SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau T    

ID / Description / Sequence
1 >lcl|NP_001001174.2|Plus1427317..428336 NW_001493748 purinergic receptor P2Y12 P2RY12 __SEG__ Chr1 {Bos taurus} MDNLTSVAGNSSQCSRDYKITQVLFPLLYTVLFFVGLITNSLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDTKLGTGPLRAFVCQVTSVVFYFTMYISIS
FLGLITIDRYQKTTRPFKTANPNNLLGAKILSVVIWAFMFLISLPNMILTNRRPSDKTVKKCSFLKSEFGLVWHEIVNYVCQVIFWINFLIVIVCYTLITKELYKSYVRT
RGAGKVPKKKVNIKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFKNSLMSMLRCSNSTSPPSHDNRKKGQDG
SDPSEETPM*
2 >lcl|NP_001007077.1|Plus1complement(345292..346413) NW_001494724 relaxin 3 receptor 2 RXFP4 __SEG__ Chr3 {Bos taurus} MPTPNTSAPLPAFWVNASGGSVLSAADATMPVGFLALRVSVALAYGLVGAVGLLGNSAVLWVLGNCAQRAPCPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGG
ALCKMVLTATVLNIYASIFLITALSVARYWVVAMAAGPGTHLSLFWARVATLAMWVAASLVTVPTAVFGAEGEVSGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLSIIT
TSYLLLLAFLRRRRRRWRDSRGVAHSIHILLASFFLCWFPNHVVTLWGVLVKFDLVPWDSTFYTVHTYVFPVTTCLAHTNSCLNPVLYCLLRQEPRRALADTFRDL*ARL
WPQGRGWVEQVALKEMGRRWTESTPQEGGLSTMLTNLDKGNPG*
3 >lcl|NP_001011672.2|Plus1complement(163313..164371) NW_001494127 C-C chemokine receptor type 5 CCR5 __SEG__ Chr22 {Bos taurus} MDYQTSTPLYDIDYGMSEPCQKLNVRQIAARLLPPLYSLVFIFGFVGNMLVVLILINCKKLKSMTDIYLLNLAISDLLFIITIPFWAHYAADQWVFGNTMCQLFTGFYFI
GYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGAATSVVTWVVAVFASLPGIIFTKSQKEGSRHTCSPHFPSSQYHFWKNFQTLKIVILGLVLPLLVMIVCYSGIIKT
LLRCRNEKKKHKAVRLIFVIMIVYFLFWAPYNIVLLLSTFQEFFGLNNCSGSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLRFFRKYFASRFCKGCPVFQGE
APERVSSVYTRSTGEQEISVGL*
4 >lcl|NP_001011673.1|Plus1complement(60479..61582) NW_001508781 C-X-C chemokine receptor type 3 CXCR3 __SEG__ ChrX {Bos taurus} ALPPQMSERQEFQASDFAYLLENSSYDYGENETYFCCTSPPCPQDFSLNFDRTFLPVLYSLLFVLGLLGNGIVAVVLLSQRAALSSTDTFLLHLAVADALLVLTLPLWAV
DAAIQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLSIVHATQLYRRGPPTRVALTCVAVWGLCLLFALPDFIFLSSHHDNRLNATHCQYNFPQEGHTALRILQLV
AGFLLPLLVMAYCYARILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDTLMDLGALARNCGRESSVDIAKSVTSGMGYMHCCLNPLLYAFVGVKFRERMWV
LLVRLGCPDQRCHQRQPSASRRESSWSETTEASYSGL*
5 >lcl|NP_001014859.1|Plus1complement(508159..509181) NW_001494127 G protein-coupled receptor TYMSTR CXCR6 __SEG__ Chr22 {Bos taurus} MAEYNYEDLGFFNGSNDSSQGHQDFLRFSKFFLPCMYVVVFTCGLVGNSLVLVIYVFYQKLKSLTDVFLMNLPLADLVFVCTLPFWAYAGIHEWVFGNVMCKALLGIYTL
NFYTSMLVLTCITVDRFVAVVRATKAYNQQAKRMAWGKAICSSIWVVSLLVSLPQIIYGNVLYHDKPFCGYHEAISTMVLAIQMTLGFFLPLLAMILCYSVIIKTLLQAR
GFRKHKSLKIIFLVVAVFLLTQTPFNLVKLIRSTSWEYHTMTSFDYAITVTEAIAYLRACLNPVLYAFVGLKFRKNFWKLVKDAGCLPYLGVSGQHMYSEDTSRSASASH
NVEATSMFHL*
6 >lcl|NP_001014962.1|Plus1complement(1107977..1109104) NW_001494757 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr3 {Bos taurus} MSQPKRRKLESGGGGEGGEGTEEEDGGELEVAVPRPRRTRRERDQLYYQCYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGCGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLELRLSFWSQMKQLYGVDMS
CLESFATRCLMGHSEIVVQGLSGEDVLARPQCFARLELARAGLEQELEAGVGGRFRFSCYGSAPMHGFAIWFQVTFPGGDSEKPVVLSTSPFHPVTHWKQALLYLNEPVQ
VEQDTDVSGEITLLPSQDHHRHLRVLLRYKVGDQEEKTKDFAMED*
7 >lcl|NP_001015542.1|Plus12187830..2188807 NW_001494248 melanocortin receptor 5 MC5R __SEG__ Chr24 {Bos taurus} MNSSFHLHFLDLGLNTTDGNLSGLSVQNASSLCEDMGIAVEVFLALGLISLLENILVIGAIVRNRNLHTPMYFFVGSLAVADMLVSLSNSWETITIYLLTNKHLVMADAS
VRHLDNVFDSMICISVVASMCSLLAIAVDRYVTIFCALRYQRIMTGRRSGAIIGGIWAFCASCGTVFIVYYESTYVVICLIAMFLTMLLLMASLYTHMFLLARTHIRRIA
TLPGHSSVRQRTGVKGAITLAMLLGVFIVCWAPFFLHLILMISCPHNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQEMRKTFKEIVCFQSFRTPCRFPSRY*
8 >lcl|NP_001015578.1|Plus1complement(5603..6004) NW_001494538 EH domain-containing protein 1 EHD1 __SEG__ Chr29 {Bos taurus} MFSWVSKDARRKKEPELFQTVSEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVP
GNALVVDPRRPFRKLNAFGNAFLN
9 >lcl|NP_001015581.1|Plus12041066..2042220 NW_001494083 chemokine binding protein 2 CCBP2 __SEG__ Chr22 {Bos taurus} MATTASPLPPTTKVASSENSSSFYDYEYYLEDMIFMLCRKDEVLSFGRVFLPVFYSLIFVLGLVGNLLLLAVLLRFVPRRRMTETYLLNLAISNLLFVVTLPFWGISVAW
HWVFGSVLCKVVSTLYTVNFYSGIFFISCMSLDKYLEIVCARPYHRLRTRAKSLLLAASVWAMALAVSIPDMVFVRTHENSPGVWECYADFGGHGTIWKLFLRFQQNLLG
FLLPLLAMIFFYSRIGSVLVSLRPPGQRRALRMAVALVVAFFVLWFPYNLTLFLHSLLDLQVFGDCRVSQHLDYALQVTESIAFLHCCFTPVLYAFSSHRFRQYLKAFLA
TVLRRQQALPSSYSESSGLTVQEDVMGMSDLGERPAESSPTRLSISSGLLILDS*
10 >lcl|NP_001015604.1|Plus1complement(917543..918664) NW_001508802 probable G-protein coupled receptor 173 GPR173 __SEG__ ChrX {Bos taurus} MANTTGEPEEVSGALSPPSAVAYVKLVLLGLIMCVSLAGNAILSLLVLKDRALHKAPYYFLLDLCLADGIRSAVCFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHA
AFMLFCISVTRYMAIAHHRFYAKRMTLWTCAAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLFEYRHRKMKPV
QMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRVFVKACAVPHRYLATAVWMSF
AQAAVNPIVCFLLNKDLKKCLRTHAPCWGTGGAPAPREPYCVM*
11 >lcl|NP_001019674.1|Plus1649359..650855 NW_001492996 zinc finger and BTB domain containing 43 ZBTB43 __SEG__ Chr11 {Bos taurus} MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCDQVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFL
QMWHVVDKCTEVLEGNPTVLCQKLNHGSDHQSPSSSNYNGLVESFELGSGGHTDFPKAQELRDGENEEESTKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGAS
DSAEFHYTRPMYSKPSIMAHKRWIHVKPERFEQACEGMDVHAPYDEHQVTESINTVQTEYSVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSMEEFSGERS
DGNLIWHKQEAALASGYSENIEMVTGIKEEASHLGFSATDKLYLCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWR
DSFHRHVTSCTKSYEAAKAEQNTTEACTKSYEAAKAEQNTTETCTKSYEAAKAEQNTT*
12 >lcl|NP_001025471.1|Plus1complement(202749..203861) NW_001494378 prolactin-releasing peptide receptor PRLHR __SEG__ Chr26 {Bos taurus} MASLPTQGPAAPDFFNGLLPASSSPVNQSSETVVGNGSAAGPGSQAITPFQSLQLVHQLKGLIVLLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMC
TACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRFSAYAVLAIWALSAVLALPAALHTYHVELKPHRVRLCEEFWGSQER
QRQLYAWGLLLVTYLLPLLVILLSYVRVSVNLRNRVVPGCVTQSQADWDRARRRRTFCLLVVVVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACY
NPFIYAWLHDSFREELRKLLLAWPRKIAPHGQSMTVSVVI*
13 >lcl|NP_001025492.1|Plus1940215..941387 NW_001494047 somatostatin receptor 1 SSTR1 __SEG__ Chr21 {Bos taurus} MFPNGTASSPSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSV
PFLVTSTLLRHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLV
GFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVILGYANSCANPILYGFLSDNFK
RSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL*
14 >lcl|NP_001028933.1|Plus160689..63865 NW_001508857 toll-like receptor 7 TLR7 __SEG__ ChrX {Bos taurus} MGDLFLYFQVFPMWTLKRQFPILFNMILISGLLGARWFPKTLPCDVTLDAPNTHVIVDCTDKHLTEIPGGIPANATNLTLTINHIAGISPASFHRLDHLVEIDFRCNCVP
VRLGPKDNVCTKRLQIKPNSFSKLTYLKSLYLDGNQLLEIPQDLPPSLQLLSLEANNIFLIMKENLTELANLEILYLGQNCYYRNPCNVSFTIEKDAFLNMRNLKLLSLK
DNNISAVPTVLPSSLTELYLYNNIITKIQEDDFNNLSQLQVLDLSGNCPRCYNVPFPCTPCENNSPLQIDPNAFDALTELQVLRLHSNSLQHVPQRWFKNINKLKELDLS
QNFLAKEIGDAKFLHLLHNLVNLDLSFNYDLQVYHAVINLSDAFSSLKKLKVLRIKGYVFKELNSLNLFPLHNLPNLEVLDLGTNFIKIANLSIFNQFKTLKFIDLSVNK
ISPSGDSPEGGFCSNRRTSVEGHGPQVLETLHYFRYDEYARSCRSKSKEPPSFLPLNEDCYMYGQTLDLSRNNIFFIKPSDFQHLSFLKCLNLSGNSISQTLNGSEFQPL
VELKYLDFSNNRLDLLYSTAFEELHNLEVLDISSNSHYFQSEGITHMLNFTKNLKVLRKLMMNYNDIATSTSRTMESESLQILEFRGNHLDILWRDGDNRYLKFFKNLLN
LEELDISENSLSFLPLGVFDSMPPNLKTLSLAKNGLKSFSWERLQSLKNLETLDLSFNQLKTVPERLSNCSRSLKKLILKNNQIRCLTKYFLQGAFQLRHLDLSSNKIQV
IQKTSFPENVLNNLNILFLHHNRFLCNCDAVWFVWWVNHTEVTIPYLATDVTCMGPGAHKGQSVVSLDLYTCELDLTNFILFSLSISAVLSLMMITIANHLYFWDVWYSY
HFCKAKIKGYRRLISPNSCYDAFIVYDTKDPAVTEWVLDELVAKLEDPREKCFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDE
KVDVIILIFLEKPLQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVTYSQVFKETA*
15 >lcl|NP_001029476.1|Plus11288032..1289135 NW_001494990 lysophosphatidic acid receptor 5 LPAR5 __SEG__ Chr5 {Bos taurus} MQANSSAKSLPTECPDYQPIHHLHLVVYSVVLAAGLPLNALALWVFLRALRVHSVVSVYMCNLAASDLLFTLSLPLRLSYYARHYWPFPDFLCQLAGAVFQMNMYGSCIF
LTLINVDRYAAIVHPLRLRHLRRPRVARLLCLGVWALILVFAVPTILAHQPSSCARDGRNVSLCFESFSDKLWKGSLLPLLLLAEALGFLLPLAAVVYSSGRVFWTLARP
DATRSQRRRKTVRLLLASLVIFLLCFVPYNATLAVYGLLRGEVVPASSEARKKVRGVLMVMVLLAGANCVLDPLVYYFSAEGFRNTLRGLRAPLRDRTLAANGAQEALAE
PLTETAHASTLTTTSQGQLQPSDPRSSFTPSHEDSSF*
16 >lcl|NP_001029524.1|Plus1complement(2045703..2046110) NW_001494731 bolA-like protein 1 BOLA1 __SEG__ Chr3 {Bos taurus} MLSGQLVVRLFSMASRVCMSRGSAGSGVIGPVEAAIRTKLEQALNPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALSEELAGPVHALAIQART
PAQWKENPQLDTSPACLGGSKKSRN*
17 >lcl|NP_001029532.1|Plus11034001..1034279 NW_001494724 dolichyl-phosphate mannosyltransferase polypeptide 3 DPM3 __SEG__ Chr3 {Bos taurus} MTKLAQWLWALALLGSTWAALTMGALGLELPSSCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLTRRGLRF*
18 >lcl|NP_001029861.1|Plus1complement(718983..719981) NW_001493084 N-arachidonyl glycine receptor GPR18 __SEG__ Chr12 {Bos taurus} MTTPHSQAQPGLPIDPHPDEYKVAALVFYSCIFIIGLFVNVTALWVFSCTTKKRTTVTVYMMNVALLDLVFIMSLPFRMLYYAKGEWPFGEYFCRILGALTVFYPSIALW
LLAFISADRYMAIVQPKYAKELKNTCKAVMACVGVWIMTLTTTIPLLLLYEDPDTASSTPPTCLKISDIIYLKAINALNFTRLIFFFLIPLFIMIGCYLVIIHSLLHGKT
SKLKPKVKEKSIRIIITLMVQVLVCFMPFHICFAFLMLGGDENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSVRRKSFRSGSLRSLSNINSE
ML*
19 >lcl|NP_001029910.1|Plus1complement(826197..827246) NW_001492799 leukotriene B4 receptor 1 LTB4R __SEG__ Chr10 {Bos taurus} MNTTSPAAPSSSGVSFISLLVIIVLSVALAVGLPGNSFVVWSILAKLRKRSVTALMVLHLALADLAVLLTAPFFLYSVAQGTWTFGLSSCRLFHYVCGVSMYASVLLIMT
MSLDRSLAVALPFVSQKLRTKAVAWRVLAGIWVMSVLLATPVLLYRTVHLGLNNRSLTCFLKYPSERHRAFHLFFEVITGFLLPFLVVVASYCDIGRRLRARRFRRSRRT
GRLVALIILAFAAFWLPYHVVNLAEGFRAAAGKALGSGPVGRRLLLARHVLITLAFLSSSVNPLLYACAGGGLLRSAGVGFIAKLLEGTGSETSSSRRKGTLAQTLRGTP
ASPEPDPAESLTASTNPLE*
20 >lcl|NP_001030576.1|Plus1complement(2376461..2377402) NW_001495423 ras-related GTP-binding protein A RRAGA __SEG__ Chr8 {Bos taurus} MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCL
EAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCK
EQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR*
21 >lcl|NP_001033642.1|Plus1127639..128691 NW_001494704 progestin and adipoQ receptor family member VII PAQR7 __SEG__ Chr2 {Bos taurus} MATIVAQKLSHLLPSLRQVHQEPQPSVPSEPVFTVDRAEVPPLFWKPYIYVGYRPLHRTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFVGTVDFWGDPHALPLF
IIVLASFTYLSLSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQTIFLPTAAFLAWLSCTGSCYNKYIQKPGLLGRTCQEVPSALAYALDI
SPVAHRILVSPDPATDDPALLYHKCQVVFFLLAAAFFSAFMPERWFPGCCHVFGQGHQLFHVFLVLCTLAQLEAVALDYEARRSIYEPLHTRWPHNFSGLFLLTVGSSIL
TAFLLSQLVRRKLDLHRKTQ*
22 >lcl|NP_001033657.1|Plus1255883..257073 NW_001495013 G-protein coupled receptor 84 GPR84 __SEG__ Chr5 {Bos taurus} MWNASDVNFSCYHESVLGYRYVAVSWGIVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTVADLLYCTLLQPFSVDTYLHLHWRTGATFCQIFGFLLFVSNSVSILT
LCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVAVASFAPLWPIYILVPVVCTCSFDRIRGQPYTTILMGIYFVVGLSSVGVFYCLIHQQVKRAAQAMNQYKLRQA
SIRSNHVAGAHEAVPGRFQELDSGLASGGPSEGISSEPVSAATTQTLEGDSSEVRDQSNSKAAKQMAEKNPPGVAAKARTTKGAQRAQDSPSEFGKVTRMCFAVFLCFTL
SYIPFLLLNILDAKVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSLLRRGPQSFHRFH*
23 >lcl|NP_001033660.1|Plus1complement(1030106..1031461) NW_001494746 G protein-coupled receptor 61 GPR61 __SEG__ Chr3 {Bos taurus} MESSPIPQSSGNSSTLGRAPQTPGPSTASGVPEAGLRDVASESVALFFMLLLDLTAVAGNAAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHDLF
GEVACRLYLFLSICFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVGVWVKALAMASVPVLGRVSREEGAPGVPLGCSLQWSHSAYCQLFVVVFAVLYFLLP
LLLILVVYCSMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSAQPVSTGQVENVVTWIG
YFCFTSNPFFYGCLNRQIRGELSKQFVCFFKQAPEEELRLPSREGSIEENFLQFLQSTGCPTESWASRPVPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSY
LRPAPSPRLES*
24 >lcl|NP_001035574.1|Plus1complement(533808..534962) NW_001493691 urotensin II receptor UTS2R __SEG__ Chr19 {Bos taurus} MALSPEPSSRFLVPATMGSAMPELPGAPNASLNSSLASPTEPNSLEDLVATGTIGVVLSAMGVVGMAGNVYTLTVMCRFLHTSASMYVYVINLALADLLYLLSIPFIVAT
YVTKRWHFGDVGCRVLFSLDFLTMHASIFTLTLMSRERYAAVVRPLDTVQRSKGYRKVLALGTWLLALLLALPMMLAIRLVRRGHKSLCLPAWGQRTHRAYLTLLFGTSI
VGPGVVIGLLYVRLARAYWLSQRASFTQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYRGAPPLAPRSARIVNYLTTCLTYGNSCVNPFLYTLLTKNYRDYRQR
SLHSRGTSGPVGVRSFPQGHTRCQLGSGRSVTSSSQQATETIALSQAVPGSLCV*
25 >lcl|NP_001035591.1|Plus1complement(1053123..1055699) NW_001493403 Toll-like receptor 5 TLR5 __SEG__ Chr16 {Bos taurus} MGDCLDLLLGVVLLTSPALGMSSCFFDGWRAIYLSCNLTQVPQVPNTTKSLLLSFNYIRTVTTASFPFLEQLQLLELGTQFTPLTIYREAFRNLPNLRILDLGGSQINFL
HPDAFQGLPHLTKLRLFSCGLSDAVLKDGYFRNLASLTHLDLSKNKIQSLYLHPSFRELNSLKSIDFSFNKIPIVCEQEFKPLQGKTLSFLSLADNQLYSRVSVDWNKCL
NPFRNMVLETLDVSGNGWGVDIMRNFSNAINGSQIFSLVLTRHIMGSSFGFSNLKDPDYHTFAGLARSSMIQLDISHGYIFSLNFRIFETLQELKVLNLAYNKINSISRN
