHLLCEIPPLLKLACADTSRYELLVYVTGVTFLLMPLSAIVASYVL
ILCTVLHMPSNEGKQKALVTCSSHLTVVVMYYGAATFMYVLPSSLHSPRQDNIISLFYTVVTPALNPLIYSLRNQEVMGALRRVLGKYMLPTHCTF*
795 >lcl|XP_853793.2|Plus1complement(16069836..16070741) NW_876266 olfactory receptor 4C12-like LOC611068 __SEG__ Chr18 {Canis lupus familiaris} MEKMNNVTEFILLGLTQNVELQKFSFVVFLIVYLVTLAGNLLIMITISTSKALETPMYFFLSYLSLIDGCCSSSMTPKMLADTLTMRKIISFRGCMTQVFAEHFFGAAEI
ILLTVMAYDRYVAICKPLRYTTIMSQQVCSLLVGVVWAGAFVHATIQIFFTVWLPFCGPNVIDHFMCDLNPLLKLVCMDTHTLGLFVAANSGFICLLNFLLLVVSYMVIL
HSLRTYSLEGRRKALSTCVSHITVVILFFVPCIFVYLRPAITFSIDKAVAVFYTMITPMLNPLIYTLRNAEVKNAIKKLWI*
796 >lcl|XP_853837.2|Plus116167599..16168708 NW_876266 hsc70-interacting protein-like LOC483608 __SEG__ Chr18 {Canis lupus familiaris} MDPRKVSELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKIPPATHKTKSEDNIKEEKTDSKKAEENIKTDEPSSEESDLEIDNEGVIEPDTDAPQEMGDENVEITEEM
MDQANDKKVAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFIKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAM
LKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAWEEHERAQREEEARRQSGAQYGSFPGGFPGGMPSNFPGGMPGMAGGMPGMAGMPGLNEILSDPEVPAAMQDPE
VMVAFQDVAQNPANMTKYQSNPKVMNLISKLSAKFGGQA*
797 >lcl|XP_853845.1|Plus130521560..30522513 NW_876273 olfactory receptor 10A5 OR4B06 __SEG__ Chr21 {Canis lupus familiaris} MAGGNWTKVEEFILISFSSLPTEIQLLLFLTFLIIYLATLMGNTLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFSFFFGV
DECFLLATMAYDRYVAICSPLHYPVIMNQRTRAKLAVASWFPGFPVATVQTTWLFSFPFCGTNEVNHFFCDSPPVLRLVCADTTLFEIYAIVGTILVVMTPCLLILCSYT
RIAAAILKIPSAKGKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNNEVKNALGRTFHKALGLRNCIP*
798 >lcl|XP_853882.2|Plus130647707..30648618 NW_876273 olfactory receptor 10A2 cOR10A9 __SEG__ Chr21 {Canis lupus familiaris} MSFSSLPTEIQLLLFLTFLIIYLVTLMGNTLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLLAWDTTISFLGCATQMYFFFFFGGAECFLLATMAYDRY
VAICSPLHYPVIMNQKTRAKLAVASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTALFEIYAIVGTILVVMTPCLLILCSYTRIAAAILKIPSAKG
KHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNNEVKNAFSRTFRKALGLRNCIP*
799 >lcl|XP_854045.1|Plus1complement(44164188..44165324) NW_876284 mitogen-activated protein kinase 3 isoform 1 MAPK3 __SEG__ Chr27 {Canis lupus familiaris} MAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSADDHVRKVRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPT
LDAMRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKG
YTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLE
QYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGVLEAP*
800 >lcl|XP_854065.1|Plus117794734..17796170 NW_876266 muscarinic acetylcholine receptor M4 CHRM4 __SEG__ Chr18 {Canis lupus familiaris} MANFTPVNGSAGNQSVRLVTSAHNRYETVEMIFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLAL
DYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVPDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLA
SRSRVHKHRPEGPKEKKAKTLAFLKSPLMKQSIKKPPPGEAAQEELRNGKLEEAPPPVLPPPPRPVADKDTSNESSSGSATHNTKERPATELSTTEATTPAMPAPPLQPR
ALNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQSCIPDTVWSIGYWL
CYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR*
801 >lcl|XP_854072.2|Plus1complement(31662134..31663078) NW_876273 olfactory receptor 10A3-like LOC611322 __SEG__ Chr21 {Canis lupus familiaris} MKRQNQSSVVEFILLGFSNFPELQEQLFGVFLAVYLVTLMGNAIIIVIITLEQTLHVPMYLFLQNLSVVDVSFSAVIMPEMLVVLTREKTSISFMSCFAQMYFILFFGGT
ECFLLGTMAYDRFAAICHPLSYPMIMNKRVFMKLVMFSWVSGIMVATVQTTWVFSFPFCGPNVINHLFCETPPVLELACADTFLFEIYAFTGTILIVMVPFVLILLSYIR
ILFAILRMPSATGRQKAFSTCASHLTSVTLFYGTASMTYLQPKSGYSPETKKLMSLSYSLLTPLLNPLIYSFRNSEMKRALMKLWRRRVDIHAF*
802 >lcl|XP_854094.1|Plus125464253..25465449 NW_876272 sphingosine 1-phosphate receptor 5 isoform 1 S1PR5 __SEG__ Chr20 {Canis lupus familiaris} MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVSLAVCALIVLENLAVLFVLARHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLRLSPALWFA
REGGVFVALAASVLSLLAIALERRLTMARRGPAPASRRGRTLALAGAAWGVSLFLGLLPALGWNCLGRLDSCSTVLPLYAKAYVLFCVLAFLGILATICALYGRIYCQVR
ANARRLRERPGASGGASTRARRPPRSLALLRTLSLVLLAFLMCWGPLFLLLLFDVACPARACPVLLQADPFLGLAMANSLLNPIIYTFTNRDLRHALVRLLCCGRRPCTR
EQDASQGSGSPAGASEGLNRWLPPGLDGSCRHLGRLSPQPDGLDTSGSTGGPGAPTASWTLVHAPAAD*
803 >lcl|XP_854131.2|Plus1complement(26292244..26293182) NW_876272 olfactory receptor 7D2-like LOC611376 __SEG__ Chr20 {Canis lupus familiaris} MEAGNLTGILEFILLGFSEDPELQPFIFGLFLCMFLVTVLGNLLIILAICSDPHLHTPMYFFLSNLSLVDICFSTTIVPKMLVNIHTENKAISYMDCLTQVYFSMFFPIL
DTLLLTVMAYDRFVAICHPLHYTVIMSPRLCGLLVFATWFVGIMTSLLHISLMRHLSFCRDLEIPHFFCELTQILKLACSDTFLNSTLIYFMTGVLGVFPLVGILFSYSQ
IASSIRKMSSSGGKQKAFSTCGSHLSVVSLFYGTGVGVYFTSAVTHSPQKVSVASVMYTVVTPMLNPFIYSLRNKDVKGALGSLLSRVTSCL*
804 >lcl|XP_854178.2|Plus1<26432157..26433146 NW_876272 olfactory receptor 7G1-like LOC611416 __SEG__ Chr20 {Canis lupus familiaris} CHFTFSIRSINNMGLRNNTGVSEFLLMEVTEDPELKPLLFVLFLSIYLVTILGNLLIILAVICDSHLHTPMYFFLSNLSFTDICLSTTTIPKMLVNIQAEDQSITYTGCL
TQIYFILVFASLESFLLSVMAYDRYVAICHPLRYTVIMNSHLCGLLILLSLCINIVDALMHSLMVLQLSFCTDLEIPLFFCEVVQVIKIACSDTLINNILIYFATSVFGG