AFYGLDNLQVLNISYNLLGELYNYDFDGLPKVAYIDLQKNHIGIIQDKTFKFLGKLNTLDLRDNALKTIYFLPSIPNIFLSGNKLMTLPNIPLTANFIQLSENRLENLND
LYFLLQVPHLQILILNQNRFSFCHQNHAPSENSSLEKLFLGENMLQLAWETGSCWDIFKGLSHLQLLYLNKNYLNFLPPGVFHHLTALRGLSLKDNRLTVLFPGDLPANL
EILDISGNQLLSPDPDLFASLSAIDITHNNFICECELSAFIHWLNQTNITIAGSPADMYCMYPNSLAGVSIYSLSTESCEEEEVLESLKFSLFILVTVTLTLFLVITLAV
TKFRGFCFICYKKAQSLLFKDPIKGRESDTYKYDAYLCFSSKDFEWVQNALLKHLDVQYHSQNRFNLCFEERDFMPGENHIANIQDAVWSSRKIVCLVSRHFLRDGWCLE
AFSYAQSRCLADLNGALIMVVVGSLSQFHLMRHQSIRGFVQKRQYLRWPEDLQDVDWFLNKLSQCILKKEKERKKDSAIQLQNVTTIS*
26 >lcl|NP_001035628.1|Plus11521577..1522605 NW_001494698 platelet-activating factor receptor PTAFR __SEG__ Chr2 {Bos taurus} MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLTMADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAV
ITYNRFQAVTRPIKTAQATTRKRGILLSLIIWVSIVGAASYFFVLDSTNREPNKTGSANITRCFEHYEKGSIPVLTIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQI
QRNAEVKRRALWMVCTVLAVFIICFVPHHLVQLPWTLAELGFQDTDFHQAINDAHQVTLCLLSTNCVLDPIIYCFLTKKFRKHLTEKLYSMRESRKCSRATSETGTEVVM
QLKDVPVKSLKY*
27 >lcl|NP_001035634.1|Plus1complement(87509..88852) NW_001494071 BAG family molecular chaperone regulator 5 BAG5 __SEG__ Chr21 {Bos taurus} MEMGNQHPSISRLQEIQKEVKSIEQQVLGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNANHPHRLEIQNIFQEAQALVKEKVV
PFYNGGNCVTDEFEEGIQDVILRLTHVKTGGKVSLRKARYHTLTKICAVQEIIENCMKKQPSLPLSEDAHPSVAKINSVMCEVNKTRGTLIALLMGVNNKETCRHLSCVL
SGLMADLDALDVCGHTEIRNYRKEVVEDINQLLRYLDLEEEADTTHAFDLGQNHSILKIEKVLKRMREIKTELLQAQNPPELYLSAKTELQGLIGQLDEVSLEKNPCIRE
ARRRAVIEVQTLITYIDLKEALEKRKLLACEEHPSHKAVWDVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVKLAQNILSYLDL
KSDEWEY*
28 >lcl|NP_001039647.1|Plus1complement(1748073..1749683) NW_001492919 suppressor of cytokine signaling 5 SOCS5 __SEG__ Chr11 {Bos taurus} MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISLGDSAPQQQSSPLRENVALQLGLSPSKNSSRRNQNCAAEIPQIVEISIEKDNDSCVTPGTRLAR
RDSYSRHAPWGGKKKHSCSTKTQSSLDTDKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPF
PAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEVNGDSCAVPQANCDSEEDTTT
LCLQSRRQKQRQVSGDSHAHVSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFD
AHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK*
29 >lcl|NP_001039897.1|Plus11312242..1313327 NW_001494496 coiled-coil domain-containing protein 89 CCDC89 __SEG__ Chr29 {Bos taurus} MDTPSSEEPLDKQNRKLEDQEEEMGFKELDGLREALANLRGLSEEDKSERAMLCSRIQEQSQLICILKRRSDEALERCQTLELLNTELEEKRLLEAEELKAKNQQAQKLE
ERFMTLASNHELMIRFKDEHKRQNAKLREENEKLRLENDQLFSPALKAQEAKVVQLTAQSEALAKELETLQRKYAHDVCQAQAREQELLELQNRQACAHTEETEQLRMQL
QSLQQQQQEALQQTAKAEQAHSQQNQELRARLQTVTREKEELLLLSMERGRVLQNKQAEIRQLEEKLKMADVARRHALERFEQEAVAVNSNLRVRELQRRVDGIQAAYDE
LRLQSEAFKKHSLDLLSKERELNAKLRHLFP*
30 >lcl|NP_001039937.1|Plus1complement(766580..767662) NW_001493084 G-protein coupled receptor 183 GPR183 __SEG__ Chr12 {Bos taurus} MDIKMDNFTTPSAASLESDCDLYAHHHTARILMPLHYSIVFIIGLVGNLLALIVIIQNRKKINSTTLYSTNLVISDILFTTALPTRIAYYALGFDWRIGDALCRITALVF
YINTYAGVNFMTCLSIDRFFAVVHPLRYNKIKRIEHAKCICIFVWILVFGQTLPLLINPMSKQEAERTTCMEYPNFEETKSLPWILLGACFIGYVLPLVIILICYSQICC
KLFKTAKQNPLTEKSGVNKKALNTIIFIIVVFVVCFTPYHVAIIQHMIKKLRLPGLLECSQRHSFQISLHFTVCLMNFNCCMDPFIYFFACKGYKRKVMKMLKRQVSVSI
SSAVRSAPEENSREMTETQMMIHSKSLNGK*
31 >lcl|NP_001039969.1|Plus1complement(874348..876531) NW_001495180 toll-like receptor 1 TLR1 __SEG__ Chr6 {Bos taurus} MPDILSLSKLKILIISHNRIQYLDLSVFKFNQELEYLDLSHNNLEKISCHPTLNLKHLDLSFNPFDALPICQEFGNMSQLEFLGLSATQLQKSSVQSITHLHISKVLLVL
GDTYGEREDAESLQDLKTQSLHIVFPTGKEFHFILDVSVGTTVSLELSNIKCVLDDNGCPYFENVLSKLQKNSRLSNLTLNNIEITWNSFFTILQLVWRTNIEYFSISNV
KLQGYLDSRDFDYSDTSLKALSIHKVVHDVFSLPQGYVYKILSNMNIQHLTVSAAHMVHMVCPSQISPFLYLNFSNNLLTDTVFINCTNLANLKTLILQKNQLKELVNIV
HMTQEMKSLQQLDVSQNSLMYDESEGNCPWARNLLSLNMSSNILTDSVFRCLPPQIKVLDLHNNRIRSIPKDVTGLETLQELNLASNSLAHLPGCGIFSSLSILIIDYNS
ISNPSADFFQSCQKIRSLKAGNNPFQCSCELRDFIQSIGQVSSDVVEGWPESYKCDYPESYKGTPLKDFQVSELSCNTALLIITIVVPGLVLAVAVTVLCIYLDLPWYLR
MVCQWTQTRRRARNVPLEELQRTLQFHAFISYSGHDSAWVKNELIPNLEKEDIRICLHERNFVAGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFHE
GSDNLILILLDPIPQYSIPSSYHKLRALMAQRTYLEWPKEKSKHGLFWANLRASINIKLMEKAAEIH*
32 >lcl|NP_001068918.1|Plus1272994..273923 NW_001493367 olfactory receptor, family 4, subfamily X, member 1 OR4X1 __SEG__ Chr15 {Bos taurus} MAATSNVTEIIFLGFSQNQGAQKVISVLFLLLYVAILLGNGLIVVTIMAGKGLTSPMYLFLSYLSFAEICYCSVTAPKLILDSFMERKVISLKGCITQIFFLHFFGGTEI
FLLTLMAYDRYVAICKPLHYTVVMNQRACGLLVGAAWGGGLLHSVGQTVLIFQLPLCGPKVLDHYFCDVHPVLKLACSDTFLISVLIITNGGSISVVSFTGLLASYVVIL
RSLRTQTSEGRRKALSTCASHLAVVALFFVPCSFVYMRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVQNALRRLMGRKGSWEEK*
33 >lcl|NP_001069051.1|Plus1complement(3648697..3649785) NW_001493616 G-protein coupled receptor 4 GPR4 __SEG__ Chr18 {Bos taurus} MGNRTLEGCHVDSRMDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQRNELGVYLMNLSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCC
ISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKV
KIKRLALSLIAIVLVCFAPYHVLLLSRSAVYLRRPRDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKALHHLLRFLASDKPQEMANASLTLETPLTSK
RISMAKAMAAGWVAAPLAQGDQVQLKMLPPAQ*
34 >lcl|NP_001069200.1|Plus1complement(132072..133118) NW_001494127 chemokine (C-C motif) receptor-like 2 CCRL2 __SEG__ Chr22 {Bos taurus} MANYTPAPEDDYDVFIEDDLSDDEIEPCTPYDPKILSAQLVPYLYTTVFMVGLLDNILVVFILVKYKGLRQAENMSFLNLALSNLGFLLTLPFWAYAASHGEGFDDPLCK
ILLLLYSIGLYSEAFFNVLLTVQRYKEFFHVRRRFSACRTVAGSIFISVLVWVTATLVTLPELVSYKPQMQSQKYKCFFTGLHFLPADETFWKHFLTLKMNILGFLLPLF
AFVYCYVRMRKTLQFRERNYGLFKLVFTIMAVFLLMWGPYNIVLFLSAFNEHFSLHGCGSSYNLNKSVQITRIIAATHCCVNPLLYVFLDKAFRKHLCHLFYLCSDTAPQ
PTEEPAQGASGEEYHLSS*
35 >lcl|NP_001069389.1|Plus1337007..338092 NW_001494127 C-C chemokine receptor type 1-like LOC529196 __SEG__ Chr22 {Bos taurus} METSTTAKDYDMTTEYDYGDTTPCQKAQERAFGAQLLPLLYSVVFVIGLVGNILVVLVLYKRIKNIINICLLNLAISDLIFLFTLPFWIDYKVKDDWIFGDAMCKLLFGF
FFLGLYSKIFFIILLTIDRYLTNVHPQFKRQCWNITSGTVTSIVVWVLAILASVPGLYFSKTQWWLTHYTCSLHFPPESHGRKWKQFLALKLNILGLILPLLVMTVCYGH
IKIIKIMLRTWNKKANIIRLIFVIMITFFLFWTPCNLTVFVSAFQDSLCEHCSQLDLAIEVTEAIAYAHCCMNPIVYVLFCRRYRRVLWYLLYQLTKCRCFLYEEAGEGQ
LHVHYTGKEERCSVYRLRPLRSIRDKETISC*
36 >lcl|NP_001069431.1|Plus1complement(1822521..1824338) NW_001494275 insulin-like growth factor binding protein, acid labile subunit IGFALS __SEG__ Chr25 {Bos taurus} PLPAGVPALVVLLVSWAALGPHGLEGVEPVAPADPEGLQCPAVCSCGHDDFTDELSVFCSSRNLTQLPGGLPPGTRALWLDGNNFSSIPAAAFRNLSGLGFLNLQGSGLA
SLEPQALLGLRGLCHLHLEHNRLHALAAHTFLHTPGLASLGLSNNLLSRLDEGLFRGLAHLWDLNLGWNSLTVLPDTAFQGLAGLRELVLAGNKLAYLQPALFCGLGELR
ELDLSRNTLRSVKANVFVKLPKLQKLYLDHNLVAAVAPGAFLGMKALRWLDLSHNRVGSLLEDSFPGLLGLHVLRLSHNALAGLRPRTFKDLHFLEELQLGHNRLRQLPE
EAFAGLGQLEVLALNDNQLQELRPGGFLGLRNLAVLNLSSNCLRDLPERAFQGLAKLHSLHLEGGCLARLGPLAFAGLSGLRRLFLKGNSIADVDERSLGGLAELLELDL
TANQLTHLPGRLFQDLGRLEYLLLARNRLSALPADALGPLQRTFWLDVSHNRLEALPAAALAPLSRLRFLSLRNNSLRTFAPQPPGLERLWLEGNPWDCSCALGALRAFA
LQQPASVPRFVQALAEGNDDRQPPVLAYNNITCASPPSLAGLDLRDVGEAHFAHC*
37 >lcl|NP_001069615.1|Plus1complement(232166..233113) NW_001493070 protein sprouty homolog 2 SPRY2 __SEG__ Chr12 {Bos taurus} MEARAQSGSGSQPLLQAPRDSGRQRGEPDPRDALPQQVHVLSLDQIRAIRNTNEYTEGPTVLPRAGLKPAPRPTAQHKHERLHGLPEPRQPSRPQHPPAHPSARASLARS
ISTVSSGSRSSTRTSTSSSSSEQRLLGSSFSSGPLADRIIRVQPKSELKPGELKPLSKEDVGLHAYKCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVC
CVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT*
38 >lcl|NP_001069661.1|Plus11296269..1298158 NW_001493403 hypothetical protein LOC539906 C16H1ORF65 __SEG__ Chr16 {Bos taurus} MEDFGRFSPRPHSAVWEPPPPSEESASLAQLDGSGPRAEPGLCSWAQTPGEESEATAPWPHLLCSATPRPSRRPYSDSPQESRSLTDVARRFLDRARKPRPRSRRLEDAW
GEARTKPQEQGGSGHSPAWQLEPEPQHSQHYPPARGDSPPPYSQGAHTPANRAFEEEKAQSGDQWAVPVCRGLRPWSLSSVHTEKSSVSSREFGTQSGCMHIQKRHSNDP
VESLTSQLSQSLVSSKEMQKQHTQVLKNKLEEAVVSSRDQKIVALVLSRLKKAQRMRELQQQAALAWEELKRSDQKVQLTLERERKLLLQQSQEQWQQDKEQRKARLNRE
LRVRRRDRRATNMIQQDSSGWKAPLEDQEKQRQEKLEGAPSEPETEPEKQCQVQRLPERMLRDLQARNSLQLQKRLAQACLKKHVHPTKGQKKIQETSLSSLVNYQARKV
LMDCQAKAEELLRKLSLEQSSQWSQERPEGHTKEPDRELKDKVQKEEERFQQVKRWAEESQKQRKEHKSLLEELADQKTLQTQSQVHKNVRDKAHHIRELNILREKNHHI
LKLKAEKEERCHIEGIKEAIRRQEQRMEQILREKDATFEEFQKISRTSGTDDVRTLANNFFDRMAREAQVPAGQQRGGY*
39 >lcl|NP_001069686.1|Plus1440873..442195 NW_001492850 suppressor of cytokine signaling 4 SOCS4 __SEG__ Chr10 {Bos taurus} MAENSESNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVSAIEKTEVPLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSS
RHSSGLPSKRKIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLSQSELRDGQLKQRRNMEEVSCFSHTSVQPCVITSNNSSGRGGPGTDSIVNLASN
NSIEDSDMDSDDEIITLCTSSRKRNKPKWEIDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRS
LHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSKVRVLRIDAPEQQC
*
40 >lcl|NP_001069899.1|Plus11566952..1567596 NW_001494961 leucine-rich repeat-containing protein 61 LRRC61 __SEG__ Chr4 {Bos taurus} MEPRGEKSGEADGVRVTPQLLKARSGEFALESILLLKLRGLGLVGLGCLGDCLGLEWLDLSGNALTQLGPLASLRQLAVLNVADNRLTGLEPLAACENLQCLNAAGNLLA
GPAQLQCLAGLRGLERLRLRDPLARLSNPLCASPCYWASVRELLPGLKVLDGERVSGRGSDFYQLCRDLDSSLSPDPGAPGPRPMEAQPWVEPGYWEALPPRSSS
41 >lcl|NP_001070386.1|Plus1complement(857854..860292) NW_001495180 Toll-like receptor 10 precursor TLR10 __SEG__ Chr6 {Bos taurus} MRYIRSIYIFCSIVTSVRSGASELPEERELTTNFSSMSLTKVPEGLTPITTTLDLSYNLLFQLQHSDFRSLSKLKVLILCHNRIQELDIKTFEFNKELSYLDVSNNRLKS
VTWFSLAGLRHLDLSFNDFDTLPISVETGNMSHLETLGLSGAKIQKSDFQKIAHLQLNTVLLGLRTLSHYEEGSLPILNTTRLHIVLPVNTNFWVLLHDGIKTSKILEVI
NIDLQKSQFTSYESQQIPILENAKTSILLLNKVDLSWDDLFLIFQLVWHTSVEYFQIQHVTFGGKVYLDHNSFDYSNTVMRTIKLEHVHFRIFNIPQESIYLLFTKMDIE
NLTISDAQMPHMLFPMYPTRFQYLNFANNILTDDVFKKSIQLPHLKTLILKDNKLETLSLVSHFASNTSLRHLDLSENLLQHENDENCLWPETLVTMNLSFNKFADSVFG
CLPRNIQILDLNSNKIQTVPKAITHLTSLRELNLAFNFLTDLPGCSHFRRLLVLNVEMNLILSSSLDFFQSCQEVKTLNAGRNPFRCTCELRDFIQLGKYSEGMMVGWSD
SYICEYPLNLKGTQLKDVHLPEISCNTGLLIVTIVVVMLVLGMAVAFCCLHFDLPWYLRMLHQWTQTWLRVRKTTQEQLKRSVQFHVFISYSEHDSAWVKYELIPSLEKE
DGSVLICLHEGNSDPGKSMTEDTINCIEKSYKSIFVLSPSFVQTEWCHYEPYFAHHNLFHESLDYIILILLEPIPLYCIPTRYPELKALMEKKAYLEWPKDRRKCGLFWA
NLRAALHVNLLDTRGTCELQTFTELNEGFGGSAISLIRTDCL*
42 >lcl|NP_001070424.1|Plus1complement(2239268..2241121) NW_001495421 kelch-like protein 9 KLHL9 __SEG__ Chr8 {Bos taurus} MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGLNTVGLKKIIDVI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
43 >lcl|NP_001070470.1|Plus1580154..581113 NW_001493748 probable G-protein coupled receptor 171 GPR171 __SEG__ Chr1 {Bos taurus} MTNSSTFCPVYRDLEPFTYFFYLVFLIGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVKITVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSI
DRCLQLTYSCKIYRIQEPGFAKMISAVVWLMVLLIMVPNMIIPIKDIKEKPNVGCMEFKSEFGRNWHLLTNFISIAIFFNFSAIILISNCLVIRQLYRNKDNENYPNVKR
ALISILLVTTGYIICFVPYHIVRIPYTLSQTEVISDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKITETFASHKESKAQKEKPRSENNA*
44 >lcl|NP_001070477.1|Plus1560629..561642 NW_001493748 P2Y purinoceptor 14 P2RY14 __SEG__ Chr1 {Bos taurus} MNATSVPPAEGSCPSNALITKQIIPMLYFVVFVAGILLNGMSGWVFFYVPSSKSFIVYLKNIVIADFLMSLTFPFKILGDLGLGLWQVKVFVCRVSAVLFYINMYVSIVF
FGLIGFDRYYKIVKPLLTSFIQSISYSKLLSVLVWSLTLLIALPNMILTNRNVTEATRVKCMDLKSDLGLKWHKASSYIFVGIFWIVFLSLIIFYTAITKKIFKSHFKSR
KNSVSVKKKSSRNIFSIMFVFFICFVPYHIARIPYTQSQTEAHYSCQSKQILFYVKEFSLLLSAANVCLDPIIYFFLCQPFREVLCKKLHIQLKTQHDSETSKIKRENII
QESTDTL*
45 >lcl|NP_001070524.1|Plus1complement(562378..562710) NW_001494727 late cornified envelope-like proline-rich protein 1 LELP1 __SEG__ Chr3 {Bos taurus} MSSDDKNKPGEPKNEPKQCDPGCEQKCETKCQPSCLKRLLQRCSEKCQPPKCPPPKCTPCPPCPPSCPPPPKCPPPCPPPCPPPCPPPCPPKPCVKSCPPKCPPPCPPPE
*
46 >lcl|NP_001070543.1|Plus1131638..132663 NW_001493674 transducer of ERBB2, 1 TOB1 __SEG__ Chr19 {Bos taurus} MQLEIQVALNFIISYLYNKLPRRRVNIFW*RA*KTS*EEI*RALVS*KAIQRIRVLDVYT*GRKWTQ*LNKHPKRAVWTLMMCVAICHRILVFGSTRLRFPTKLVKRDQ*
RCFMWMIIMKMDASWIRRSKTALTQRPRFLCP*VTQPHQCPALHRLPLVTLLP*ALPSCPGPLSL*PSPLPLSLPPSLALPK*RIVAAATRLHVLLLLTSA*M*MTS*SR
KPSLPQCTLCMGLAWVTSSSRSNSSSHLSHHHRRSSSNSRKPLLFLLMPRNLFFLICRVKVVPMECSQVTAPLTSVLSSTVMPLMYLRPMEASTRSLL*MA*ILA*ITCS
ILTSNSSLLWLT
47 >lcl|NP_001071307.1|Plus1362221..363288 NW_001494127 chemokine (C-C motif) receptor 1 CCR1 __SEG__ Chr22 {Bos taurus} METSTTAKDYDMTTEYDYGDTTPCQKAQERAFGAQLLPPLYSVVFVIGLVGNILVVLVLMQYKRLKSMTSIYLLNLAISDLIFLFTLPFWIDYKVKDDWIFGDAMCKLLS
GFYFMGLYSEIFFIILLTIDRYLAIVHAVFALRARTITFGIITSIVVWVLAVLASVPGLYFSKTQWEFTHHTCSIHFPPESFTKWKQFQALKLNIMGLVLPLLVMIVCYT
GIIKILLRRPNEKKAKAVRLIFVIMIIFFLFWTPYNLSVFVAAFQDSLFTRKCEQSRQLDLAIQVTEVIAYTHCCINPVIYVFVGERFRKYLRQLFYRLVAVHLAKWFPF
LSTERLERVSSMSPSTGEHELSAGF*
48 >lcl|NP_001071344.1|Plus1complement(260186..261133) NW_001495313 olfactory receptor, family 10, subfamily H, member 1 OR10H1 __SEG__ Chr7 {Bos taurus} MQGANFSAVTEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATIWREHSLHTPMYLFLCALSISEILYTFAIIPRMLADLLSTDRSISFTACASQMFFSFMFGFT
HSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWAGGSVMGLVVTSAIFHLIFCGPNEVHHFACHVPPLLKLACGTEVQVVAKGVGLVCITALLGCGLLILLSYA
FIVAAILRIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKIAMKKTFLSKLYPEKI*
49 >lcl|NP_001071405.1|Plus1complement(1390219..1392249) NW_001495460 zinc finger and BTB domain containing 5 ZBTB5 __SEG__ Chr8 {Bos taurus} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQSGEEQPAPMSSSLRGNLDQRTPFPMRRLHKRKQSAEERARQRLRPTLDESAISDVTPE
NGPGVHSREEFFSPDSLKIVDNPKADGMADNPDDSTIMFDQSFSAQEDAQVPSQSDNSASNMAQLSMASRATQVETSFEQETTAEKSAFQCENPEVGLGEKEHMRVVVKS
EPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGSNFSTNQNNDDNLPNTTSDCRLE
GEAPYLLSPEAGPASGPSSAPGAHVENPFSEPSDSHFVRPMQDVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMMGSPRGGASNFPYYRRIAPKMPVVTSVRSS
QIPENSASSQLMMNAATSSFENGLPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK
TTCLRWQSSNLPSTLL*
50 >lcl|NP_001071415.1|Plus14813750..4814763 NW_001493616 G protein-coupled receptor 77 GPR77 __SEG__ Chr18 {Bos taurus} MENNSLGNEYGDYSDLPDLPVDCADGSCMSIDLLHATPLLLYAAVFLVGVPGNAMMAWVTWKEARQRVSANWFLQLAVADLLCCLSLPILAVSVAHKGHWLYGAVGCRTL
PSVILLSMYASVLLLATLSTDLCLLALRPIWWGTAGRACRVRAACGACWGLALLLTVPSAIYRRLHQEHFPHRLECVVDYGGSTVAENSVTATRFIFGFLGPLVVVVVCH
SALLCRATQRRWPLGLAVVVGFFVCWAPYHALGLVLTMAAPHSTLLAQALRAEPLVVGLALAHSCLNPMLFLYFGQAQLRQSLPAACRWALKEPQSEDESMVSKKSTSHD
LVSEMEV*
51 >lcl|NP_001071419.1|Plus1336251..337384 NW_001493769 progestin and adipoQ receptor family member IX PAQR9 __SEG__ Chr1 {Bos taurus} MPRRLQLRSAGTKGPPGTIAAASEAASRPHALASGDSPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGR
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTGLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCSYPFALRTFVFIMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLKEPPDAPTFLGTVGYMLLLVVCLGLVIKKFLSNAEFCSKK*
52 >lcl|NP_001071535.1|Plus1198077..199846 NW_001493918 ectodermal-neural cortex (with BTB-like domain) ENC1 __SEG__ Chr20 {Bos taurus} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDAWNSITTVPYSLIPTAFVSTWKHLPS*
53 >lcl|NP_001073067.1|Plus1197448..198089 NW_001508823 hypothetical protein LOC520057 LOC520057 __SEG__ ChrX {Bos taurus} MSASTSSRRPIKGILKNKGSTASSVAGSAQQSGGPLQEVHRKKSQKWDESNILATYRPEYRDYDFMKMNEPSTPQFGPQNLGERSAESEATALDSLTKRLAATHTSDSSY
SVRDPELDGAHSSKIYLDRQEKRRQFEMKRKLHYSEGKNIKLARQLISRDLLHDYEDDNNEESSHVISHDKTTTQEEAEQGATSDEGLQTQTCCYLGDDEDDK*
54 >lcl|NP_001073773.1|Plus1900485..902050 NW_001492947 leucine-rich repeat transmembrane neuronal protein 1 precursor LRRTM1 __SEG__ Chr11 {Bos taurus} MDFLLLGLCLHWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQ
KLRRVKELTLSSNQITQLANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHND
LVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYVEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLS
NFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEEGAEPTSGHLLSAVTNRSDLGFPAGPATTLADDREGQPDSTPEPVTVALPGEHAENAVQIHKVVTGTMALIFSFLI
VVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV*
55 >lcl|NP_001074195.1|Plus12132755..2133312 NW_001494827 cbp/p300-interacting transactivator 4 CITED4 __SEG__ Chr3 {Bos taurus} MADHLMLAEGYSLVPRPPPAAPAHGPHALRTLQPYSSPGLDSGLRPRGAPLGPPPPPQGTVAYGAFGPSPTFQPFPAVPPPAAGNAHLQPVATLYPGRATMPPGAPGGPS
GPQPAPGAPAPPLQPPAHALGGMDAELIDEEALTSLELELGLHRVRDLPELFLGQSEFDCFSDLGSAPPAGSVSC*
56 >lcl|NP_001074198.1|Plus1complement(1932993..1934279) NW_001494036 immunoglobulin superfamily containing leucine-rich repeat protein precursor ISLR __SEG__ Chr21 {Bos taurus} MQELRLLCLVVLVGLAQACPEPCECGEKYGFHIADCAYRDLQAVPSGFPANVTTLSLSANQLPSLPGGAFREVPRLQSLWLAHNEIRSVAAGALASLSQLKSLDLSHNLI
SDFAWSDLHSLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFAPLTALSHLQINDNPFDCTCGIVWFKTWALTTAVSIPEQDNITCTSPHVLKGTR
LNRLLPLPCSAPSVQLTYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQTPGGTVEITSPNVGADGRALPGVLAASSRPRFQAFANGSLLIPDFGKLEEGTYSCLAT
NELGSAESSVNVALATPGEGGEDALGRRFQGKAAEGKVCYTVDNEVQPSGPEDNVVIIYLSRARGPEAAATAEGVPGKQPPGLLLLGQSLLFLFLASF*
57 >lcl|NP_001074202.1|Plus1174274..175671 NW_001494948 muscarinic acetylcholine receptor M2 CHRM2 __SEG__ Chr4 {Bos taurus} MNNSTNSSNNVALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDK
KEPVANQDPVSPSLVQGRIVKPNNNNMPGSDDGLEHNKIQNGKTPRDAVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSVGHSKDENSKQTCIKIVTKT
PKGDQCTPTNTTVELVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYA
LCNATFKKTFKHLLMCHYKNIGATR*
58 >lcl|NP_001074981.1|Plus1complement(1486306..1487205) NW_001495372 protein sprouty homolog 4 SPRY4 __SEG__ Chr7 {Bos taurus} MEPPIPQSVPLTPSSVMVQPLLDSRTAHSRLQHPLTILPIDQMKTSHVENDYIDNPGLAPPSGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQR
LLDHMAPPPVADQASPRAVRIQPKAIHCKPLDLKGPAGPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCA
DHPCSCSRSNCCARWSFMGALSLVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAAAGDAKASRPDKPF*
59 >lcl|NP_001075010.1|Plus1complement(768626..769684) NW_001495323 endothelial differentiation, sphingolipid G-protein-coupled receptor, 5 S1PR2 __SEG__ Chr7 {Bos taurus} MGGVYSEYLSSSKVREHYNYTKESPDTKDTPSRQVASALIILLCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFIANTLLSGSVTLGLTPVQWFAREG
SAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIAASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKPYVLCVVTIFSVILSAIVALYIRIYCVVRSSQ
ADVAAPQTLALLKTVTIVLGVFIFCWLPAFSILLLDYACPVRTCPMLYQAHYFFAFATLNSLLNPVIYTWRSRDLRREVLRPLQCWRQAAGMQGRRDRTPGHHLLPLRSS
SSLEKGMHVPTSPTFLEGNTIV*
60 >lcl|NP_001076856.1|Plus1complement(1554967..1556004) NW_001495111 transducer of ERBB2, 2 TOB2 __SEG__ Chr5 {Bos taurus} MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPDKPLKGSGFRCVHIGEIVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVK
VLYVDDSEGCVAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAAGGGGVASGGAGGPQPPQQQPRL
ARSPTNNLLKQKSLSLSLHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDGADGPGSGSPASFGGSGAGTCNSSSFDVAQVFGGGANSLFLEKTPFVEGLSYNLNT
MQYPSQPFQPVVLAN*
61 >lcl|NP_001077133.1|Plus11415734..1416597 NW_001493535 transmembrane protein 119 TMEM119 __SEG__ Chr17 {Bos taurus} MVSAAAPSLAVSLLLLLRVLPTVSYSVSLQAGFLEDTGGSGEAEGSSASSPSLPPPQTPALSPTLVGPEPTPLAGPKPPTNFLDGIVDFFRQYVMLIAVVGSLVFLLMFI
VCAAVITRQKHKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDGRPEETLDSSQQLQAHILAATQNLKSPSRAAPSSGDLARAPEGRSEEEEKGPREADLEAQGR
ALPADKPEVPPLPEEPCSVEADAAAGAAAADEGQGEPDVAPLLAQEAGGPAGPPENPCVCGSVPPSI*
62 >lcl|NP_001077221.1|Plus1complement(779726..781171) NW_001495101 complement component 3a receptor 1 C3AR1 __SEG__ Chr5 {Bos taurus} MESFSAETNSTDLHSQPWDEPHIILSMVILSITFLLGLPGNGLVLWVAGLKMQRTVNTVWFLHLTLADFICCLSLPFSLVHLVLQGHWPYGWFLCKLIPSIIILNMFASV
FLLTTISLDRCLLVLRPIWCQNHRNVGTACTICGCIWVVALVMCIPVFVYRETFTIDNQSMCSYNFGHYGSLDYPDFTYDLLENGSFDNYPPGEMDDRLDSFSSQTKDRP
WAATTGLHSQEFQRTSRDSLPMNSARLSVQQPHYDLFQSADKVSATLSSDFPIEDHRTHPLENSNSFLPADLEFFSNASSDLLYTSELSQGFQDDYFGQFAYDHQVPTPQ
VAITISRLVVGFLLPFIIMVACYSLIILKMRRSRFTKSRSKLLRVAMVVVVVFLVCWAPYHIVGVLLLFTDPDTPSGESLLSWDHVSLALASANSCFNPFLYALLGKDFR
RKARQSMQGILEAAFSEDVTHSTSCPQNKTSFERNSISTVV*
63 >lcl|NP_001077265.1|Plus1839117..841138 NW_001494276 slit-like 2 VASN __SEG__ Chr25 {Bos taurus} MHSRAPLRLLLPLLLLLPALGPGVQGCPSGCQCNQPRTVFCTARRGTTVPLDVPPDTVGLYIFENGITTLDAGSFAGLPGLQLLDLSQNQIASLPGGVFQPLANLSNLDL
TANRLREITNETFRGLRRLERLYLGKNRIRHIQPGAFDVFDRLLELKLQDNELRALPPLRLPRLLLLDLSHNGLSALEPGVLDTANVETLRLAGLGLRHLDEGLFGRLRN
LHNLDVADNQLERVPPAVRGLRGLTRLRLAGNTRIAQLWLEDLAGLAALQELDLSNLSLQALPHELSTLFPRLRLLEAARNPFNCVCPLSWFGPWVRESRLTLASPEETR
CHFPPKNAGRLLLDLDYSDFGCPATTTTATAPTTRAPVQEPTLPPSSLAPTQLRPTELATEAPSQPPPAPPTAGPVPPPRDCPASICLNGGTCHLGARGHLECLCPQGFT
GLYCEGRVRPGPRPSPAPATPRPLPLGIEPASPTSLRVGLQRFQQGSAVQLKSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVRALGAGRVPEGEEAC
GEARTPPAVRSNHAPVTQAREGNLPLLIAPALAAVLLAVLAAVGAAFCVRRGRAAAAVVQGKGQVGPGAGPLELEGVKAPLEPDPKALEGGGEAPTGGLECEVPLMGYSG
PGPQGPLPAKPYI*
64 >lcl|NP_001091502.1|Plus1complement(1200070..1201815) NW_001493514 frizzled 10 FZD10 __SEG__ Chr17 {Bos taurus} MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMC
EQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMFPPLLRPQRPHSAQEHQLKDGGPGRAGCDNPGKFHHVEKSASCAPLCTPGVDVYWS
RDDKRFAVVWLAVWSVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVIL
TLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGNMDINALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL
MVRIGVFSVLYTVPATCVIACYFYERLNVEYWKVLATQHKCKMNNQTKNLDCLMTTSIPAVEIFMVKIFMLLVVGITSGMWVWTSKTLQSWQNVCSRRFKKKSRRKPASV
ITSSGIYKKAQHPPKTHLGKYEIPAQPPTCV*
65 >lcl|NP_001091579.1|Plus12656392..2657471 NW_001493032 protein mab-21-like 1 MAB21L1 __SEG__ Chr12 {Bos taurus} MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAG
KQSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALENAAKQTWRLAREILTNPKSLEKL*
66 >lcl|NP_001091621.1|Plus1438018..439019 NW_001493748 purinergic receptor P2Y, G-protein coupled, 13 P2RY13 __SEG__ Chr1 {Bos taurus} MNVTVMKGFNGSERCPRDLKTAQLVFPAIYTIVFFVGILLNSLALWVFIHIPSSSTFIVYLKNTLVADLIMTLMLPFKILSDARLGPWQLRAFVCRFSAVIFYESMYVGI
TLLGLIAFDRFLKIIRPFGKFFVQKPAFAKGVSTLIWLFLFLLSLPNMILSNKEATPSSVKKCASLKGPLGLKWHEAVNYISQFIFWTVFVLMLLFYTVIAKKVYDSYRK
SKSKDSKNNKRLEGKVFVVVAVFFVCFAPFHFSRIPYTHSQTNSKTDCRLQNQLFLAKETTLFLAATNICMDPLIYILLCKRFRERLPCMKGRQIAAFTQENHTSQSDNI
TLG*
67 >lcl|NP_001091628.1|Plus1203591..204601 NW_001508794 casein kinase I isoform beta CSNK1B __SEG__ ChrX {Bos taurus} MASSSRPKTDVLVGGRYKLVREIGFGSFGHVYLAIDLTNHEQVAVKLESENTRQPRLLHEKELYNFLQGGVGIPQIRWYGQETDYNVLVMDLLGPSLEDLFNFCSRRFSM
KTVLMLADQMISRIEYVHSRNLIHRDIKPDNFLMGTGPQWKKLFLVDFGLAKKYRDNRTGQHIPHRSGKSFIGTPFCASISAHLGIEQSRRDDMESIGYVLMYFNRGSLP
WQGLKAATLKQKCEKISEMKMTTPVDVLCKGFPIEFAMYLKYCLRLSFEEAPDYRYLRQLFRLLFRKLSYQHDYAFDWIVLKQKAEQQASSSSGEGQQAQTPTGKSDNTK
SEMKHS*
68 >lcl|NP_001091851.1|Plus11322757..1323845 NW_001494836 chemokine (C-X-C motif) receptor 7 CXCR7 __SEG__ Chr3 {Bos taurus} MDLHLLDYSEPGNFSDISWPCNGSDCIAVDTLQCGHIPNKSVLLYTLSFVYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVVTIPVWVVSLVQHNQW
PMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSVAYFASTSGRKKRLVRRAVCVLVWLLAFGVSLPDTYYLKTVTSASNNETYCRAFYPEHSVKEWLISMELVSVILG
FAIPFCIIAVFYFLLARAIASSSDQEKQSSRKIILSYVVVFLVCWLPYHLVVLLDIFSILHYIPFTCQLEAFLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAF
IFKYSAKTGLTKLIDASRVSETEYSALEQNAK*
69 >lcl|NP_001091852.1|Plus1complement(513005..513931) NW_001494175 olfactory receptor, family 12, subfamily D, member 2 OR12D2 __SEG__ Chr23 {Bos taurus} MLNQTSVTEFFLLGVTDIQVLQPVLFVVFLTIYFLNLAGNGAILIVVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLENFLSTHKAISFLGCISQLHFFHFLGSTEA
MLVPVMAFDRFVAICKPLRYTLIMSHQVCIQMAVTIWIIGFFHALLHSVMTSRLNFCGSNHIHHFFCDVKPLLKLACGNTELNQRLLNNVTGTFAVGSFFLTLLSYFYII
IYLFFKTHSCSMLHKALSTCASHFMVVVLLFGPVFFIYIRPASGSSMDQEGIIAIMYSVVTPVLNPLIYTLRNKEVKEALRRMIRRKL*
70 >lcl|NP_001092354.1|Plus1complement(664759..665532) NW_001493790 leucine rich repeat containing 3 precursor LRRC3 __SEG__ Chr1 {Bos taurus} MGPTGRQSPSSLPVPAGGPCLLLLFCLRLGASCPQNCQCPDHAGAVAVHCSARGLQEVPRDIPADTVLLKLDANKIARIPNGAFQHLHQLRELDLSQNAIETIGPAAFSG
LAGGLRLLDLSHNRLRRIPKDALGKLSAKIRLAHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSVHHKTTDVAMLVTMFGWFAMVIT
YVVYYVRQNQEDARRHLEYLKSLPSTPMSKDPTSSAP*
71 >lcl|NP_001092836.1|Plus1complement(1391467..1392426) NW_001493505 protein sprouty homolog 1 SPRY1 __SEG__ Chr17 {Bos taurus} MDPQNQHGSGSSLVVIQQPALDNRQRLDYEREIQPAAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTTPRQEKHERTHEIIPINVNNNYEHRPTSHLGHAGLSNNTRGPI
LSRSTSTGSAASSGSNSSASSEQGLLGRSPPTRPIPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGT
CMCLVKGIFYHCSNDDEGDSYSDNPCSCSQSQCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRGCYDWIHRPGCRCKNSNTVYCKLESCPSRGLGKPS*
72 >lcl|NP_001092838.1|Plus1524593..527073 NW_001495372 protocadherin gamma subfamily A, 2 PCDHGA2 __SEG__ Chr7 {Bos taurus} MAALLNLPHRRRFVLLCLLWAALWKVGAGQMRYSVPEEIEKGSFVGSVAKDLGLEPLALAERGARIVSRGRTQLFALNPRNGSLVTAGRIDREELCAQSARCLVSFNILL
EDKLSIYSVEVEIKDINDNAPRFGVEEVELKISETTMPGFRIPLKSAHDADVGENTLQKYEINSNDHFSLDVRSGMDGNKYPELVLARALDREEEAVHYLVLKALDGGDP
IRSGTSRIRVTVLDVNDNAPVFIQPEYGVSVPEDTPVGTRILTVTATDADEGYNAQVTYFLEKNPEETSEVFELKSSSGEITIIKSLDYEDAKFHEIDIEAQDGPGLLTR
MKVIVTVLDVNDNVPEFYMTSATSSVPEDSPPGTIIALFNVHDRDSGQNAFITCSLPENLPFKLERSVDNYHRLVTTRVLDREQFSSYNITVTAKDGGSPSLSTDAYILL
QVTDINDNPPTFPHTSYSAYIPENNPRGASIFSVMACDPDSNDNAHVTYSLAEDTLQSAPLSSYISINSDTGVLYALRSFDYEQFCELQLWVTAQDGGNPPLSTNVSVNI
FVLDQNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFAVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQPPLSATVTL
TVAVADSIPDILTDLGSLKPSVDPDDSGLTLYLVVAVAAVSCVFLAFVIVLLALRLRHWHTSRLFQASGSGLAGVPASQFVGVDGVRAFLQTYSHEVSLTADSRGSHVIF
PQPNYADTLISQESCEKKDFVSEPQFLPEDKEETFSQVNSLPNIPVSYFAKRHEFT*
73 >lcl|NP_001092865.1|Plus1complement(3468356..3469135) NW_001494427 leucine-rich repeat-containing protein 3B precursor LRRC3B __SEG__ Chr27 {Bos taurus} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMVSNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