IPVCGIIFSYTQIVSSVLRMPSTGGKYKVFSTCGSHLSVVSLFYGNGLGVYISSALTSSSRNTAVVSVMYTIVPQMMNPFIYSLRNRDMKGALRKLMSKIPLFFQERAV*
805 >lcl|XP_854183.1|Plus133306465..33306926 NW_876270 cdc42 effector protein 5 CDC42EP5 __SEG__ Chr1 {Canis lupus familiaris} MPVLKQLGPAQPKKRPERGTLSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSAPPPAVPQPPPPALRAPAPADPLLSFHLDLGPSMLDAVLG
VMDAERPGAAATKPDLDLSSEAQHPRAHCRPSADLELDDVIGL*
806 >lcl|XP_854304.1|Plus125167057..25167986 NW_876302 putative olfactory receptor 2W6-like LOC611532 __SEG__ Chr35 {Canis lupus familiaris} MEKSNGSSEYGFILVGFSDRPKLELVLFIVNFILYTVAVLGNSTIILVCILDSRLHTPMYFFLANLSFLDLCFSTSCIPQMLVNLWGPDKTISYAGCVVQLFSFLSVGSI
ECILLAVMAYDRYAAVCKPLHYLVIMHPQLCLRLVAVAWGSGLVNAIVMSPLTMTLPRCGRLRINHFLCEMPALIKMACVDARAVEMLAFTFAILIVLLPLVLILLSYGY
ITAAVLKIKSAAGRWKAFNTCSSHLTVVSLFYGSIIYMYMQPGNSSSQDQGKFLTLFYNLVTPMLNPLIYTLRNKEVKGALKKVLGRQQ*
807 >lcl|XP_854447.1|Plus134724268..34725602 NW_876263 alpha-2B adrenergic receptor ADRA2B __SEG__ Chr17 {Canis lupus familiaris} MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDR
YWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSHRRGPRAAGGRGEGESKQ
PHSVPTAASTKLPTLASLAASGEANGHSKPTGEKEEGDTSEDPGTPALPPSWSAVPNPGQSQKEGVCGASPEEEAEMEEGEEECEPQALPASPAAACSPPLRQPQGSRVL
ATLRGQVLLGRGVGTTSGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRQWT
QTAW*
808 >lcl|XP_854487.1|Plus1complement(35614420..35615475) NW_876270 N-formyl peptide receptor 2 FPR2 __SEG__ Chr1 {Canis lupus familiaris} MENNLSIPLNGSEEMLHESAGYKVLHILPLVVLGITFVLGILGNGLVIWVAGFRMARTVTTICYLNLALADFSFTATLPFLIVSMAMRELWPFGWFLCKVVHIVVDINLF
GSVFLIAFIALDRCICVLHPVWAQNHRTVSLASKVIIGPWILALILTLPVFIFLTTVNDGTGNIYCTFNFASWGNSIEERLKVAITMLTARGIIRFIIGFSMPMSIVAIC
YGLIAAKIHKKGMIKSSRPLRVLTAVVASFFLCWFPFQLIALLGTVWLKEMLFEGKYKILDVLVNPTSSLAFFNSCLNPMLYVFMGQDFRERLIHSLPASLERALSEDVT
QTTDTTAKSALPSAEAELQAM*
809 >lcl|XP_854636.1|Plus124724896..24726305 NW_876266 probable G-protein coupled receptor 152 GPR152 __SEG__ Chr18 {Canis lupus familiaris} MDAAMEANLGAADHGPRTELDDEDYYPQGGWDTVFLVALLLLGLPANGLMAWLAGSQARQGAGTRLALLLLSLALSDFLFLAAAVFQILEIQHGGHWPLGTAACRFYYFL
WGVSYSSGLFLLAALSLDRCLLALCPRWYPGRRPARLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLVICLDFWDSEELPLRMLEILGGFLPFLLLLVCHVLTQATAC
KTCCRHQPRPAACQGFARVAKTILSTYVVLRLPYHVAQLLYLAFLWDIYPGYLLWEALVYSDYLILLNSCLSPFLCLLASADLRALLRAVLSSFAAALCEERPGSLTPAE
PQAQVDSEGQTLPMAGAQPPGNPVTPPQVDPAAQPQLDSVAPPRSDFGVQPQLNSSGQPQVNHEAQPHVDSVAQSQVSPKAQAPGSPASSAPRPCDEASSAPSTDPTPGA
PENPAVPAASDGEGPGSVPPEEAPGTGPT*