74 >lcl|NP_001093763.1|Plus17329149..7330228 NW_001494078 chemokine (C-C motif) receptor 4 CCR4 __SEG__ Chr22 {Bos taurus} MNPTDIADTTVDESIYNSYYLYENLPKPCNKDGIRAFGGLFLPPLYSLVFLFGLLGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLC
KLISWIYLVGFYSGIFFITLMSIDRYLAIVHAIFSLRARTLTYGVITSVATWSVAVLVSLPGLLFSTCYTERNHTYCKTKYSFNSTRWKVLSSLEINILGLVIPLGIMLF
CYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTFERHLDYAIQTTETLAFVHCCLNPVIYFFLGEKFRKYIVQLFKTCRGTLVLCQ
YCRLLPMYTDTPSSSYTQSTVDHDLRDAL*
75 >lcl|NP_001093774.1|Plus1224147..225232 NW_001493439 probable G-protein coupled receptor 52 GPR52 __SEG__ Chr16 {Bos taurus} MNDSRWTEWRILNTSSGILNVSERHSCPLGFGHYSAVDVCIFETIVIVLLTFLIIAGNLTVIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGIHE
SLTCQVFGYIISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAALVVC
FTYFHIFKICRQHTKEINDRRARFPSHEAAASRDAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRR
LSETMCTSCMCVKDKEARDPKPRKRANSCSI*
76 >lcl|NP_001093777.1|Plus1complement(406186..407283) NW_001495561 G protein-coupled receptor 6 GPR6 __SEG__ Chr9 {Bos taurus} MNASVSSLNGSQVVAVAAEGAAAAATAAGARDTGEWGHPAAAAAAALGGGGAANASLELSSQLPAGPPGLLLSAVNPWDVLLCMSGTVIAGENALVVALIASTPALRTPM
FVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLTVGFLVTSFAASVSSLLAITVDRYLSLYNALTYYSRRTLMGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACS
VVRPLTRSHVALLSATFFAVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATKKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPDVYTYATLLPATYNSMINPI
IYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV*
77 >lcl|NP_001094589.1|Plus11068218..1069699 NW_001494746 AMIGO protein AMIGO1 __SEG__ Chr3 {Bos taurus} MQPQGDLRGLWLLLLSLFLLLFEVARAGRPVVSCPASCLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNHLNFISSEAFSPVP
NLRYLDLSSNQLRTLDEFLFSELQVLEVLLLYNNHIMAVDRCAFDDMTQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHN
NPLHCDCELYQLFSHWQYRQLSSVMDFQEDLYCMSSKKLHNVFNLSFLNCSEYKERAWEAHLGDSLTIKCDTKQQGMTKVWVTPSNERVLDEVANSTVTVSKDGSLHFQQ
VQIEHGGVYTCYAMGEAFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQADSLSSSMLSTTPNHDPMAGGDKDDGFDRR
VAFLEPAGPAQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV*
78 >lcl|NP_001094605.1|Plus11117315..1118379 NW_001494165 progestin and adipoQ receptor family member VIII PAQR8 __SEG__ Chr23 {Bos taurus} MTTAILERLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAEGLPWASAYTL
PLLVYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYTSDQAWYEHFWLLFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPSGLA
YILDISPVVHRVVLCHLSGCQDPAAWYHTLQIIFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHTFLSVCTLSQLEAILLDYKGRQDIYLPRHSPLSIYLACLSFFLV
VGCSAGTAAFLRQKIKARLTKKDS*
79 >lcl|NP_001094648.1|Plus1complement(187299..188969) NW_001494368 inositol 1,4,5-triphosphate receptor-interacting protein precursor ITPRIP __SEG__ Chr26 {Bos taurus} MALGLFRVCLVVVTAIINHPLLFPRENTTVPENEEEIIRQMQAHQEKLQLEQLRLEEEMARLAADKEAEKEALERVAEEGQQQNESRTAWDLWSTLCMILFLVIEVWRQD
HQDAPSPECLGSDEDELPDLEGAPLRGLTLPNRATLDHFYERCIRGATADAARTREFVEGFVDDLLEALRSLCSRDSDMEVEDFIGVDSMYENWQVNKPLLCDLFVPFMP
PEPYHFHPELWCSSRSVPLDRQGYGQIKVVRADEDTLGCICGKTKLGEDMLCLLHGRNNVVHHGSKAADPLCAPNSPYLDTMRVMKWFQTALTRAWHRIEHKYEFDLAFG
QLDTPGSLKIRFRSGKFMPFNLIPVIQCDDSDLYFVSHLAREPGGGTRASSTDWLLSFAVYERHFLRVTSKALPEGACHLSCLQIASFLLSKQSRLTGPSGLGSYHLKTA
LLHLLLARRPADWKAEQLDARLHELLCFLEKSLLEKKLQHFFIGNRKVPQAMGLPEAVRRAEPLNLFRPFVLQRSLYRKTVDSFYEMLKNAPALISEYSLHIPSDHASLP
PKTVIL*
80 >lcl|NP_001094677.1|Plus1complement(1245167..1246480) NW_001495020 hypothetical protein LOC540367 FAM113B __SEG__ Chr5 {Bos taurus} MVHLLASEVRQLLHNKFVVILGDSVQRAVYKDLVLLLQKDCLLTLSQLKAKGEHTFEQDELVHGGQQGHMHNGTHYREVRQFCSGQHLVRFYFLTRVYSDYLEDVLEELQ
SGEHHPDLVIMNSCLWDITRYGKDFWPSYRRNLERLFGRLRQMLSESCLLVWNTAMPVGDKITSRFVPPEVQFTSSSVKISVIEANFYSSAEAQKHGFDVLDLHFHFRRH
TGKYLQTDGVHWNQCAHRHLSQLLLAHVADAWGVELPRRDPVDKWIPDGPGRRRPGRRLERQPLVCGDQPACPLPRPLPLPGRQPLLPTPPCPPLFPLLSPQRHPIPLHQ
VMPPFPFCPQETCFSSDHPFQSDQFSLNYLHSDVPPSIQTEFAVQGDFQYGPQPPMPRFPPPCYQQRVPEVHRGFPRYHPPDPYMPWRRRPKTSKRRASAYKEPRPQ*
81 >lcl|NP_001094684.1|Plus11394300..1395547 NW_001495094 G protein-coupled receptor 19 GPR19 __SEG__ Chr5 {Bos taurus} MVFAHRMDNSKPPLVVPTLLVPLHNHSCAETTTPLPSRDLTELSPEHSWRSNRTDPQYGPNPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSLACA
DLLVSVASTPFVLLQFSTGRWTLGSAMCRAVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWIFEATFVTPVLFFYGSSWDSHCNYFLPSSWEG
TAYTVIHFLVSFVIPCILIILFYQKVIKYIWRIGTDGRTVRRTMNIVPRTKVKTIKMFLILNLLFLLSWLPFHVAQLWHPHERDYKKSSLVFTAITWISFSSSASKPTLY
SIYNANFRRGMKETFCMSSMKCYRSNAYTITTSSRMAKKNYVGISEIPPSARTITKDSIYDSFDREAKGKKLAWPINSNPPNTFV*
82 >lcl|NP_001094708.1|Plus1complement(432518..433609) NW_001494122 G protein-coupled receptor 62 GPR62 __SEG__ Chr22 {Bos taurus} MANATGLSAPEVAASMGLILAALVEAAALLGNGALLVVVLRTPGLRDALYLVHLCVVDLLAAASIMPLGLLAAPPPGLGRVRLGPAPCRAARFLSAALLPACTLGVAALG
LARYRLIVHPLRPGARPPPTIVLTAVWAAAGLLGALSLLGPPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGSIFLVARRAALRPPRPARGSRPRSDSL
DSRLSILPPLRPRPPWGKAALAPALAVGQFAACWLPYGCACLAPAAQAAAAEAAVTWIAYSAFAAHPFLYGLLQRPVRRTLGRLARRALPWSPRACTSRAWHPRALLQHL
QRPPEGPALGPSEAPDQGRDLTERESLSMSEAT*
83 >lcl|NP_001094773.1|Plus11152632..1153657 NW_001492888 G protein-coupled receptor 65 GPR65 __SEG__ Chr10 {Bos taurus} MNSTCIDEQHDLEHYLFPVVYVFVVIVSIPANIGSLCVSFLQAKQENELGIYLFSLSLSDLLYASTLPLWINYTWNRDNWTFSPALCKGSAFFMYLNFYSSTAFLTCISI
DRYLAVVYPLRFFFLRSRKCAFMVSLTIWVLETILNAVILWEDETAVEYCDAKKSNFTLCYDKYPLENWQIRFNFARTCIGYVIPLVVIMTCNKKVYQAVRQNQATEHRE
RKRIIKLLISITLTFILCFTPFHVMLLIRSILEHDMNLKEQVFDHFKSGKQSYKIYRITVALTSLNCVADPILYCFITEIGRSDMWNILKFFTGKLNKSKRQGKSVLSVS
TKDTIELEILE*
84 >lcl|NP_001095425.1|Plus1339743..340933 NW_001494142 kelch repeat and BTB (POZ) domain containing 1 KLHL31 __SEG__ Chr23 {Bos taurus} MAPKKKTVRKNKADVNEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLLEGLSKMRQEGFLCDLVISTKTKSFDVHKSVMASCSEYFYNILKKDPSTQR
VDLNDIAPLGLATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIQEMSVENCMYIANIAETYSLRNAKAAAQKFIRDNFLEFAETDHFMKLTFEQINELL
IDDDLQLPSEIVAFQIAMKWLEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHKLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVGGRPGLTEK
SLSRDVLYRDPEIGWSKLTEMPAKSFNQCVAVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYRLFY*
85 >lcl|NP_001095483.1|Plus1762461..763870 NW_001494910 kelch repeat and BTB (POZ) domain containing 2 KBTBD2 __SEG__ Chr4 {Bos taurus} MVEHKFTAVYHQEAFMQLSHDLLIDILSSDNLNVEKEETVREAAMLWLEYNTESRSQYLSSVLSQIRIDALSEVTQRAWFQGLPPNDKSVVVQGLYKSMPKFFKPRLGMT
KEEMMIFIEASSENPCSLYSSVCYSPQAEKVYKLCSPPADLHKVGTVVTPDNDIYIAGGQVPLKNTKTNHSKTSKLQTAFRTVNCFYWFDAQQNTWFPKTPMLFVRVKPS
LVCCEGYIYAIGGDSVGGELNRRTVERYDTEKDEWTMVSPLPCAWQWSAAVVVHDCIYVMTLNLMYCYFPRSDSWVEMAMRQTSRSFASAAAFGDKIFYIGGLHIATNSG
IRLPSGTVDGSSVTVEVYDVNKNEWKMAANIPAKRYSDPCVRAVVISNSLCVFMRETHLNERAKYVTYQYDLELDRWSLRQHISERVLWDLGRDFRCTVGKLYPSCLEES
PWKPPTYLFSPDGTEEFEMDGEMVALPPV*
86 >lcl|NP_001095994.1|Plus1complement(719893..721095) NW_001493368 apelin receptor APLNR __SEG__ Chr15 {Bos taurus} MEEGGEYDGYYGADNQSECEYEDWQSSGALIPAIYMVVFVLGTAGNGLVLWTIFRSGRDRRRAADVFIASLAVADLTFVVTLPLWATYTYRDYDWPFGAFACKLSSYLIF
VNMYASVFCLTGLSLDRYLAIVRPVANARLRPRVGGAVATAGLWALAGLLALPVLVFRATSTVLQAENATKVQCYMDYSLVAGPDAEWAWEVGLGVSSTALGFAGPFAVM
LTCYFCIGRTVAGHFGKERARGLRKRRRLLAIIAVLVLTFALCWLPYHLVKTLYVLGSLLRWPCAFDLFLMNVFPYCTCVSYVNSCLNPFLYAFFDPRFRQACASVLCWG
RRGCGGAWRAGGGGGGGGGRGGGGGDKSASSSSSASSGHSQGPGPGGAGKGGEPMPEKSIPYSQETLLVD*
87 >lcl|NP_001095997.1|Plus1525860..527200 NW_001495131 neuropeptide Y receptor Y5 NPY5R __SEG__ Chr6 {Bos taurus} MDSELKDYYNKTSAGENNTAALRNSDFPVWDDYKSSVDDLQYFLIGLYTLVSLLGFMGNLLILMALMRKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFG
RVMCHIMPFLQCVTVLVSTLILISIAIVRYHMIKHPVSNHLTANHGYFLIATVWTLGFAMCSPLPVFHSLVELQETFGSALLSNRYLCVESWPSDAYRIAFTISLLLVQY
ILPLVCLTVSHTSVCRSISCGLSNKENQLEEKEMINLTLHPSQKSGPQVKLPSSQKWSYSFIRKHRRRYSKKTACVLPAPARPPLENRPGRLPEHAGSRKSPLPSSSKFI
PGVPTCFEVKPEENSDVHEMRVNQSIMRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRSLI
HCLHMS*
88 >lcl|NP_001096028.1|Plus1complement(42810..43886) NW_001494081 CX3C chemokine receptor 1 CX3CR1 __SEG__ Chr22 {Bos taurus} MHTTLPESTSENFEYYDLAEACDMGDIVALGTVFVVILYSLVFAFGLVGNLLVVFALINSQRSKSITDIYLLNLALSDLLFVATLPFWTHYVINEQGLHHATCKLITAFF
FIGFFGGIFFITVISVDRFLAIVLAANSMSNRTVQHGVTTSLGVWAAAILVATPQFMFTREKENECFGDYPEILQEIWPVILNTEINFLGFLLPLLIMSYCYFRIMQTLF
SCKNHKKAKAIRLIFLVVVVFFLFWTPYNVMIFLQTLNLYDFFPKCDVKRDLKLAISVTETIAFSHCCLNPLIYAFAGEKFRRYLYRLYRKCLAVLCCHPDHLSFSSSLS
ESQRSRRESVLSSNFTHYTSDGDASILL*
89 >lcl|NP_001096713.1|Plus1complement(1632765..1633580) NW_001493360 muscarinic acetylcholine receptor M4 CHRM4 __SEG__ Chr15 {Bos taurus} MTVLYVHISLASRSRVHKHRPEGPKEKKAKTLAFLKSPLMKQSVKKPPPPGDTTARGELRNGKLEEAPPPVLPPPPRPMADKDTSNESSSGSATQNTKERPPTELSTTEA
TTPATPAPPLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANVARKFASIARSQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQS
CIPETVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR*
90 >lcl|NP_001096717.1|Plus1complement(970820..971674) NW_001494415 protein phosphatase 1 regulatory subunit 3B PPP1R3B __SEG__ Chr27 {Bos taurus} MAVDIECRYSCMAPSLRRERFAFQIAPKPSKPLRPCIQLSGKNEASGTVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPLNITELLDSIVSLTTAESESFV
LDFSQPSADYLDFRNRLQTDHVCLENCVLKDRSIAGTVKVQNLAFEKTVKVRMTFDTWKSFTDFPCWYVKDTYAGSDKDTFSFDISLPEKIQSYERMEFAVCYECNGQTY
WDSNKGKNYRIIRAELQSTQGTAQPPNGPDFEIAFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY*
91 >lcl|NP_001096718.1|Plus1441323..443713 NW_001495372 protocadherin beta 11 PCDHB11 __SEG__ Chr7 {Bos taurus} MELGKGNPQQIRQVLLFFVFLGGSLVCSETWRYSVAEETEIGSFIGNVVKDIGLGVEDLAARGARVIFDDYKPHLRLDLQTGNLLLNEQPDREALCDLTEPCILHFQVLL
ENPLQFFRAELWVEDINDHTPTFTNKHILLKISESTAPGTSFQMDSAQDLDVGKNGVQNYTLNPNLHFHLKLQDSEDGRKYPELLLDQPLDREKEPELRLTLTALDGGSP
ARSGTALVRVLVLDINDNAPQFERSVYEVPIPENSPLDFLVVRVSATDLDAGINGELSYSFSHVSRDIQKTFEIHPIFGEVRLKAFLDFELLQSYTINIQAIDGGGLSGK
SVILVSVVDVNDNPPEVVVTSLTSPIPENSSPEMVVAVFSLRDQDSGDNGRMVCSIQDNLPFLLKPNFKNFYTLETESPLDRESKAEYIITITVTDMGTPRLKTEHNITV
LVSDVNDNAPTFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPRPARAPRLPRVHQPRQWPPLRPHVPGLRGPKSLRVPRGRHRPRVACAQQPGAGAR
ARGGRQRQRALRALPAAERLGALHRAGAQGGRAGLPGDQGGGGGRRRGPERLAVVPAAQGHGARAVRRVGAQRRGAHGAAAERARRAQAAAGGAGQGQRRAATVGQRHAA
RAAGGRLLAALPAGPGSGSGGRGAGRPAHRLPGGGLGVGVVALPLLGAGVRGGAAVQEGWGNLGGSLPGARGPLPWPSGGRQRHGDPVPELPVRSVSDRRNWDQRVQGSK
VCCLQSPGVHD*CRRKLRLSEWFWIQL
92 >lcl|NP_001098458.1|Plus1complement(81233..82252) NW_001495494 immunoglobulin (CD79A) binding protein 1 IGBP1 __SEG__ Chr8 {Bos taurus} MAAAEDELLLPRLPELFETSKQLLDEVEIAAEPTSSQIIQDKVFKGLDLLKKAAEMLSQLDLFSQNEDLEEIASTDLKYLMVPAFQGAFTMKQVSPSKRLDHLQWAREHF
LNFLTQCQYYHVAKFELPKTKTNLAGNNTANSSMAYPSIIAMASQRQAKKERYKQKKEVEHRLSALKSAVESGQADDEHVREYYLLHLRRWIGISLEEIESIDQEIKILR
EKDSTHEASTSQSSHQDRPPMKPFVLTQNMAQAKVFGAGYPSLASMTVNDWYEQHRKFGALPDQGIATTMSEFKRAAQQQEDQEHEEEEDDEQAVCRAREWDDWKDTHPR
GYGNRQNMG*
93 >lcl|NP_001103469.1|Plus1428445..429503 NW_001494062 bradykinin receptor B1 BDKRB1 __SEG__ Chr21 {Bos taurus} MASWALLELQTLNQSQPLPPNTTSCDEAWEAWALLHRVLPTCVLSICLCGLLGNLFVLSVFLVARRRLNTAEIYLANLAASDLVFVLGLPFWAENIRNEFNWPFGALLCR
LVNGIIKANLFISVFLVVAISQDRYCVLVHPMASRRQRRRRRAQGTCLLIWAVGALLSLPTFLLRSVKAVPELNVSACVLRYPHDAWPFVRMVELTLLSFLLPLAAIVFF
NCHILAALRGRRQISRTRCGGPREGRTTALILTLVSAFLLCWAPYHFFAFLEFLFQVRAVRGCFWENFIDLGLQCANFFAFVNSCLNPVIYVFWGQLFRTKVWELYKQCI
PGSLTPVASSHRTEILQLFWRN*
94 >lcl|NP_001106144.1|Plus1complement(1090464..1091561) NW_001495576 5-hydroxytryptamine (serotonin) receptor 1E HTR1E __SEG__ Chr9 {Bos taurus} MNITNCTPEASVAVRPKTITEKMLISMTLVIITTLTMLLNSAVIMAICTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWKLGYFICEVWLSVDMTCCTCSI
LHLCVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIRHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSR
HLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKIHTSIRIPPFDNDLDYPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSTYAVSSEVADFLT
WLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT*
95 >lcl|NP_001108204.1|Plus1complement(1325609..1326964) NW_001494303 selenophosphate synthetase 2 SEPHS2 __SEG__ Chr25 {Bos taurus} MAEVAATGAGGEAMAAVAAGEGSSGPVGLPQGRGFSSYRPFEPQALGLSPSWRLTGFSGMKG*GCKVPQETLLKLLAGLTRPEVLPAPGRGLVGGLEETAQEAGLPVRAE
PSPPFPTLGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMPEEEREKITPLMIKGFRDAAEEGGTAVTGGQTVV
NPWIIIGGVATVVCQPNEFILPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKIKMVVSREEVELGYQEAMFNMATLNRIAAGLMHTFNAHAATDITGFGILGHSQ
NLAKQQRNEVSFVIHNLPIIAKMAAISKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATATPLVP
ENSSASSEPSL*
96 >lcl|NP_001137216.1|Plus1complement(741744..742250) NW_001494622 G-protein coupled receptor 39 GPR39 __SEG__ Chr2 {Bos taurus} LIVVTLAVCWMPNQVRRIMAAAKPKHDWTKSYFRAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRSVFGQVLRCQLTLPHANQEKHLRAHVASTMDSTRSACRPLIFPA
SQRSSSSARANMVFLSTFHSEAKPESKPQELSCESPEPNSERKPANPATRNGFQEHEV*
97 >lcl|NP_001137563.1|Plus1330480..332204 NW_001501789 frizzled homolog 7 FZD7 __SEG__ Chr2 {Bos taurus} MRGSRAAASRLPLDLCTVVLALLGSLPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEEAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC
TVLDKAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGGPTAYPTAPYLPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYL
GYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQG
TKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFL
LAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWS
GKTLQSWRRFYHRLSHSSKGETAV*
98 >lcl|NP_001138705.1|Plus1539967..540947 NW_001493607 free fatty acid receptor 3 FFAR3 __SEG__ Chr18 {Bos taurus} MTNPDHSFFLGNHWLFFSVYLFTFLVGLPLNLMALVIFVGKLRRRPLAVDVLLLNLTLSDLVLLLFLPFRMVEAASAMHWSLPFVFCPFSRFLFFTTIYLTSLFLAAVST
ERFLSVAYPLWYKTRPRPGQAGLVSGACWLLAAAHCSVVYVIEFSGNSSPSQGINGTCYLEFREDQLALLLPVRLEMAVVLFGVPLFISSYCYSRLVCILGRGASHRRRK
RVAGLAAATLLNFLVCFGPYNMSHIVGYIQGKSPTWRSYVLLLSTLNSCVDPLVYYFSSSGFQADFHGLLGRLTGSWGPWRQENGVTSKKSEGEGPPQELFNIEAS*
99 >lcl|NP_001138706.1|Plus11228626..1229633 NW_001493523 G protein-coupled receptor 81 GPR81 __SEG__ Chr17 {Bos taurus} MANRSCCLIQGYHMPEVMPSLLILAFVLGILGNGVALCGFCFHMKTWKPSTIYLFNLAVADFLLMICLPFRTDYYLRQRQWAFEDIPCRVVLFMLAMNRAGSIVFLTVVA
VDRYFKVVHPHHMVNTISNWTAVGIVCVLWTLVILGTLYLLLENHLCVQEKIIACESFIMVSANGWHDVMFQLEFFLPLGIILFCSFKIIWSLKQRQRLARQSRMKKPVR
FIMMVAVVFIACYLPSALARLYFLWTVPSSACNPSVHVALHVTLSFTYINSMLDPLVYYFSSPSFPKFYTKLKICSVRPRCPGCFKRPEGMPTSNLCCKSCISVANSFQS
QSEGQ*
100 >lcl|NP_001138707.1|Plus1160018..161106 NW_001493541 chemokine-like receptor 1 CMKLR1 __SEG__ Chr17 {Bos taurus} MEAEDYNASYEDYPDDVDPIVVLEELSPLEGRVVRILLVAVYSVICLLGILGNGLVIVMITCKMKRTVNTVWFLNLAVADFLFNVFLPVHIAYAALDYHWVFGTAMCKIS
NFLLIHNMFTSVFLLTVISFDRCVSVLLPVWSQNHRSVRLAYTACLVIWVLAFFLSSPSLVFRDTARLHGKISCFNNFSLSAAVSSPWPAHPQVDPVGSGRHKVVTITRF
LCGFLVPGLITTACYLTIVYKLQRSRLAKTKKPFKIILTIIVTFFLCWCPYHAFYLLELRRGSVPPSVFSLGVPLATAIAIANSCMNPILYVFMGQDFKKFRVALFSRLV
NALSEDTGHSSYPSHRSFTKMSSMNERETGML*
101 >lcl|NP_001157256.1|Plus1604579..605568 NW_001493607 free fatty acid receptor 2 FFAR2 __SEG__ Chr18 {Bos taurus} MPDWDSSLILTAYIIILLTGLPANLLALRAFLGRVRQPHPAPVHILLLSLTLADVLLLLLLPFKIIEAASDFRWELSNLACALMGFGFYGSIYCSTLLLAGISVERYLGV
AFPVQYKLSRRPVYGVIAALIAWVMSFGHGTVVIIVQYLNSTQRAPKENETTCYENFTQEQLRLLLPIRLELCLLLFFFPMVVTTFCYSRFVWIMLTQPHMGAQKQRRAM
GLAIVSLLNFLLCFGPYNISHLVGFYMKASPKWRREAVVFGSLNASLDPLLFYFSSSVVRRSFGKGLQALYHWGSSLLGRRCKETAEAANEDPGVSQAEGAPSSDFTLD*
102 >lcl|NP_001159980.1|Plus11545460..1545909 NW_001493918 calmodulin CALM __SEG__ Chr20 {Bos taurus} MADQLTEEQIAEFQEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVM
TNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVHMMTAK*
103 >lcl|NP_001159997.1|Plus1172126..173259 NW_001493330 P2Y purinoceptor 2 P2RY2 __SEG__ Chr15 {Bos taurus} MATGLDTWNGTTNGTWDGDELDYKCRFNESFKYVLLPVSYGVVCVLGLCLNAAALYIFLCRLKTWNASTTYMFHLAVSDALYAASLPLLVYYYAQGDHWPFSTVLCKLVR
FLFYTNLYCSILFLTCISVHRCLGVLRPLHSLRWGRARYARRVAFAVWVLVLSCQAPVLYFVTTSTRSSRIICHDTSAPELFGHFVAYSSVMLSLLFAAPFAVILVCYVL
MARRLLKPAYGTSGGLPRAKRKSVRTIAIVLTVFVLCFLPFHVTRTLYYSFRSLDLSCRTLDAINLAYKVTRPLASANSCLDPVLYFLAGQRLVRFARDAKPPTDPTPPT
QARHRLGLHRSYGTDADRTEDSASRENSRGTESSLAGSGADTKDIWL*
104 >lcl|NP_776430.2|Plus1246996..248762 NW_001495460 calicin CCIN __SEG__ Chr8 {Bos taurus} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDIALTVDHHVFFAHRNVLAAVSPLVKNLISNHDMKTTDELFITIDPNYLSPTTVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGCVHFMRCPPVIFGRLLRDENLHVLNEDQALNALINWVCFRKDEREKYFKKFF
NYINLNAVSNKTLMYASNKLMGMENSSAHSTLIESVLVDRKQERPTSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATSAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKETWCLAGKMSIPMDGTAVITRGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTNTGEVVQCITFPIEFNHRPLLSFHQDNILCVYSHRQSVEINLQKVKANKTTTSVPLLPNNCPLDVSHAICSVGDNKVFVCGGVTTTTDVQTKDYTINPNA
YLLDQKAGEWKTLAPPPEALDCPACCLAKLPCKILQRI*
105 >lcl|NP_776467.1|Plus1728801..730141 NW_001492776 d(1A) dopamine receptor DRD1 __SEG__ Chr10 {Bos taurus} MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTAS
ILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLGKTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRI
AQKQIRRISALERAAVHAKNCQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGSGETKPFCIDSITFDVFVWFGWANSSLNPII
YAFNADFRKAFSTLLGCYRLCPTTNNAIETVSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPALSVILDYDTDVSLEKIQPITQ
NGQHPT*
106 >lcl|NP_776508.2|Plus163724..65199 NW_001494128 histamine receptor H1 HRH1 __SEG__ Chr22 {Bos taurus} MTCPNSSCVFEDKMCEGNKTAPANNAQLTPLVVVLSTISLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGVVVMPMNILYLLMSRWSLGRPLCLFWLSMDYV
ASTASIFSVFILCIDRYRSVQQPLKYLRYRTKTRASITILAAWFLSFLWIIPILGWRHFQPKTPEPREDKCETDFYNVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQ
HCQHRELINGSFPSFSDMKMKPENLQVGTKKPGKESPWEVLKRKPKDTGGGPVLKPPSQEPKEVTSPGVFSQEKEEKDGELGKYYCFPLDTVQAQPEAEGSGRGYAAINQ
SQNQLEMGEQGLSMPGAKEALEDQILGDSQSFSRTDSDTPAEPALAKGKSRSESSTGLEYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFIMAAFIICWIPYFIFFM
VIAFCESCCNQHVHMFTIWLGYINSTLNPLIYPLCNENFKKTFKKILHIRS*
107 >lcl|NP_776533.1|Plus11032191..1033144 NW_001493571 melanocyte-stimulating hormone receptor MC1R __SEG__ Chr18 {Bos taurus} MPALGSQRRLLGSLNCTPPATLPFTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVVAAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGVLATQA
AVVQQLDNVIDVLICGSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFITYYNHKVILLCLVGLFIAMLALMAVLYVHMLARACQHAPG
HCPAPEEAAPHSSGLWPQGRCHPHHPAGRLLPLLGPLLPAPLAHRPLPPAPHLWLHLQELQPLPGPHHLQRHCGPPHLCLPQPGAPEDAPRGAAVLLV
108 >lcl|NP_776534.1|Plus1complement(2212099..2212992) NW_001494248 adrenocorticotropic hormone receptor MC2R __SEG__ Chr24 {Bos taurus} MKHILNLYENINSTARNNSDCPAVILPEEIFFTVSIVGVLENLMVLLAVAKNKSLQSPMYFFICSLAISDMLGSLYKILENVLIMFKNMGYLEPRGSFESTADDVVDSLF
ILSLLGSICSLSVIAADRYITIFHALQYHRIMTPHRALVILTVLWAGCTGSGITIVTFSHHVPTVIAFTALFPLMLAFILCLYVHMFLLARSHTRRTPSLPKANMRGAVT
LTVLLGVFIFCWAPFVLHVLLMTFCPADPYCACYMSLFQVNGVLIMCNAIIDPFIYAFRSPELRVAFKKMVICNCYQ*
109 >lcl|NP_776535.1|Plus1complement(545062..546060) NW_001494269 melanocortin receptor 4 MC4R __SEG__ Chr24 {Bos taurus} MNSTQPLGMHTSLHSWNRSAHGMPTNVSESLAKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNST
DTDAQSFTVDIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVAITISAIWAACTVSGVLFIIYSDSSAVIICLITVFFTMLALMASLYVHMFLMAR
LHIKRIAVLPGSGTIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCSPLGGLCDLSS
RY*
110 >lcl|NP_776622.1|Plus1complement(1737831..1740185) NW_001493469 toll-like receptor 2 precursor TLR2 __SEG__ Chr17 {Bos taurus} MPRALWTAWVWAVIILSTEGASDQASSLSCDPTGVCDGHSRSLNSIPSGLTAGVKSLDLSNNEITYVGNRDLQRCVNLKTLRLGANEIHTVEEDSFFHLRNLEYLDLSYN
RLSNLSSSWFRSLYVLKFLNLLGNLYKTLGETSLFSHLPNLRTLKVGNSNSFTEIHEKDFTGLTFLEELEISAQNLQIYVPKSLKSIQNISHLILHLKQPILLVDILVDI
VSSLDCFELRDTNLHTFHFSEASISEMSTSVKKLIFRNVQFTDESFVEVVKLFNYVSGILEVEFDDCTHDGIGDFRALSLDRIRHLGNVETLTIRKLHIPQFFLFHDLSS
IYPLTGRVKRVTIENSKVFLVPCLLSQHLKSLEYLDLSENLMSEETLKNSACKDAWPFLQTLVLRQNRLKSLEKTGELLLTLENLNNLDISKNNFLSMPETCQWPGKMKQ
LNLSSTRIHSLTQCLPQTLEILDVSNNNLDSFSLILPQLKELYISRNKLKTLPDASFLPVLSVMRISRNIINTFSKEQLDSFQQLKTLEAGGNNFICSCDFLSFTQGQQA
LGRVLVDWPDDYRCDSPSHVRGQRVQDARLSLSECHRAAVVSAACCALFLLLLLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPRRDICYDAFVSYSERDSYWVENLMV
QELEHFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTIFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIDKKAIPQRFCKLRKIMNTKTYLEWPVDETQ
QEGFWLNLRAAIRS*
111 >lcl|NP_776658.1|Plus1complement(1501007..1502086) NW_001493749 type-1 angiotensin II receptor AGTR1 __SEG__ Chr1 {Bos taurus} MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSF
NLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVCAFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWK
TLKKAYEIQKNKPRKDDIFKIILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPLFYGFLGKKFKKYFLQLLKYIPPKAKSHSNL
STKMSTLSYRPSENGNSSTKKPAPCIEVE*
112 >lcl|NP_776690.1|Plus1complement(879390..880442) NW_001493779 C-C chemokine receptor type 11 CCRL1 __SEG__ Chr1 {Bos taurus} MAVEYNQSTDYYYEENEMNDTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFIIGLAGNSTVVAIYAYYKKRRTKTDVYILNLAVADLFLLFTLPFWAVNAVHGWVLGKI
MCKVTSALYTVNFVSGMQFLACISTDRYWAVTKAPSQSGVGKPCWVICFCVWVAAILLSIPQLVFYTVNHKARCVPIFPYHLGTSMKASIQILEICIGFIIPFLIMAVCY
FITAKTLIKMPNIKKSQPLKVLFTVVIVFIVTQLPYNIVKFCQAIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNPVLYVFMGTSFKNYIMKVAKKYGSWRRQRQN
VEEIPFESEDATEPTSTFSI*
113 >lcl|NP_776695.1|Plus12573870..2575642 NW_001494447 muscarinic acetylcholine receptor M3 CHRM3 __SEG__ Chr28 {Bos taurus} MTLHNNNTTSPLFPNISSSWIHGPSDTGLPPGTVTHFGSYNISRAAGNLSSPNGTTSDPLGGHTIWQVVFIAFLTGVLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSL
ACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGE
CFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSMKRSARRKYGRCHFWFTTKSWKPSAEQMDQD
HSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGSVGLERKPSKLQTQQSMDDGGSFQKSFSKLPIQLESAVDTAKA
SDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKT
FRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL*
114 >lcl|NP_776785.1|Plus1complement(887897..888979) NW_001494678 high affinity interleukin-8 receptor B IL8RB __SEG__ Chr2 {Bos taurus} MTIILKDLSNSSILWEGFEDEFGNYSGTPPTEDYDYSPCEISTETLNKYAVVVIYALVFLLSLLGNSLVMLVILYSRIGRSVTDVYLLNLAMADLLFAMTLPIWAASKAK
GWVFGTPLCKVVSLLKEVNFYSGILLLACISMDRYLAIVHATRTLTQKRHWVKFICLGIWALSVILALPIFIFREAYQPPYSDLVCYEDLGANTTKWRMIMRVLPQTFGF
LLPLLVMLFCYGFTLRTLFSAQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRNDIGRALDATEILGFLHSCLNPLIYVFIGQKFRHGLLKIMA
IHGLISKEFLAKDGRPSFVGSSSGNTSTTL*
115 >lcl|NP_776823.1|Plus11622718..1623092 NW_001493244 neurocalcin-delta NCALD __SEG__ Chr14 {Bos taurus} MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDL
DGNGYISKAEMLEIV
116 >lcl|NP_776826.1|Plus1complement(2165193..2166347) NW_001493468 neuropeptide Y receptor type 2 NPY2R __SEG__ Chr17 {Bos taurus} MKMGPLGAEADENQTVEEMKVDQFGPGHTTLPGELAPDSEPELIDSTKLIEVQVVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFT
LTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGT
VYSLSSLLILYVLPLGIISFSYTRIWSKLKNHVSPGAAHDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGW
MNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAKKHLQVTKNNGPNDSFTETTNV*
117 >lcl|NP_776891.1|Plus11535581..1536270 NW_001493694 suppressor of cytokine signaling 3 SOCS3 __SEG__ Chr19 {Bos taurus} MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRS
TQPVPRFDCVLKLVHHYMPAAGAPSFSQPPAEPSSSPSSEVPEQPPAQPLSGNPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIRE
FLDQYDAPL*
118 >lcl|NP_776892.1|Plus1complement(26346..27452) NW_001502389 somatostatin receptor type 2 SSTR2 __SEG__ Chr19 {Bos taurus} MDLVSELNETQPWLTAPFDLNGSVGAANISNQTEPYYDLASNVVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFG
KAMCRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPL
TIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVK
VSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI*
119 >lcl|NP_776923.1|Plus1985489..986379 NW_001495476 alpha-1A adrenergic receptor ADRA1A __SEG__ Chr8 {Bos taurus} MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCC
TASIMGLCIISIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKS
GLKTDKSDSEQVTLRIHRKNAQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGKS
120 >lcl|NP_778219.1|Plus1964259..965248 NW_001494678 G-protein coupled bile acid receptor 1 GPBAR1 __SEG__ Chr2 {Bos taurus} MTSNSTREVPSPVPAGALGLSLALASLIVAANLLLAVGIAGDRRLRSPPAGCFFLSLLLAGLLTGLALPALPVLWSQSRRGYWSCLFLYLAPNFCFLSLLANLLLVHGER
YMAVLRPLRPRGSMRLALLLTWAAPLLFASLPALGWNHWAPGGNCSSQAVFPAPYLYLEIYGLLLPAVGAAALLSVRVLVTAHRQLQDIRRLERAVCRGAPSALARALTW
RQARAQAGATLLFGLCWGPYVATLLLSVLAFEQRPPLGPGTLLSLISLGSASAAAVPVAMGLGDQRYTGPWRVAAQKWLRMLRGRPQSSPGPSTAYHTSSQSSVDLDLN*
121 >lcl|NP_919242.1|Plus11431018..1432421 NW_001494374 beta-1 adrenergic receptor ADRB1 __SEG__ Chr26 {Bos taurus} MGAGALALGASEPCNLSSAAPVPDGAATAARLLVPASPPASLLTSASEGPPLPSQQWTAGMGLLMAFIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLL
VVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVCTVWAISALVSFLPIFMQWWRDKDAKASGCYNDPECCDFII
NEGYAITSSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLSGPARLPSPAPSPGPPLPAATVANGRANKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLA
NVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAACGSHAAAGDPPRALGCLAVARPSPSPGAASDDDDDDDEDDVGAAPPVRLLEPWAG
YNGGAAANSDSSPDEPSRAGCASESKV*
122 >lcl|XP_001249506.1|Plus1complement(2465611..2468139) NW_001493065 slit homolog 1 protein-like SLITRK6 __SEG__ Chr12 {Bos taurus} MKLWIHLLYSSLLACISSQSQSPMPSASARGSCDSLCNCEEKDGTMLINCEEKGIKKLSQISVPPSRPFHLSLLNNGLTVLHTNDFSGLTNAISIHLGFNNIADIETGAF
NGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDN
KWACNCDLLQLKLWLENMPPQSVIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAVTSSISDSHMSAKTTSLLKPPTKAPGLIPYITKPSTQLPGLY