810 >lcl|XP_854783.2|Plus1complement(43367324..43368262) NW_876253 olfactory receptor 13J1-like LOC611969 __SEG__ Chr11 {Canis lupus familiaris} MELVNRTEIFEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIVAVSVLDVHLHTPMYFFLGNLSILDICYTSTFVPLMLVHLLSAQKTISFVGCAIQMCLSLATGST
ECLLLAIMAYDRYLAICRPLRYPVLMSHRLCLLLAGAAWGLCLVKSMTETVIAMRLPFCGHRMVSHFTCEILAVLKLACSDTSVSEVFLLVGAILLLPIPLAFICLSYTL
ILATILRVPSAAGRRKAFSTCSAHLAVVMLFYGTVIFMYMKPKSKEAHISDEVFTVLYAVVTPMLNPVIYSLRNKEVKEAARKVWCRSWTSK*
811 >lcl|XP_854786.1|Plus1complement(43417585..43418544) NW_876253 olfactory receptor 2S2-like LOC611974 __SEG__ Chr11 {Canis lupus familiaris} MEKANWSSPVAGFIILGLSDHPGLEKMFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFLDICYTTSSVPLVLDGFLTPRKIISFSACAVQMFFSFAMAG
TECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAVSSWAIGGTASVVHTSLTIQLPFCGNNVINHLACEILAVLRLACVDISINVISMRVANVILLGVPVLFISISYV
FIIATILRIPSAEGRRKAFSTCSAHFTVVVIFYGTLFFMYRKPKSKDSLEDNKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKSAVWNLMSQKCFTR*
812 >lcl|XP_854802.2|Plus143471478..43472422 NW_876253 putative olfactory receptor ENSP00000348552-like LOC611988 __SEG__ Chr11 {Canis lupus familiaris} MDRSNQTSPVMGFILLGLSAHPKLEKTFFVLILVMYLVILLGNGVLILVTILDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTIPFSACVMQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPVVMSKAAYVPMAASSWAAGITNSVVQTSQAMRLPFCGDNVINHFTCEILAVLKLACADISINVISMVVANVIFLGVPVVFIFVSYV
FIIATILRIPSAEGRKKAFSTCSAHLTVVVVFYGTILFMYGKPKSKDPQGADKQDISDKLTSLFYGVVTPMLNPIIYSLRNKDVKAAMKNLVCQ*
813 >lcl|XP_854902.1|Plus1complement(31066887..31068038) NW_876272 sphingosine 1-phosphate receptor 4 S1PR4 __SEG__ Chr20 {Canis lupus familiaris} MNGTGPPAAAPESCQQLAASGHSRLIVLHYNHSGRLAGRAGPDEGSLGVLRGVFVAASCLVVLENLLVLVAIATRMRSRRWVYYCLVNITLSDLLTGVAYLANVLLSGAR
TFHLAPAQWFLREGLLFMALAASTFSLLFTAGERFATMVRPVAESGASKRGRVYGFIGLCWLLAALLGLLPLLGWNCVCAFPRCSSLLPLYSKAYILFCVGVFACILAAI
MALYGAIFRVVRANGQKAPRAPARRKARRLLKTVLMILLAFVVCWGPLFGLLLADVFSSTDWAQEYLRGMDWILALAVLNSAVNPLIYSFRSREVCQAVLGFLCCGCLRL
GLRGPRDCLAQVTEAQSSTTDSSLRPRDSFRGSRSLSFRMREPLTSISSVRSV*
814 >lcl|XP_854968.1|Plus1complement(38919430..38920443) NW_876270 C5a anaphylatoxin chemotactic receptor C5L2 GPR77 __SEG__ Chr1 {Canis lupus familiaris} MENTSVSYDYGHYDEIPDLPVDCVDGSCVSTDPLSVAPFLLYAVVFLVGVPGNATMAWVTWKEARRRVGATWFLHLAVADLLCCLSLPVLAVPMARGGHWPYGALGCHTL
SSLILLSMYASVLLLAALSADLCLLALRPGWGAAGGRARRVQVACAVAWAVALLLTVPSAMYHRLHQEHFPPRLECVVDYGGSAVVESAVAAARFVCGFLGPLVVVASCH
GALLCRAAPHRWPLGVAVVLGFFVCWAPYQLLGLVITVAAPHSRLLARALRAEPLVIGLALAHSCLNPVLFLYFGRTHLCRSLPAACRRALKESQSKDESVVGKKSTSHD