CPIPCNCKVLSPSGLLIHCQERNIESLSDLKPPPQNPRKLILAGNIIHTLLKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSGGMFLGLHNLE
YLYLEYNGVKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTRINLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDEILCTS
PEHLHKKELKALNSELLCPGLVNNPSLPTQTSYIIVNTPTTTTTADNIFKSLTDAVPLSVLILGLLIVFITIVFCAAGIVVLVLHRRRRYKKKQADEQMRDTSPVHLQYS
MYGHKTTHHTTERPTASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLERENHSPLTGSNMKYKTTDQSTEFLTFQDASSLYRNILEKERELQQL
GITEYLRKNIAQLQPDTEVHYPGAHEELKLMETLLYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQT*
123 >lcl|XP_001249583.2|Plus1234557..235516 NW_003101172 olfactory receptor 630-like LOC783616 __SEG__ Chr15 {Bos taurus} METANSSNILASTFYLTGIPGYEEFHHWISIPFCLLYLIGIMGNCTILHVVWTDPRLHEPMYYFLAMLSLTDMGMSLPTVISLFRVLWSISREIQFNTCVVQMFFIHTFS
FTESSVLLAMALDRYVAICHPLRYATILTPTLITKIGIVALLRSAFAMIPLLAQLAFFPFCHSHVLSHSYCLHQDMIRLACADTKFNVIYGLVLITLLWGMDSLGIFVSY
VFILHSVLNISSQEGRFKALNTCASHICAVLILYVPMIGLSIAHHFAKHSSPLIHIFMAHIYLLVPPVLNPVIYSVKTKKIRQGILHLLFPLRISSSVM*
124 >lcl|XP_001249593.1|Plus1336920..337300 NW_001508835 histidine triad nucleotide binding protein 1 HINT1 __SEG__ ChrX {Bos taurus} MADEITKAQVARPGGDTIFGKIIRREIPAKIIYEDDQCLAFHDISPQAPTHFLVIPKKYISQISAAEDDDESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYH
VHLHVLGGRQMNWPPG*
125 >lcl|XP_001249597.1|Plus1complement(485617..487110) NW_001492854 G protein-coupled receptor 135-like GPR135 __SEG__ Chr10 {Bos taurus} MEEQPPPPLVRPPVSTALSGSPHPGAPSPAGTPGGTSSAATAVAVLSFSTAAAAALGNRSDVSGADSTGAAAGGGLGGRGAAGAAGRPPLGPEAAPLLSHGAAVAAQALV
LLLIFLLSSLGNCAVMGTIVKHRQLRTVTNAFILSLSLSDLLTALLCLPAAFLDLFTPPGGPAPAATAAAAGPWSGFCAASRFFSSCFGIVSTLSLALISLDRYCAIVRP
PREKIGRRRALQLLAGAWLAALGFSLPWELLLTPREAPAAAQSFHRCLYRTSPDPAQLGAAYSVGLVVACYLLPFLLMCFCHYHICKTVRLSDVRVRPLTTYARVLRFFS
DVRTATTVLIMIVSVICCWGPYCFLVLLAAARRAQAAQSPSLLNVVAVWLTWANGAINPVIYAVRNPNISMLLGRNREEGYRTRNVDALLPNQGRALQAGTLNLLRNRCT
NRLGAWSTMSSSNPTSGVAGDMAMWARKNPVVLFCREGPPDPVTAAAKQSESGDTSL*
126 >lcl|XP_001249683.2|Plus1439043..439996 NW_001494524 hypothetical protein LOC781277 __SEG__ Chr29 {Bos taurus} MDPGNHSSVTEFILAGLTEQPQLQLPLFLLFLGIYVVTMVGNLGMITLTGLSSHLHTPMYYFLTNLSFIDLCQSTVITPKMLVSFMTEKNIISYPECMTQLYFFIIFAIS
ESHMLAVMAYDRYVAICNPLLYNITMSYYICFCLTVGVYILGITGSTVHTGFMLRLFFCNTNIINHYFCDLFPLLELSCSSIYVNELLVIFLSAFNILIPALVILSSYIF
ILSSILQIHSKEGRSKAFSTCSSHISAVAIFYGSTAFMYLQPSSVSSMDQGKVSSVFYTIIVPMLNPLIYSLRNRDVKFALKKILDCAKHVGTEPIS*
127 >lcl|XP_001249684.2|Plus1complement(6601948..6602883) NW_003101170 olfactory receptor Olfr227-like LOC781279 __SEG__ Chr5 {Bos taurus} MKNRTLTEFILLGLTDIPELQSIIFILLLLTYIISILGNLIIITLTLLDSHLHTPMYFFLWNFSSLEIFFISTFTPRLLFSISTGNKSISFAGCLTQYFFVIFFGATEFY
LLAAMSYDRYVAICKPLHYTTIMNSRVCIQLVLCSWLAGFLIILTPIIMTSQLDFCASNVLNHYFCDYGPLIEISCSDTRLLELVDFISAVVTLVLTLMLVILSYTNIIQ
TILRIPSAQKRKKAFSTCSSHMIVITLSYGSCIFMYIKPSAKDGVAFNKGVAILNTLIAPLLNPFIYTLRNKQVKEAFSNVARKIAHLYSF*
128 >lcl|XP_001249775.2|Plus1complement(6622378..6623307) NW_003101170 olfactory receptor Olfr227-like LOC781363 __SEG__ Chr5 {Bos taurus} MKNQTYITEFILLGLTDIPELQSVIFILLFLTYVFSIIGNLTIITLTLLDSHLHTPMYFFLWNFSFLEISFTTTFTPRLLFSISTGNKSISFAGCFTQYFFAIFLGATEF
YLLAAMSYDRYVAICKPLHYMTIMNSRVCIPLILWSWLGGFLVILSPIILTSQLDFCASNMLNHYYCDYGPLIEISCSDTRLLELVDFILAVVTLVLTLMLVILSYTNII
QTVLEIPSVQQRKKAFSTCSSHMIVISLSYGSCIFMYIKPSAKEGVAFNKGVAVLNTSIAPLLNPFIYTLRNEQVKQAFKNVARKIVSL*
129 >lcl|XP_001249865.1|Plus1427218..428147 NW_001493367 olfactory receptor 1259-like LOC781435 __SEG__ Chr15 {Bos taurus} MANERNVTVFILVGLTQNPQMQKIVFVVFLVLYMVTLSGNLLIVVTITTSQALNSPMYFFLTHLSLIDTIYSSSSAPKLIVDSLQEIKTISFNGCMAQVYAEHIFGATEI
ILLTEMAYDHYVAICKPLHYTAIMSHRLCVLLLGVAWTGGFVHATIQVLFTVRLPFCGPDVIDHFMCDLYPLLKLVCVDTHILGLFVAANSGFICLLNFLLLLVSYVVIL
SSLKSYSLEGRRRALSTCVSHITVVVLFFVPCIFVYLRPVTTLPIDKAVAVFYTMVAPMLNPLIYTLRNTEVKCAMKKLWKKKVRSDNS*
130 >lcl|XP_001249873.2|Plus1complement(124247..125185) NW_001501816 olfactory receptor Olr1108-like LOC781446 __SEG__ Chr5 {Bos taurus} MALRNHSTITQFILIGLSDDTHIQALLFILFLGIYLQTLLGNLTMILVIRTDSHLHTPMYYFLSNLSFLDLCFSSVTVPKLLKDLLSEKKTISVEGCLAQVFFVFLTAGN
EACLLSVMAYDRYAAICHPLLYNQVMSNQLCKGLVWGSWGLASLNAVIIVLLAINLDFCDAQTIHHYTCELPSLFPLSCSDISINISILSFSTIFLGLGNFFPIFFSYVR
IIFHILSISSTTGRSKAFSTCSSHLIAVILFFGSGMLRYLMPPSGSSLDLLSSLQYSVITPMLNPLIYSLRNNEVKTAVKRTLGKYPQYFRH*
131 >lcl|XP_001249954.1|Plus1complement(321280..322212) NW_001494524 olfactory receptor Olfr906-like LOC781509 __SEG__ Chr29 {Bos taurus} MAPGNGSFVTEFILLGLTNQPDLQLPLFFLFLGMYMVTVLGNLGLITLIALNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINFISKKNIISYVGCMTQLYFFSFFIIS
EIYVLTSMAYDRYVAICKPLLYNVVMSPKVCSSLMLGSYLMAFSGAMAHTGCMLRLTFCDANTITHYFCDILPLLQLSCTSTYVSELEMFIVVGINIIVPSLTIFVSYGL
ILTNILHISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPPSAVSMDEGKISSVFYTNMVPMMNPLIYSLRNKDVKLALRKTLSMRQF*
132 >lcl|XP_001250040.2|Plus1complement(60059..62773) NW_001493072 SLIT and NTRK-like family, member 5 SLITRK5 __SEG__ Chr12 {Bos taurus} MHTCCPPVTLEQDLHRKMQSWMLQTLAFALTSLVLSCAETIDYYGEICDNACPCEEKDGILTVSCENRGIISLSEISPPRFPIYHLLLSGNLLSRLYPNEFVNYTGASIL
HLGSNVIQDIETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLESLEYLQVDYNYISVIEPNAFGKLHLLQVLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGL
LQHMDKVVELQLEENPWNCSCELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPLSTTGYLHTTPASVNSVATSSSAVYKPPLKP
PKGTRQPNKPRVRPTSRQPSKDLGYGNYGPSIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENYIALVRRSDFLEATGLDLLHL
GNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGLQSLQYLFLQYNLIREIQPGTFDPVPNLQLLFLNNNLLQTLPSGVFSGLTLLRLNLRSNHFTSLPVSRVLD
QLTSLIQIDLHDNPWDCTCDVVGMKLWVEQLKAGVLVDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVSTPAPSSIQVPARTSAVTPAVRLNATGAPAGLGAGGGAAS
SVPLSVLILSLLLVFIMSVFVAAGLFVLVVKRRKKHQSDHASTHNSDVSSFNMQYSVYGGGGGGGGGSGGAXXXXXXXXXXXXXXXXXPPQPQPPPPVQLQPAGEDERRE
SHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCATTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQYLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLE
LKAKLNVEPDYLEVLEKQTTFSQF*
133 >lcl|XP_001250191.2|Plus181637..82575 NW_001502368 olfactory receptor 1280-like LOC781713 __SEG__ Chr10 {Bos taurus} MEESNQSVVSEFVFRGLCDSKDLQKFLFLPFSALYLMTVLGNLFIAFLIITDSHLHSPMYFLLANLSFVDFCLSSVTTPKLITDFLKDNKTISFGGCMSQILFIHFLAGD
EMVLLVTMAYDRCVAICKPLHYSRIMDRQKCIWLALISWIIGFVHAISQLAMILDLSFCGPRIVDSFFCDIPEVIKLACMDTHTLRILINADSGVLAVTCFILLLISYTY
ILVTIHLHSKDGASKALSTCTSHITVVVLFFGPCIFIYFWPLSITWVDKVLSVFYTVITPLLNPAIYTLRNKEIKNAVKRLISQHKNTKYNF*
134 >lcl|XP_001250297.1|Plus1312624..313523 NW_001493152 protein phosphatase 1, regulatory subunit 3D PPP1R3D __SEG__ Chr13 {Bos taurus} MSGGPGSAVLPATVGFRKPAPRSLSCLSDLDGGAAREPRPCRPPGSPGSAPPPPPAPSGCDPHLRPIILRRARSLPSSPERRQKGAGAPGAACRPGCSRQHRVRFADALG
LELAQVKVFNAGEDPSVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFPPPVEAPDFGERLGRQLVCLERVTCSDLGISGTVRVRNVAFEKQVAVRYTFSDWRSAHEVA
ARWRGPAGSGGSEDVFAFGFPVPPFLLELGSRVHFALRYRVAGAEHWDNNDGRDYSLTCRNHALHMPRGECEESWIHFI*
135 >lcl|XP_001250345.2|Plus1complement(32953..33891) NW_001502368 odorant receptor MOR10-like LOC781843 __SEG__ Chr10 {Bos taurus} MSKANYSSVSEFVFLGLSTSRPVQHFLLAFSTVFYVIIVLGNFLVVFTVTFDPHLHSPMYFLLANLSSIDLCFSTLTVPKMISDLYSGHKTISFQGCVTQIFVLHTLGGS
EMVLLTAMAFDRYVAICKPLHYLTIMSPRVCLLLLCGAWAIGLIHSVVQLAFVIHLPFCGPNEIDSFYCDLPWFIKLACIDSYRMEFMVTANSGFISMGTFFLLIISYVF
ILVTVWKHSSGGLRKALSTLSAHITVVVLFFGPCIFVYMWPFPTVTVDKFLAILDFLVTPILNPAIYTLRNKDMKTAMSRLSNQLLSLRKVS*
136 >lcl|XP_001250473.1|Plus1113626..114726 NW_001493843 5-hydroxytryptamine (serotonin) receptor 1F HTR1F __SEG__ Chr1 {Bos taurus} MDFLNSSDQNLTSEELLNRMPSKILVSFILSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCS
ILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISIFISMPPLFWRHQGTSQEDECIIKHDHIISTIYSTFGAFYIPLTLILILYYKIYKAAKMLYHKRQASRI
AKEEMNGQVLLESGEKSTRLVSTPYMLEKSLSDPSTDFDKIHSTVKSPRSEFKHERSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSN
FLTWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRC*
137 >lcl|XP_001250528.1|Plus1481000..481929 NW_001501816 olfactory receptor 157-like LOC781968 __SEG__ Chr5 {Bos taurus} MALGNHSTITEFILLGLSADPHVQALSFVFFLAIYLLTLLGNLTMMLVIRTDSHLHTPMYFFLSHLSFLDFCFSSATVPKMLEILLSQKKTVSVEACLAQVFFVFDLGGT
EACLLSVMAYDRYAAICHPLLYGKKMSNQLCKGLVLGSWSLGFLDAFINILLAMDFDFCRDQFIPYYSCELPSLFPLSCSDVSTSFTILLCSSLLHGLGTCFLIILSYTL
IVSTILNIRSSSYRSKAFSTCSSHLTAVLLFYCSAFLRHIVPTLGSPQELIFSVQYSVITPLMNPLIYSLKNNEVKAAMQRTFRKYLHC*
138 >lcl|XP_001250601.3|Plus1complement(11463..11777) NW_001505433 protein kinase, cGMP-dependent, type I LOC786016 __SEG__ Chr26 {Bos taurus} MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASPLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQ*
139 >lcl|XP_001250692.2|Plus1complement(247128..248480) NW_001492979 COP9 constitutive photomorphogenic homolog subunit 2 COPS2 __SEG__ Chr11 {Bos taurus} MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEK
SINSILDYISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKK
LKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDI
TEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNS
LNQAVVSKLA*
140 >lcl|XP_001250694.2|Plus11225466..1226401 NW_001493517 olfactory receptor 959-like LOC782103 __SEG__ Chr17 {Bos taurus} MRNASVVTEFILLGIPHTEDLETMLFVLFLSFYIFTLMGNLLILLAIVSSAPLHTPMYFFLCKLSVCDMFFPSVSSPKMLFYLSGNSRAISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYTIIMSHRACAILATGTSFFGCIQATFLTTLTFQLPYCGPNEVDYFFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSRIV
CSILQIRSADGRKRAFSTCSAHLTAILLFYMPVVLIYLRPTPSPWMDATVQILNNLVTPMLNPLIYSLRNKEVKSSLRKVLYQLDILPEQR*
141 >lcl|XP_001250703.2|Plus182773..83708 NW_001494525 hypothetical protein LOC782117 __SEG__ Chr29 {Bos taurus} MDPGNHSSVTEFILAGLTEQPQLQLPLFLLFLGIYVVTMVGNLGMITLTGLSSHLHTPMYYFLTNLSFIDLCQSTVITPKMLVSFVTEKNIISYPECMTQLYFFIIFAIS
ESHMLAVMAYDRYVAICNPLLYNITMSYYICFCLTVGVYILGITGSTVHTGFMLRLFFCNTNIINHYFCDLFPLLELSCSSIYVNELLVLVLSAFNILTPDLTILTCYLF
ILSSILQINSPEGRSKALSTCSSHILAAAVFFGSAAFIYLKPSSVSSMDQGKMSSVFYTCIVPMLNPLIYSLWDKDVKFFLKKILERGKCI*
142 >lcl|XP_001250741.1|Plus157285..58262 NW_001495617 MAS proto-oncogene-like MAS1 __SEG__ Chr9 {Bos taurus} MDEANGTSFVAEEPSNASTSGNTSVKDPRREIPIVHWVIMSISPLGFVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSVDYALDYELSSGYYYTIVTLSV
TFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSEGQTHSRGDCRAVIIFIAILSFLVFTPLMVVSSTILVVKIRKNSWA
SHSSKLYLVITVTIIIFFIFAMPMRLLYLLYYEYWSTFKNLHHVSLLFSTINSSANPFIYFFVGSSRKKRFKESLKVVLTRAFKDEMQPRQPEDHTATTATETVV*
143 >lcl|XP_001250779.2|Plus1complement(68437..69369) NW_001494525 olfactory receptor 893-like LOC782191 __SEG__ Chr29 {Bos taurus} MTMENISSVSEFILMGLTDQPKLQLPLFSLFLLNYLVTVVGNLFLMILICLNSHLHTPMYFYLFNLSFIDLCYSSVFTPKMLISFISDRNVISFTGCMSQLFFFCFFVNS
ECYVLTAMAYDRYVAICKPLLYTVAMSPQVCSQLMSGSYAMGFAGAIVHTGSMMRLIFCDSNIINHYLCDIFPLLQLSCSSTYANEIVVSAVVGTVVILSSLIIFISYVL
ILFNILHIPSSKGWSKALTTCFSHITTVSLFYGFGLLTHVKLPSSRFVDQGKFFTVFSTNVVPMLNPFIYSLRNKDVKIAVKKILKRITN*
144 >lcl|XP_001250809.1|Plus1267499..268536 NW_001495589 trace amine associated receptor 6-like LOC783342 __SEG__ Chr9 {Bos taurus} MSSNSSPTAAVQLCYEHLNGSCVKTPYSPASRVILYMVYGFGAVLAVFGNLLVMTAILHFKQLHSPTNCLIASLACADFLVGVTVMPFSMVRTVESCWYFGRTFCTFHTC
FDVAFCYCSLFHLSFISIDRYIAVTEPLIYPIKFTVSVSCICISISWILPLTYSGAVFYTGANEKGLEELSSALNCVGGCQTVANQNWVLIDFLSFFIPTLVMIILYSNI
FLVARQQAKKIENTGSKTDSSSDSYKSRVAKRERKAAKTLGITVIAFMISWLPYSIDSLIDAFMGFITPAYIYETCCWCAYYNSAMNPLIYALFYPWFRKAIKVIVSGWV
FKDSSGSMNLSSEQM*
145 >lcl|XP_001250835.1|Plus1complement(54606..55532) NW_001494525 olfactory receptor Olr1242-like LOC782221 __SEG__ Chr29 {Bos taurus} MASGNGSFVTEFLLLGLTDQPDLQLPLFFLFLVIYTVTVLGNLGMTTLIGMNSHLHTPMYFFLFNLSFIDFCYSSVFTPKMLVTFLSKSNIISYVGCMTQLYFLCFFAIS
EIYVLTSMAYDRYVAICNPLLYNVVISPKVCSSLVLGSYLMAFSGAMAHTGNMLTLTICDANIINHFFCDMLPLLQLSCTSTHVNELVIFIVVGINIIVPSLTIFVSYGL
IFSSILHIKSMEGRSKALSTCTSHITAVSLFFGSGAFVYLKPSSAGSKDEGKISSVFYTNTVPLLNPLIYSLRNKDVKLALKKTLNKR*
146 >lcl|XP_001250863.1|Plus1256304..257335 NW_001495589 trace amine associated receptor 8-like LOC783380 __SEG__ Chr9 {Bos taurus} MNSSSPSVAAVQLCYKHLNGSCVKTPYSLGPRLILYTVFIFGAVLAVFGNLLVMISILHFKQLHSPTNFLIASLACADFMVGVTVMPFSIVRSVESCWYFGESYCQFHSC
FDVSFCLASIYHLCFISLDRYIAVTDPLVYPTRFTVSFSGMCIASSWLFSIIYSFSLLGTGANAVGLEDLVSALTCVGGCQIAMNQSWVLVNFLLFFIPTLVMIILYSKI
FLIAEQQARKIESLNIKTGRCSESYQDRVAKRERKAARTLGITVLAFLVSWLPYFLDAITDAFLGFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKV
LRANSSTVNLFSE*
147 >lcl|XP_001250919.1|Plus1complement(2964016..2965020) NW_001493954 BRISC complex subunit Abro1-like LOC782284 __SEG__ Chr20 {Bos taurus} MLTKVAFLKVIGWYRFRRNTQQQMSYGEQVIHKQLTRILGVPDLVFLLFSFISTANNSTHALEYVLFRPNRRYNQRISLAIANLGNTSQQEYKVSSVPNTSQSYAKVIKE
HGADFLDKDGVMKDIRAIYQVYNALQEKVQAVCADVEKSERVVESCQAEVNKLRRQITQRKNEKEQERRLQQAMVSRQMPPESVDPTFSPRMPYPGFTAEGRSTLGDTEA
SDPPPPYSDLHPNNQESTLSHSRMESSVFMPRPQAVGSSSYASTSAGLKYPVSGADAPPSHRAAGDSAEESDDSDYENLIDPTEPPNSEYSRSRDSRPMTHPDGGSRNTQ
TSQI*
148 >lcl|XP_001250921.2|Plus135569..36501 NW_001494524 olfactory receptor, family 10, subfamily G, member 9-like LOC782288 __SEG__ Chr29 {Bos taurus} MANASLVTTFILMGLPHAPELDMLLFGIFLVIYVLTVVGNLLIMLLIIVNPHLHTPMYYFLSNLSFIDMWYSTVTVPKMLMTLESPEGSPISFPSCVAQFYSFDFLGSTE
CFLYTVMSYDRFLAISYPLRYASMMSGRMCAILATTTWLSGSLHSAAQTTPTFHLPFCGPNQIQHYICDAPSILKLACADTSTVEMVIFVNIGLVALGCFLLIMLSYVSI
VHSILKIRTSEGRWRAFQTCASHCTVVLCFYVPLVFIYLRPGSKEVVDRIVAVFYTVMTPLLNPVVYTLRNKDVKKALLKLKKSVFIQSK*
149 >lcl|XP_001250927.2|Plus1complement(377222..378220) NW_001501883 olfactory receptor 772-like LOC782296 __SEG__ Chr5 {Bos taurus} MKHFNVNSIFNRTQQSAMRNSTVTTFILLGLTDDPQLQILLLIFLFLTYMLSITGNLTIIFLIFLDSHLKTAMYYFLQNFSFLEISFTSAYIPRYLYNIVTGDKVITYNA
CASQVFFTDLFGVTEFFLLAAMSYDRYVAICKPLHYVTIMSSMVCRRLVFCCWVAGLFIIIPPLSLGLELEFCDSNTIDHFICDASPLLKISCSNTWYMEQTVIICAVLT
LLMTLMCVVLSYIYIIKTILEFPSAQQKKKAFSTCSSHIIVVSITYGSCIFIYIKPSAKDSVAINKGVTMLTTSIAPVLNPFIYTLRNKQVKQAFNNSIKRITILSQKNK
RM*
150 >lcl|XP_001250928.1|Plus1complement(41399..42331) NW_001494525 olfactory receptor Olfr906-like LOC782297 __SEG__ Chr29 {Bos taurus} MAPGNGSFVTQFILMGLTDQPGLQLPLFFLFLGMYTVTVMGNLGLIILILLNSHLYTPMYFFLFNLSFIDLCYSSVFTPKMLINFLSNKNIISYMGCMAQLYFFCFFVIS
EIYVLTSMAYDHYVAICSPLLYNVVMSPKVCSSLMLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDILPLLQLSCTSTFINELVVFFVAGINIIVPSIAIFVSYGL
IFSNIFHISSTEGRSKALSTCSSHIIAVSLFFGSMSFMSLKPSSAGSMDDRRISSVFYTNVVAMMNPLIYSFRNKDVKTALRKTVSGIQF*
151 >lcl|XP_001250975.2|Plus1complement(22897..23829) NW_001494524 olfactory receptor Olr1308-like LOC782329 __SEG__ Chr29 {Bos taurus} MRNHTELNEFILLGMPQTQGLETVLLGIFLFIYPLTLLGNLLILLAIVSSSTLHTPMYFFLGLLSILDMLFPSVTCPKMLFYLSGQSRAISYKGCAVQLFFYHFLGSTEG
CLYSVMAYDRFVAICHPLRYMLIMRPGVCVGLVLAAWLLSYLHATVLIAFVFQLPYCGPNRVDHFFCDIPAVLTLACADSSLARRVSSTNVGFLVLMFWLCVCVSYTRIG
IAILRIRSAEGKQKAFSTCSAHLTAILCAFGPIIIVYLQPTPNPLLGATVQILNNTVSPMLNSLIYSLRNKEVKRSLKMVFYNVVFTALK*
152 >lcl|XP_001250981.2|Plus1complement(364695..365630) NW_001501883 olfactory receptor 800-like LOC782338 __SEG__ Chr5 {Bos taurus} MRNHTVTTFTLLGLTDDPQLKIVIFIFLFLTYMLSVTGNLTIISLTFIDSHLKTAMYFFLQNFSFLEISFTSACIPRYLYNISTGDKTIAYNNCISQIFFADLFGVTEFF
LLATMSYDRYVAICKPLHYMTIMNNMVCRRLILCCWMAGLLIIIPPLSLGLHLEFCDSNVIDHFFCDAVPLLKISCSETWLIEQMIIVCAVLTFIMTLLCVILSYVYIIK
TILQFPSAQQRKKAFSTCSSHSIVVSITYGSCIFIYVKPSAKESAGINKGVAMLSTSIAPMLNPFIYTLRNKQVKQAFGDAIKRIALFSKI*
153 >lcl|XP_001251012.1|Plus1complement(9410..10342) NW_001494524 olfactory receptor Olr1308-like LOC782366 __SEG__ Chr29 {Bos taurus} MRNHTELNEFILLGIPQTQGLETVLLGIFLFIYFFTLLGNLLILLAIVSSSTLHTPMYFFLGLLSILDMLFPSVTCPKMLFYLSGQSRAISYKGCAVQLFFYHFLGSTEG
CLYSVMAYDRFVAICHPLRYMLIMRPGVCVGLVLAAWLVGCLHATILTSFTFQLPYCGPSQVDHFFCDIPAVLPLACADSSLAQRVGSTNVGFLALMLWLSVCVSYTHIG
IAILRIRSAEGRQKAFSTCSAHLTAILCAYGPVIIIYLQPTPNPFLSAMVQILNNIVSPMLNSLIYSLRNKEVKSSLTRVFYNVVFTALD*
154 >lcl|XP_001251058.2|Plus1complement(332963..333916) NW_001501883 olfactory receptor 771-like LOC782430 __SEG__ Chr5 {Bos taurus} MENHTITTFILVGLTDDPQLQIPIFMFLFLTYMFSITGNLTIIFLTLMDPHLKTPMYYFLQNFALLEVSFTTACIPRYLYNIATGDRSITYAICIIQVFFTDVFGVTEFF
LLAIMSYDRYVAICKPLHYMTIMNSRVCQRLVLCCWISGLLIILPPLILFLNLKFCDSNIIDYFFCDASPILKISCSDTWLIEQLVIVSAVLTFILTLVCVALSYIYIIK
TIVRLPSSQQRKRAFSTCSSHMIVVSITYGSCIFVYVKPSAKESVAINKGVAVLMTSIAPMLNPFIYTLRNKQVRQAFSDSFKKLVLVSKKQKTAQA*
155 >lcl|XP_001251059.1|Plus126877..27839 NW_001494173 olfactory receptor, family 2, subfamily W, member 1-like LOC782431 __SEG__ Chr23 {Bos taurus} MDQRNYTSLHGFILLGFSDHPKLETVLSGVVTVFYLITLVGNTAIILASLLDSHLHTPMYFFLRNLSLLDLCFTTSIVPQMLVNLWGHDKTISYVGCIIQLYVYMWFGSI
ECLLLAVMSYDHFTAICKPLHYLVIMNPHLCLKMVIIVWSISLANSVVLCTLTLNLPRCGNNLLDHFLCELPAMVKIACIDTTAVEMSVFALGIVIVLTPLVLILISYGY
ITKAVLRMKSKAGQRKAINTCGSHLTVVSIFYGTIIYMYLQSGNNASKDQGKFLTLFYTIITPSLNPLIYTLRNKDMKDALKKLMRVDHKSTKSRRNWKS*
156 >lcl|XP_001251095.2|Plus1487584..488513 NW_001494525 olfactory receptor Olr1242-like LOC782465 __SEG__ Chr29 {Bos taurus} MAPGNGSSVTQFIFLGLTDQPDLQLPLFFLFLVMYMVTVMGNLGLLILIGLSSHLYMPMYFFLFNLSFIYLCYSSVFTLKMLINLISKKNIISYMGCMTQLYFLSFFVIS
ECYVLISMAYDRYVAICNPLLYNVAMTPKVCSSLMLGSYFMAFAGAMVLTECMLRLTFCEANTINHYMCDIMPLLKLSCTSTYVNELVDSITSGFNVIVPSITIFVSYVF
IFSNILQISSKEGRSKVFGTCSSHVIAVSLFFGSISFVYLKPSSAVSMDEGKISSVFYTNMVPLLNPLIYSLRNEDVKLALRKTLPRWF*
157 >lcl|XP_001251102.1|Plus141508..42479 NW_001494173 olfactory receptor, family 2, subfamily W, member 1-like LOC782475 __SEG__ Chr23 {Bos taurus} MGTSNGSSTTDFILLGFSDRPQLEHIISVVVFIFYIITLVGNTTIILVSYLDTQLHMPMYFFLSNLSFVDLCYTTSIIPQMLVNLWGPKKSITYGGCVLQFFFALDMGAT
ECLLLAVMAYDRYAAVCQPLHYTVIMHPELCQKMVLTAWLGGLGSALILCSLTLKLPRCGHQEVDNFFCEMPALIKMACVYSKVIEVVVFALGVVFLLVPLSLILISYGV
ITQAVMRIKSAARWQKILNTCGSHLTVVSLFYGTLIYMYMKPHTSTLQDEGKFLTLFYTIVTPSLNPLIYTLRNKDVKSAIKRILWIKKNGQQSHELSGKIRV*
158 >lcl|XP_001251177.1|Plus1complement(503658..504587) NW_001494525 olfactory receptor Olr1214-like LOC782544 __SEG__ Chr29 {Bos taurus} MAPGNESSVTEFILLGLTQQPGLQLPLFFIFLAVYVVTVVGNVGLIILIGLNPHLHTPMYYFLFNLSFIDLCNSSVITPKMLMSFVSQNIISYAECMTQLCFFSFFVIDE
CCILTSMAYDRYVAICKPLLYKVSMPRQVCLMLTVGVYAMGLVGAMAHTACMLRLSFCDGNIINHYMCDIPPLLQLSCTSTSINELVVFIVVGVNVIVPSVTIFISYTLI
LSNILHIRSAEGRSKAFSTCSSHIIVVSLFFGSSAFMYLKPFPAESLDEEKVSTVFYTIVGPMVNPFIYSLRNKDVQIALSKTLRKRVF*
159 >lcl|XP_001251282.2|Plus139079..40044 NW_001493320 olfactory receptor 16-like LOC782645 __SEG__ Chr15 {Bos taurus} MDNHTTVSTFLLWGFSSFPDLQDLLFVMVFFSHVTILAANVAVMVAVKLNHSLHIPMYFFLCGLFFSETCTAMVIIPRMLVDLLSDSKSISVFECATQMFFFFGLSGNNC
FIMAAMSYDRYTAIHNPLHYSVLMTRKICFQLMMAAWLVGFLVSMCIVTIVFNLSFCDSNTIQHFFCDISPVVCLACDYTLSYEMAIFVLSAFVLVGSFILIMISYVFIG
SIVMKMPSAEGRYKAFSTCSSHLTVVCTHYGFAGFVYLRPKSSDSFHEDMLMAVTYTVLTPLLNPIVYSLRNKEMQIALRKIVDSASRFILQVVNKRTLNI*
160 >lcl|XP_001251326.2|Plus158321..59253 NW_001493320 olfactory receptor 491-like LOC782678 __SEG__ Chr15 {Bos taurus} MEAGNHTSVTEFILLGLTEDPTLCGIFFVLFLGIYVIILVGNITIIILIASCSQLHSPMYLFLGHLAFVDIGCSTSVTPMMIIGFLRHRLALPVAGCEAQLCSMVMFGST
DCFLLAVMAYDRCVAICLPLFYSTRMCPRVCVLLVGGSYLGGCVNAWTFGSCLLTLSFCGPNQIDHFFCDFSPLLKLSCSDVSTIEIIPSISSGSILVITVSVISLSYIC
ILNTILKMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSSYSTEQNRVVSVFYTVLIPMLNPLIYSLRNRDVKEALRKAMVRIYS*
161 >lcl|XP_001251414.1|Plus1284968..285918 NW_001501922 olfactory receptor Olr1654-like LOC782766 __SEG__ Chr15 {Bos taurus} MKRQNQSSVVEFILLGFSNFPELQRQLFQVFLVIYLVTLIGNAIIIVVISLEQSLHVPLYLFLLNLSVVEVGFSAVIMPEMLVVLSSEKTVITFAGCFSQMYFILLFGGT
ECFLLGAMAYDRFAAICHPLSYPVTMNKRVFMKLITFSWVSGIIVATVQTTWVFSFPFCGPNEINHLSCETPPVLELACADTFLFEIYAFTGTILIVMVPFLLILLSYVR
ILFSILKMPSTTGRQKAFSTCASHLTSVTLFYGTANMTYLQPKSGYSPETKKLMSLAYSLLTPLLNPLIYSLRNSEMKRALMKLWQRKVDLHTFLN*
162 >lcl|XP_001251451.2|Plus1399329..400258 NW_001493368 hypothetical protein LOC782792 __SEG__ Chr15 {Bos taurus} MGQNNGTEVTEFILLGFTGQHKSWHVLFIVFLVIYVVALVGNIGMILLIKTDSSLHTPMYFFLQNLAFVDLCYATAITPKMLRNLMSTENSISFFGCMVQLLVYGTFVTS
DCYILGAMAVDRYVAICNPLRYGTVMSQRVCSQLLTASYFMGFLNASVNVGFTFSLKFCKSNKINHFFCDEPPILALSCSDIYFSIMVLAAFVGFNLTFTILVIIFSYMF
ILSAILKISSAAGRKKAFSTCASHLTAVTIFYGTLSYMYVHHSTIESQEQEKMASIFYGIVIPMLNPIIYSLRNQDVREALKGIGKKCS*
163 >lcl|XP_001251455.1|Plus1complement(637877..638812) NW_001494525 olfactory receptor 877-like LOC782797 __SEG__ Chr29 {Bos taurus} MAADNTSSVIEFILTGLTDQAQLKIPLFFLFLSFYVVTVVGNLGLITLIGLNSHLHIPMYFFLFNLSFIDFSYSTTLTPKMLMGFVSEKNIISYTGCITQFFFFCFFVFS
ESYILSAMAYDRYVAICKPLVYTVTMSPQVCLLLLLGVYGMGVFGAVAHMGNIMFMTFCGDNLVNHYMCDIIPLLELSCNSSYVNLLVVFIVVTIGIGVPIVTIFISYGF
ILSSILHISSTEGRSKAFSTCSSHIIVVSLFFGSGAFMYLKPPSILPLDQGKVSSVFYTAVVPMLNPLIYSLRNKDVKVALKKTLSIKIFS*
164 >lcl|XP_001251472.1|Plus126198..27796 NW_001494297 hypothetical protein ITPRIPL2 __SEG__ Chr25 {Bos taurus} MSVHYTLNLRVFWPLVTGLCTALVCLYHVLRGNAGARTEPPDGADGGFPLLKVAVLLLLGYILLRCRHAVRQRFLPGPPRMGGHSTFSAKHFPEPSLDILLESYYEHEVR
LSPHVLGHSKAHVSRIVGELVRAGRARGSPGPIPGGALALAFRGDFIQVGSAYEQHKIRRPDGFDVLVPLRLPPLVALEPRSLGSEPELAPAFHGCFVCALKAPPGASGG
HWLRDCKPFSDGFCVDVRGRRLLSATLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVHLGDSVFLVAPPPPPSPAGP
LSELPEGLRADALWGLNTARQEQKLLSWLQERAPPGACYLKCLQLLKALRDLGARGLDPTAAAQWGRILSSYVLKSALLAVLQREGAPAPGWDEAHLGDRLEELVQFLRD
CLLRRRTLFHCVLGPGGAATEVGPLPKVLREAAPVDLLAAFDRQVRELAAARLLSTWRRLPQLLRAYGGPRYLVRCPPPRSQRTQGFPEDEP*
165 >lcl|XP_001251517.2|Plus1complement(135206..136144) NW_001493320 olfactory receptor 467-like LOC782865 __SEG__ Chr15 {Bos taurus} MEIGNHTMVTEFVILGLTDHPTLCSIFFLVFLGIYVATILGNISIITLIHRSPQLHTPMYLFLSHLAFVDIGYSSSVTPIMIVSFLEVRTTIPVAGCIVQLGSDVIFGTA
ECFLLAAMAYDRYVAICSPLLYSTYMSPRVCVILLIASYLGGCVNASSFIGCLLSLTFCGPNKINHFFCDLPPLVKLSCTHVYVAEISPAISAGSIIVITLFTIIVSYLY
ILHSILKMCSTEGRSKAFSTCTSHLTAVTLFYGTVTFVYVIPKSSYSPDHIKVVSVFYTVVIPMLNPLIYSLRNKEVKEAMRKLMTKIHQSF*
166 >lcl|XP_001251528.3|Plus1complement(666860..667810) NW_003101172 olfactory receptor 78-like LOC782875 __SEG__ Chr15 {Bos taurus} MASINMSYLNPRTVILIGIPGLQHMQFWIGFPFFAVCLVALLGNIILLIIIPMERSLHQPMYIFLAVLAATDIGLCAAIAPKMLAIFWFRSYSMAFDTCLAQLFFIHALQ
CMESGILLAMALDRYIAICDPLRHTSILTPSVLGRMVVIVAIRATVLVGLLPILIKRLHRFHSTVIAHSYCEHMAVVKLAAEDIRVNNTCGLFVGFTILGFDMIFILISY
TLIFQAVLRLHQKEARLKAFNTCTAHIFVFLEFYILAFFSFFSHRFGHVVPSTHILLSTIYLLVPPALNPIVYGVKNKVICKHVAQVLLLNHGSQQ*
167 >lcl|XP_001251594.2|Plus1488505..489434 NW_001493368 olfactory receptor 480-like LOC782933 __SEG__ Chr15 {Bos taurus} MEQNNGTTVTEFILLGFADQHKSWHVLFTVFLVIYVVTLVGNIGMILLIKTDSSLHTPMYFFLQNLAFVDLCYTSAITPKMLQSFVETKQSISFIGCMVQLLVYGAFATS
DCYILAAMAVDRYVAICNPLRYETVMSQRVCSQLLTASYFMGFLNASVNTSFAFSLNFCKSNKISHFFCDAPPILALSCSSIYLNIMLLTVFVGFNLTFTVSVVIFSYVF
ILIAILKISSAAGRKKAFSTCVSHLTAVSIFYGTLSYMYLHHRTIESQEQEKMASVFYGIIIPMLNPLIYSLRNQDVREALKGVGKKCF*
168 >lcl|XP_001251600.2|Plus1643816..644760 NW_003101172 olfactory receptor 600 (predicted)-like LOC782941 __SEG__ Chr15 {Bos taurus} MSSCNNSIPQPLIFVLAGIPGLESSHVWFSVPFFLVFVVAVIGNATILCIIRVEKSLHEPMFLLLAMLSVVDLSLVSVTVPRMLGIFWMNAKEISFNACLTQMFFIPSFY
VMESGVLLAMAFDRFVAIWHPLRYTTVLSNSLLAKMALTVLARAVAVLTPAPILVKRLESFQTHIIAYSYCAYMAVVHIACGDLSDHIVYGLMVIVASVGFDLFFIILSY
GLILHAVFRIPSWEARGKAFSTCGSHLCVIALFYSPVIFSVLAQILCYHMAPHLQIIIDNLYFLVPPMINPLIYGARTKQMREWVLRIFHCEGD*
169 >lcl|XP_001251658.1|Plus11079093..1080037 NW_001494173 olfactory receptor Olr1654-like LOC783002 __SEG__ Chr23 {Bos taurus} MNRINESVPPQEFILLGFSDRPRLELPLFVVFLISYILTILGNLAIIIVSRLDSKLHTPMYFFLTNLSLLDLCYTTSTVPQMLVNIRSIRKVISYGGCVAQLFIFLALGS
TECLLLAVMSFDRFAAICRPLHYSVIMHQRLCLQLAAMSWVSGFSNSVLQSTLTLQMPLCGHNEVDHFFCEVPALLRLSCVDTTANEAELFFISVLFLLIPVTLILISYA
FIVQAVLKIQSVEGRRKAFGTCGSHLIVVSLFYGTAIYMYLQPPSPASKDRGKMVSLFYGIITPMLNPLIYTLRNKDVKGAFKSLIAKIFLIKK*
170 >lcl|XP_001251835.1|Plus1complement(969186..970148) NW_001494173 olfactory receptor Olr1654-like LOC783203 __SEG__ Chr23 {Bos taurus} MNRINESVPQEFILLGFSDRPWLELPLFVVFLISYILTILGNLAIIIVSRLDSKLHTPMYFFLTNLSLLDLCYTTSTVPQMLVNIRSIRKVISYGGCVAQLFISLALGST
ECLLLAVMSFDRFVAICRPLHYSVIMHQRLCLQLAAMSWVSGFSNSVLQSTLTLQMPLCGHNEVDHFFCEVPALLRLSCVDTTANEAELFFISVLFLLIPVTLILISYAF
IVQAVLRIQSVEGRRKAFGTCGSHLIVVSLFYGTAIYMYLQPPSPASKDRGKMVSLFYGIITPMLNPLIYTLRNKDVKGAFKRLIARILLIKKYPSDRPC*
171 >lcl|XP_001251837.2|Plus1867706..868638 NW_001494525 olfactory receptor Olr1194-like LOC783205 __SEG__ Chr29 {Bos taurus} MAAENHSTVTEFILGGLTNRPELQLPLFFLFLGIYSVTMVGNLGMITLICLNAQLHTPMYYFLSNLSLVDLCYSSVTTPKMLVNFVSGKNTISYAGCMAQLYFFLVFVIA
ECYMLTVMAYDRYVAICRPLLYNIIMSHRVCSLLVAGVYIMGLIGSTIETGLMLKLPYCEHLIISHYFCDILPLMKLSCSSTYDVEMTVFFLAGFNIVVTSLTVLISYAF
ILSSILRISTTEGRSKAFSTCSSHFAAVGIFYGTTAFMYLKPSTASSLAQENVASVFYTTVIPMLNPLIYSLRNKEVKAAMQKTLREKLF*
172 >lcl|XP_001251839.2|Plus1complement(565100..566044) NW_001501922 olfactory receptor 491-like LOC783210 __SEG__ Chr15 {Bos taurus} MEAGNHTSVTDFILLGLTEDPTLCVIFFVVFVGIYVITLIGNISIIILIRSCSHLHTPMYFFLSHLAFVDMGFSTSITPMMIIGLLKHRLALPVAGCEAQLCSGVTFGTT
ECFLLAAMAYDRYVAICLPLLYSTRMSPRVCVILVGACYLGGCVNAWTFGSCLLTLSFCGPNQVDHFFCDFSPLLKLSCSDVSIIEIIPSISSGSIIVVTVSVIALSYIC
ILNTILKMCSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSSYSTEQNKVLSVFYTVLIPMLNPLIYSLRNRDVKKALRKQVSEYILRIYS*
173 >lcl|XP_001251949.2|Plus1complement(911633..912577) NW_001494173 olfactory receptor 1365-like LOC783311 __SEG__ Chr23 {Bos taurus} MERANDSAFSGFILLGFSNQPQLETALFAVILIIYSLSCLGNGAIMLLSTMDPHLHSPMYFFLSNLSFMDLCLTTCTVPQTLANFKGKDKTITYGGCVAQLFIALGLGGV
ECVLLSVMAYDRYVAVCRPLHYMVIVHPQLCLQLVVTAWLTGFGNSVVQTALTMTLPLCGKNQVDHFFCEVPVMLKLACTNTSVNEAELFAVSVFFLVVPLSLILVSYGH
ITCAVLKIKSAQGRQKAFGTCGSHLMVVIIFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLLNPLIYTLRNKEVKGALRRQMRRILDLRQS*
174 >lcl|XP_001251951.2|Plus1complement(530138..531106) NW_001494312 olfactory receptor, family 7, subfamily A, member 17-like LOC783313 __SEG__ Chr25 {Bos taurus} MEPWNLTGVSEFVLLGFSKEEELQTLIFVIFLSMYLITVFGNLLIILATVYDSHLHTPMYFFLSNLSFADICFTTTTVPKMLVNIQTQSKVITYAGCITQMYFFLFFSGL
DIYLLTVMAYDRFVAICHPLHYMVIMNPRLCGLLLLVTWIISVLHSLLQSLMVLRLSFCTDVEIPHFFCELNQMVQLACCDTFLNNMVMYFAAVLLAGGPLAAILFSYSK
IVSSIRGISSAQGKQAAFSTCMSHLSVVSLFFCTSLGVYLSSAATHRSHSSAKASVMYAVVTPMLNPFIYSLRNKDIKGALKRFLGMAVIKGTVVTGLKSCL*