LVSEVEV*
815 >lcl|XP_854999.1|Plus131713243..31715021 NW_876272 leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3-like LINGO3 __SEG__ Chr20 {Canis lupus familiaris} MTCWLCVLSLQLLLLPAAPPPAGGCPARCECTAQTRAVACPRRRLTAVPDGIPAETRLLELSRNRIRCLNPGDLAALPLLEELDLSENVIAHVEPGAFANLPRLRVLRLR
GNLLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLRSLRRLEVGDNHLVFISRRAFAGLLALEELTLERCNLTALSGESLGHLRGLGALRLRHLAIAALEDQNFRR
LPGLLHLEIDNWPLLEEVAAGSLQGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLL
STLEENTFHSVNTLETLRVDGNPLACDCRLLWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTAAAGDDVRFQCRAEGEPAPTVA
WVTPRHRAVTASSAGRTRVLPGGTLEIQGARPQDSGTYTCVASNAGGNDTYFATLTVRPEPAANRTPSEGRNETQAAVRFPLDLTTILVSTAMGCITFLGVVLFCFLLLF
VWSRGRGQHKNNFSVEYSFRKVDGPAAATGQGGARKFTMKMI*
816 >lcl|XP_855119.2|Plus149146610..49147587 NW_876269 LOW QUALITY PROTEIN: proto-oncogene Mas MAS1 __SEG__ Chr1 {Canis lupus familiaris} MDELNVTSFVDEKSTNASTARNTSVGDLRREIPIVHWVIMSISPLGFVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSVDYALDYELSSGYYYTIVTLSV
TFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSEGQSHSRSDCRAVIIFIAILSFLVFHSSHGGCPAPSW*SRSERTRG
RPIPRSCT*SSWSPSSYSSFSPCP*GSCTCCITSTGQPLGTCTIFLFFSPRSTAAPTLLFTSSWAAAGRSVSRSP*K*F*PGLSKMKCNPGARKTMATPPRLRLWS
817 >lcl|XP_855123.2|Plus141034824..41035906 NW_876292 cannabinoid receptor 2 CNR2 __SEG__ Chr2 {Canis lupus familiaris} MESRGVMEAANGCKDALDFNPMKEYMVLNSSQRIAVAVLCTSLALLSALENLAVLYLVLSSHRLRRKPSYLFISSLAVADFLASVIFACNFVNFHVFHGMDSKAVFLLKI
GSVTMTFTASVGSLLLTAIDRYLCLCHPSTYKALLTCGRALATLGIMWALSALVSYLPLMGWTCCPNPCSELFPLIPNDYLLGWLLFIAFLFFGIIYTYGHVLWKAHQHV
ASLAEHQDRQVPGMARMRLDVRLAKTLGVVLAVLFICWLPVLALMVYSLTTTLSDQVKKVFAFCSLLCLVNSMINPIIYALRSGEIRSSAFHCLAHWRRHLRRLGLEGNK
EVPRSSVTETEADVKITPWPDSRVLNCPDC*
818 >lcl|XP_855419.2|Plus143772923..43773417 NW_879562 diphosphoinositol polyphosphate phosphohydrolase 3-beta NUDT11 __SEG__ ChrX {Canis lupus familiaris} MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDS
VSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSVAASLPQSDP*
819 >lcl|XP_855453.1|Plus144758712..44759833 NW_879562 probable G-protein coupled receptor 173 GPR173 __SEG__ ChrX {Canis lupus familiaris} MANTTGEPEEVSGALSPPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYFLLDLCLADGIRSAVCFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHA
AFMLFCISVTRYMAIAHHRFYAKRMTLWTCAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPV
QMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRVFVKACAVPHRYLAIAVWMSF
AQAAVNPIVCFLLNKDLKKCLRTHAPCWGTGGAPAPREPYCVM*
820 >lcl|XP_855481.1|Plus1complement(47495546..47496538) NW_876270 free fatty acid receptor 2 FFAR2 __SEG__ Chr1 {Canis lupus familiaris} MTNWRSPLILTAYIIIFLTGLPANLLALRAFIGRVRQPHPAPVHILLLSLTLADLLLLLLLPFKMVEAAYDFQWYLPELLCALTGFGFYSSIYCSTWLLAGISIERYLGV
AFPVQYKLSRKPVYGVIAAVIAWVMSFGHCTIVIIGQYWNSTHNDVTSENGITCYENFTQAQLDVVLPVRLELCLFLFFVPMVITIFCYWRFVWIMLTQPHVGAQRRRRA
VGLAVVTLLNFLVCFGPYNVSHLVGFFTKKSPLWRAEAVVFSSLNASLDPLLFYFSSAAVRRAFGRGLQILRHQSASLLGRRGKETTEGTSGDRGVSQAEGAPSSDFTTE
*
821 >lcl|XP_855484.1|Plus1complement(47549452..47550426) NW_876270 free fatty acid receptor 3 FFAR3 __SEG__ Chr1 {Canis lupus familiaris} MDTSPDLSFFPGNHWLYFSVYLFTFLVGLPLNLVALVIFLGKLRRRPVAVDVLLLNLTISDLLLLLFLPFRMVEAASGMRWPLPFIFCPFSGFLFFTTIYLTSLFLAAVS
VERFLSVAYPLWYKARPRPRQAGLVSGACWLVAGAHCSVVYITEFSRNSSYSHTNNDTCYLEFQENQLAILLPVRLEMAVVLFGVSLLITSYCYGHLVWVLSRGASHRRR
RRVVGLVAATLLNFLVCFGPYNVSHVVGYIRGESPAWRSYVLLLSTLNSCVDPLVYYFSSSGFQADFHGLLRRLTGGWRPWREEGSLKLKEKNEEGGSRGSCPT*
822 >lcl|XP_855486.1|Plus1complement(47554294..47555193) NW_876270 free fatty acid receptor 1 FFAR1 __SEG__ Chr1 {Canis lupus familiaris} MDLPPQLFFALYVAAFALGFPLNILAIGGAVSHARLRLTPSLVYALHLGFSDLLLAASLPLKAVEALALGAWPLPAPLCPAFALAHFAPLYAGGGFLAALSVGRYLGAAF
PLGYQAARRPRYSWAVCAAIWALVLCHLGLVFGLEAPGGWVDNTTSSLGINTPVNGSPVCLEAWDPASAGPARLTLSLLLFFLPLTITAFCYVGCLRALARSGLSHRRKL
RAAWVAGGALLTLLFCLGPYNASNVAGFLRPDIGGCWRKLGLITGAWSVVLNPLVTGYLGGGTGRVTSVARTKGGTSQK*
823 >lcl|XP_866480.2|Plus1complement(27538087..27538608) NW_876284 protein tyrosine phosphatase type IVA 1-like isoform 2 LOC486655 __SEG__ Chr27 {Canis lupus familiaris} MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIRVLDWPFDDGAPPSNQIVDDWVSLVKIKFREEPGCCIAAHCVAGLGR
APVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMWLRFQDSNGHRNNCCIQ*
824 >lcl|XP_867530.2|Plus148551858..48552937 NW_876259 protein mab-21-like 2 isoform 2 MAB21L2 __SEG__ Chr15 {Canis lupus familiaris} MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTG
KQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALESAAKQTWRLAREILTNPKSLDKL*
825 >lcl|XP_867980.1|Plus1complement(35260311..35261042) NW_876276 proline-rich protein 23A-like LOC611131 __SEG__ Chr23 {Canis lupus familiaris} MGSRPRSPSAHPEPCWGPPRGGPGPAKRRRTPEPEGPQGMEGPPAAGALASVVVLAAGSALQLLLDDVDLVLEPEPTSVLQVSLGGLTLLLVPEALLRAGGQGHPPAGPE
QGAVPSAPGHQAAGPHEALCASVPDVAAQEEACAEDADPELPPPRAGPTAGWAPELRACAGGVAGPRPRPRAPGPGPKRLSPLRYFDLDPHLLEPFPGSPLQPLPPSPSP
GPHVRPQRPPGPSPKARRRLFQE*