175 >lcl|XP_001251957.2|Plus1complement(555574..556533) NW_003101172 olfactory receptor 630-like LOC783323 __SEG__ Chr15 {Bos taurus} METANSSNILSSTFYLTGIPGYEQFHHWISIPFCLLYLLGIVGNSTILHIVWTDPRLHEPMYYFLAMLSLTDMGMSLPTMISLFRVLWSISREIQFNACVVQMFFIHTFS
FTESSVLLAMALDRYVAICHPLQYATILTPTLITKIGIAALLRSALPVIPLLARLAFFPFCHSHTLSHSYCLHQDVIRLACADTKFNVIYGLVLITLLWGMDSLGIFVSY
VFILHSVLKISSQEGRFKALNTCASHICAVLILYVPMIGLSIVHRFAKHSSPLIHIFMAHIYLLVPPVLNPVIYSVKNKKIRQGVLCLLFPLKISSSVM*
176 >lcl|XP_001251985.3|Plus1555069..556007 NW_001494312 olfactory receptor, family 7, subfamily A, member 17-like LOC783355 __SEG__ Chr25 {Bos taurus} MEQENHTQFSGFLLLGLSDEAELQPLLFWLFLSMYLITIAGNLLIILTTIYDSHLHTPMYFFLSNLSFSDICFTSTTIPKMLLNLYIQNKGITYEGCLTQLYFFILFAEL
DIFLLSVMAYDRFVAICHPLRYTTKMTPQLCGLLLLASWILSVLDSLLRSLLVLRLSFCTDLEIPHFFCEINQVIQLACSDNLLSIIEMCFATVLMGIIPLSGIVVSYSR
IVSSILRITSARGKYKAFSTCGSHLSVVCLFYGTGLGVYLSSATTQNSRTSAIASVMYTVVTPMLNPFIYSLRNKDIKGALESLVTTLAFSE*
177 >lcl|XP_001252054.2|Plus1502797..>503744 NW_003101172 olfactory receptor Olr104 (predicted)-like LOC783446 __SEG__ Chr15 {Bos taurus} MADSNHTGTSFFLTGLPGLEAGHTWLSIPLCAMYVAALVGNSLILWVVRSEPSLHQPMYYFLSMLAMTDLGLSASTLPTMLSIYMLGVREVALDVCLAQLFFIHTFSIME
SSVLLAMAFDRFVAISKPLHYGTILTSPRIARLGLVIVVRSIGLHIPAPIMLKQLPYCRTRLLSHSYCLHPDVMKLACADTHTNSVYGLFVVLSTLGVDSVLIVLSYGLI
LQTVLSIASKAERLKALNTCVSHICAVLLFYTPMIGLSMIHRFGRRASPSSHVLLSYLHFLTPPLLNPVVYTIKTRQIRLKMLHLFRSDRTGIRDL
178 >lcl|XP_001252108.2|Plus1complement(459356..460324) NW_001493322 olfactory receptor, family 10, subfamily A, member 5-like LOC783518 __SEG__ Chr15 {Bos taurus} MVEGNWTKVNEFSLMSFSSLPTEIQSLIFLTFLFIYLVTLLGNSLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGV
SECFLLATMAYDRYVAICSPLHYPVIMNPRTRAKLAAVSWFPGIPMATVQTTWLFSFPFCGINKVNHFFCDSPPVLRLICADTALFEIYAIIGTILVVMIPCLLILCSYT
RIAAAILKIPSAKGKHKAFSTCSSHLLVVSLFYVSLSLTYFRPKSNNSPESKKVLSLCYTVVTPMLNPIIYSLRNSEVKNALGRTFHKAMGVRTAFCRHFEV*
179 >lcl|XP_001252136.1|Plus1complement(460540..461496) NW_003101172 Olfactory receptor 614-like LOC783558 __SEG__ Chr15 {Bos taurus} MWSFNHTVSNWPTFSFIGIPGLEAAQIWISIPFCLLYLLALMGNALLLILVKAEHNLHEPQFYFLAVLALTDLGLSLSTMPSVLAIFWFNVHSIGLDACLTQMFFIHTLS
SVESGVLVAMAFDRLVAICAPLNYTRILTHSTVACLSGAAVIRGATLVAPLPFLLRTFPFCGANILSHSYCYYPDMLNLACGDIIFSGVYGLVFVLFTFAVDVVFILVSY
MKILATVIKLGNQDRNWKSLHTCACHLCTVCVFYLPLISLAVLHHYTQNTSPILFTSMSNAYLLMTPLLNPLVYSLKSRQIQAALRKRFWVQRIIAGE*
180 >lcl|XP_001252157.2|Plus1complement(420019..420975) NW_003101172 olfactory receptor Olr110-like LOC783597 __SEG__ Chr15 {Bos taurus} MATSSNYTNLRDIWYTMIGIPGLEDAHTWISIPICSMYIVAVVGNTLLLFLIFTERSLHEPMYLFLSMLALADIFLSTVTTPKMLAIFWFQEVGISFSSCVSQMFFLHFI
FVAESAILLAMAFDRYVAICYPLRYTTILTPSVIGKIGIASIIRSFLICFPLVFLVYRLTYCGRNIIHHSYCEHMGIARLACDNIQVNIYYGVIVALFSTCLDVVLIIIS
YALILCTVLRIPSQDAQLKALGTCGSHVCVILLFYTPAFFSFFAHRFGGHSIPLHIHILLANLYVVVPPTLNPIIYGVKTKQIQEKFIQVFSLSKKFC*
181 >lcl|XP_001252210.1|Plus1complement(390323..391264) NW_003101172 olfactory receptor 78-like LOC783671 __SEG__ Chr15 {Bos taurus} MSASSASNINSSIFIFTGFPGLEQYYPWFSVPFSLIYAVVFLGNCLVLHVVHTEPSLHKPVFYFLAMLALTDLFMGLSTVYTVLGTMWGLSQEIGLDACVSQTYFVHGLS
FMESGVLLAMAFDRFIAICNPLRYTSILTNSRIIYFMVTILTRSSLSILPVIIRLKFFPYCRPHILSHSFCLHQDLLRLACSDIRFNSFYALALVVCTLLLDAVLILISY
VFILHTVLAIASRKERLKALETCVSHLCAVLVFYIPIIGLTMVHRFGKHLSPLVHVLMGNIYILFPPMMNPIIYSVKTQQIRSRMKKWFSLKM*
182 >lcl|XP_001252222.2|Plus11515343..1516272 NW_001493845 olfactory receptor, family 5, subfamily I, member 1-like LOC783690 __SEG__ Chr1 {Bos taurus} MDMMEANKTLVMEFVLTGLTDLPGLQVPLFLVFLVIYLTTMVGNLGLIFLIWKDPHLHTPMYSFLGSLAFADACSSSSVTPKMLINFLSVNHTISLVECISQFYIFASSA
NTECFLLVVMAYDRYVAICNPLLYPMVMYNIFCTQLIGVSYIIGFLHPMMHVGLLFRLTFCKSNVIHYFYCEILQLFKMSCTDPRVNMLLIFVFSVFIQSFTFMSIIISY
THVLLAVLKKKSAKGRNKAFSTCSAHLLSVSLFYGTLFFMYVRPGSRSAEKQDKLYSLFYTIIIPLLNPFIYSLRNKEVIGALKRIINK*
183 >lcl|XP_001252229.3|Plus1complement(1083457..1084878) NW_001494541 G protein-coupled receptor 152-like GPR152 __SEG__ Chr29 {Bos taurus} MPSLIHQVPTPCPVRHWGPQIDTAMEASLGAPGRWPRTELDDEDYPQGGWDTVFLVALLLLGLPANGLMAWLAGSQARQGAGTRLALLLLSLALSDFLFLAAAAFQIMEI
QHGGHWPLGTAACRFYYFLWGVSYSSGLFLLATLSLDRCLLALCPRWYPERRPARLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLVICLDFWDSEELPLRMLEILGG
FLPFLVLVVCHVLTQAAACRPCRRQPGAPACRGFARVAKTILSAYVVLRLPYQLAQLLYLAFLWDFYPGYLLWEALVYSDYLILLNSCLSPFLCLLASTDLRALLRAMLA
SFAAALCEERPGSFMPADPQTQVDSGDQTVPGPVAEAEPQVNPTAQPQVNPEAKQQVNPAAQPQEDDEGPPQPDSGAQSQASPKAQPPGPTTSSAPSACEEASSTPAMDS
TLEAPMNPATPAASEGEGPSGAPREEAPGAGPT*
184 >lcl|XP_001252271.2|Plus11548882..1549808 NW_001493845 olfactory receptor, family 5, subfamily I, member 1-like LOC783777 __SEG__ Chr1 {Bos taurus} MAENNCSLATEFILIGFTEHPDLRILLFLVFFIIFLITMVGNLGLVALIVTEQCLHTPMYIFLGNLALMDSCCSCAITPKMLENFFSKDKMISLYECMVQFYFLCLAESA
DSFLLAAMACDCFVAICKPLQYHIMMSQKLCIQMTTGAYVAGNLHSMIHVGFLFRLTFRGSHQINHFFCDVLPLYRLSCVDPYINELMIFIFGGSVQIFTITIVIISYLY
IIFTIFKMKSKEGRKKALSTCASHFLSVSIFYGSLLFTYIRPNSVNEEDKDLPVAIFYTLVIPLLNPFIYSLRNKEVINVMKKIMNIS*
185 >lcl|XP_001252293.2|Plus11571630..1572568 NW_001493845 olfactory receptor, family 5, subfamily I, member 1-like LOC783812 __SEG__ Chr1 {Bos taurus} METKNATEVREFILTGLTHQPEWQIPLFLLFFMIYLITVMGNTGLIALIYNDPQLHIPMYSFLGNLAFVDTWLSSTVTPKMLVNFLGKSKTISLSECKVQFFSFAISVTT
ECFLLATMAYDRYAAICKPLLYPVIMTNRLCMQLLVSSFVGGLIHALIHTGFLFRLTFCNSNIILHFYCDVMPLIKISCTDPSINVLMIFIFSGSIQVFTILIVLVSYTL
VLFTILKKKSLQGLRKAFSTCGAHLLSVSLYYGPLLFMYVRPGSTQADDQDMMDSLFYTVIIPFLNPIIYSLRNKKVIDSLTKMLKRDGCIS*
186 >lcl|XP_001252315.2|Plus1<1577321..1578292 NW_001493845 olfactory receptor, family 5, subfamily I, member 1-like LOC783843 __SEG__ Chr1 {Bos taurus} FHLLHLFQRLSIKDMETKNATELTEFILTGLIHQPEWQIPLFLLFLMIYLITIMGNLGLIALIYNDPHLHIPMYLFLGSLAFVDAWVSSTVTPKMLVNFLGKSKMTSLSE
CRAQFFSFVISVTTECFLLSTMAYDRYVAICKPLLYPVIMTNRLCMQLVVLSFLGGLIHSTIHTGLLFRVTFCNSNIIHHFYCDIMPLIKISCTDPSINVLMVSIFSGSI
QVFTILIVLISYSLILFTILKKKSIQGIRKAFSTCGAHLLSVSLYYGPLLFMYVHPGSEQADDQDMIDSLFYTVIIPFLNPIIYSLRNKKVIDSLTKVLKRYS*
187 >lcl|XP_001252342.2|Plus11600963..1601892 NW_001493845 olfactory receptor, family 5, subfamily I, member 1-like LOC783884 __SEG__ Chr1 {Bos taurus} METKNATELTEFVLTGLTYEPVWQVPLFLLFLIIYLITITGNLGLIVLIWNDPHLQIPMYLFLGNLALVDIWLSSTVTPKMLVNIINQNKRISLSECMVQFFLFVVSATT
ECFLLAMMSYDRYLAICNPLLYPAIMTHRQCMGMLVSSFVGGLFHALIHTGFLFRLTFCNDNIIHHFYCDIMPLFKISCTDPSINVLMIFIFSGSIQVFTILIVLISYTL
VLFTILKKKSAQGIRKAFSTCGAHLLSVSLYYGPLLFMYVRPGSTQADDQDMMDSLFYTVIIPFLNPIIYSLRNKKVIYSLLKILKRNI*
188 >lcl|XP_001252404.1|Plus11626470..1627024 NW_001493491 BCL2-like 10 (apoptosis facilitator)-like LOC783956 __SEG__ Chr17 {Bos taurus} MVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKR
DDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQSFQPSWERQLVWFFLSYWTAIIIIYFWIKLS*
189 >lcl|XP_001252432.1|Plus11682839..1683768 NW_001493845 hypothetical protein LOC783995 __SEG__ Chr1 {Bos taurus} MDPKNATLLSMFVLTGLPYQLEWQIPLFLLFLAIYLITTVGNLGLIYLIYNDPRLHIPMYLFLGSLAFVDSWISSTVTPKMLVNFFARSKMISLSECMLQFLSFAFGGTT
ECFLLATMAYDRYVAICKPLLYPVIMTNKLCIQLLVSSFVAGLIHPMIHVGALFRLTFCKSNIIHHFYCDVMPLFRISCIDPSINVLMVFISSGSIQVCSIMTVLVSYTF
VLHTVLKNKSVQGIRKAFSTCGAHLLSVSLYYGTLLFMCVRPGSTQADDQDMMDSLFYTVIIPLLNPIIYSLRNKKVIDSLTKVLKRNI*
190 >lcl|XP_001252435.2|Plus1complement(1956616..1957551) NW_001492801 olfactory receptor 738-like LOC783998 __SEG__ Chr10 {Bos taurus} MKISNTPNTSSTITGFILLGFPCPREGQILLFVLFSALYLLTLMGNGSIICAVSWDQRLHTPMYILLANFSFLEIWYVTSTVPNMLANFLSDNKFISFSGCFLQFYFFFS
LGSTECFFLAIMAFDRYLAICWPLHYPTLMTGRLCANLVISCWVLGFLWFLIPIIIISQMSFCGSRIIDHFLCDPGPLLALTCTRVPVIELTSSTLSSLLLFIPFLFTMV
SYALVLQAVLKFPSSAGRRKAFSTCGSHLTVVSLFYGSVMVMYVSPTSEHDAGMQKIVTLFYSVVTPLINPVIYSLRNKDMKHAMKKLLGT*
191 >lcl|XP_001252469.1|Plus1262557..263513 NW_003101172 olfactory receptor, family 52, subfamily A, member 5 (predicted)-like LOC784043 __SEG__ Chr15 {Bos taurus} MLRPNGSVFTPSVLTLIGIPGLESVQCWIGIPFCFMYLMAVIGNTLILVIIKYENSLHSPMYIFLAMLGATDIALSTCILPRMLGIFWFHLTEISFDACLLQMWLIHSFQ
ATESGVLLAMALDRYVAICNPLRHASIFSQKLLTHIGIGVVLRAIVLVAPCIVLIKYRLKFYRTTVISHSYCEHMAIVKLATEDIRINKILGLFVAFTILGFDISFITLS
YFQIFVTVFQLPQKEARLKAFNTCIAHICVFLQFYLLGFFSFFTHRFGSHIPPYVHILLSSLYLLVPPFLNPIVYGVKTKQIRDRVLKMIFSKRHPDH*
192 >lcl|XP_001252476.1|Plus1337922..338947 NW_001493674 transducer of ERBB2, 1 isoform 1 TOB1 __SEG__ Chr19 {Bos taurus} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHVGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPVSDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGNQQQPQQQQQPSQPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQY
SNQQFQPVMAN*
193 >lcl|XP_001252701.2|Plus1complement(72141..73064) NW_003101172 olfactory receptor, family 51, subfamily E, member 2-like LOC784376 __SEG__ Chr15 {Bos taurus} MSLPNNTSFHLSTFLLLGIPGMEAIHTWISMPFCLGNFSILFIIRTDSNLHEPMYFFLCMLSVADLILSTTAMPKILSIFWFHDREIYFEACLVQVFLIHSLCSMASGFI
LAMAFDRYVAICNPLRHSIILAHRVIQNLGLVTIFCGVVLYTPQPFMLWWLSYCRANVIPHNYCEFMPLIKLACAETRICRTYSLTAAFFTGGLDLILILCSYVVILFTV
FHLPSEAAQLKTMGTCGSHVCLILVAYTPVFLSFLTHRFGHHMAPHIHIFVAKIFVLIPPMVNPMTYGIRTKRIRECPLQLFTSHKL*
194 >lcl|XP_001252703.2|Plus1complement(32172..33137) NW_001502241 olfactory receptor, family 51, subfamily G, member 1 (predicted)-like LOC784379 __SEG__ Chr15 {Bos taurus} MRILYNSSLQKATFFLTGFQGLEDLHGWISIPFCFIYLTVIVGNLSIIHVIRTDVTLHEPMYYFLAMLALTDLGLCLSTLPTVMGIFWFDAREIGIPACFTQLFFIHTLS
LVESSVLLSMSIDRYVAICNPLRYSTVLTPARIIRMGLSSVFRSALLILPLPFLLKRFQYCHSHVLAHAYCLHLEIMKLACSSIIVNHIYGLFVMACTVGVDSLLIFLSY
ALILRTVLSIASHHERLRALNTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRTVHLLMSYVYLLAPPLMNPIVYSIKTKQIRQRIVKKFELIKSLRGFQQD*
195 >lcl|XP_001252728.1|Plus1complement(43444..44397) NW_001502241 olfactory receptor 78-like LOC784411 __SEG__ Chr15 {Bos taurus} MAPLNDTNIEVLRFFLIGIPGLEKSHFWISIPFSSVYFLSLLGNFTILFFIKTEPSLHEPTHYFLSMLSISDLGLSLSFSPITLGLFLFGVHGIHAATCFAQEFFIHLFT
VIEASVLLVMAFDQYVAMHHPLRYSTILTSSQVIKTGVLLTSKNIMLILPLPFLLQRLTYCHQNLLLHSYCLHQGVMKVACSDNRVNVVYGLCATLSSILDLLFITFSYM
MILKTVLGIATPREQPKALNTHISHICAVLIFCVPVLSAAMLHQFASGVSPMIHILMADVFLLVPLLMNPIVSCVKTHQIRKKVMGKFCSKRSLSMQ*
196 >lcl|XP_001252744.1|Plus1complement(44341..45285) NW_003101172 olfactory receptor Olr94-like LOC784435 __SEG__ Chr15 {Bos taurus} MSLPNNTNIYPSTFLLLGIPGMEAIHTWISMPFCLIYLTALLGNCSILFIIRTDSNLHEPMYFFLCMLSVADLILSTTAMPKILSIFWFHDREIYFEACLVQVFLIHSLC
SMASGFILAMAFDRYVAICNPLRHSIILSHRVIQNLGLAIVFHGVVLFSPQPFMLRWLPYCRTNVIPHTYCEFMALIKLACAETRICRIYSLTAAFLTGGLDFLLILCSY
VVILYTVFHLPSKAAQLKTLGTCGSHVCVILVAYTPAFFSFLTHRFGHHVAPHIPIFVANIYVLVPPMVNPMIYGIRTKRIRERFLHVLTSHKF*
197 >lcl|XP_001252759.1|Plus1complement(2142492..2143478) NW_001492801 olfactory receptor 744-like LOC784455 __SEG__ Chr10 {Bos taurus} MNISESASHSESVREFILLGFPCSREIQVILFMFFSIVYLLTLIGNGAIICAVCWDQHLHTPMYILLGNFAFLEIWYVNSTVPNTLINFLSESKAISFTGCFLQLYFFFS
MGSTECFFLSAMSFDRYFAICRPLNYATIMTGRRCFNLVIACWVCGFLWYLVPVILISQLSFCGPNAIDHFVCDSGPLLTLSCVPAPMSKLTSYTLSALIILLSFLFILI
SYALVLLAVLRLPSASSRQKAFSTCGSHLAAVLLFYGTVMVMHVSPGSSHSTLLPKIMTLFYAMVTPLINPLIYSLRNKDMKKALWKVLEKFKISFKVFGSRRRRNVG*
198 >lcl|XP_001252812.1|Plus193564..94511 NW_001502241 olfactory receptor, family 51, subfamily L, member 1 (predicted)-like LOC784542 __SEG__ Chr15 {Bos taurus} MVVWNNSDTMEPIFILRGFPGLEYVHSHLSIPFCLAYLLAFIGNATVLSVIWTESSLHQPMYYFLSMLALTDLGMSLSTLPTMLAVLCLDVREIQASACYAQLFFIHTFT
FLESSVLLAMAFDRFVAICHPLHYTTILTNSVIGKVGLACLLRSMGVVLPTPLLLRHYHCCHASALSHAFCLHQDVLKLSCSGARISSVYGLSVVIATLGVDSVFILLSY
VLILKAVLGIASHEEQLKALNTCVSHMCVVLIFFVPVIGVSMVHRFGKHLSPIIHILMADIYLLLPPVLNPVVYSIRTKQIRLGILCKFGIRRRF*
199 >lcl|XP_001252837.2|Plus1complement(4184..5128) NW_003101172 olfactory receptor, family 51, subfamily E, member 2-like LOC784566 __SEG__ Chr15 {Bos taurus} MPPLNTSHPSPVTFSLMGIPGLEHLHVWIGIPFCSMYVVAVVGNVTILAVVRTERSLHKPMFLFLCMLSVTDLVLSTSTLPRMLCLFWLGAHDIAFDACLTQMFFIHSFT
AMESGFFLSMAIDRYVAICHPLRHTTILTHTRIAKMGASVVLRGVAFFSPHPVLLRQLPYCRTRIIAHTYCEFMAVVKLACVDTGPTKRYSLSMAFVIGSCDGLFIVVSY
VLILRAVFHLPSREASLKALGTCVSHVCVILVFYSTAVFTFLTHRFGHSVAPHIHIFIANIYLLVPPFLNPIVYGIRTKKIRDHVLSSLRVKVA*
200 >lcl|XP_001252838.2|Plus1101439..102380 NW_001502241 cOR51P3 olfactory receptor family 51 subfamily P-like LOC784568 __SEG__ Chr15 {Bos taurus} MSVFNDSVLYPCFLLTGFSGLESRYGLISLPIFLVYATSVAGNITILFIIRTEPSLHQPMYYFLSMLAFTDLGLSTTTLPTMFSVFWFHAREISFNGCLVQMYFIHVFSI
IESAVLLAMAFDRLVAIRAPLRYAAILTNDVIIGIALAITGRALALVFPASFLLKRLQYRPVNILSYPFCLHQDLIKTTVSSRRVSSIYGLMVVICSMGLDSVLLLLSYI
LILGTVLSIASRTERVKALNTCISHICAVLTFYTPMIGLSMIHRYGQNASPFVHVFMANVYLLVPPLMNPIVYSVKTKQIRDRILKKFNQQKV*
201 >lcl|XP_001252882.1|Plus1405809..406762 NW_001501889 hypothetical protein LOC784623 __SEG__ Chr15 {Bos taurus} MIPRENSTVVIEFILAGITDDSQLQIPLFLVFTLIYLLTLVGNLGVITLILLDSRLHTPMYFFLSNLALVDFGYSTAVTPKVMAGFLTGDKVISYNACVAQLFFFGGFLS
VETFLLALMAYDRHAAVCKPLHYTNIMTPRVCAWIVIGSYVFGFLEISVHTWNIFSLSFCRSYVIDHFFCDATPLLALSCSKSNRSEMVLFLFVGFNVLLSNLVILVSYL
FIFVTILRMRSSGGHQKAFSTCASHLTAVSIFYGTASFMYFQPGSRHSMSTDKMASVFYAIVIPMLNPLIYSLRNKEVKRVLKKAVGKAKSSLIFKI*
202 >lcl|XP_001252902.1|Plus1103942..104883 NW_001494174 olfactory receptor, family 2, subfamily B, member 3-like LOC784652 __SEG__ Chr23 {Bos taurus} MNWANESSPKEFVLLGFSDKPWLQKPLFILLLISYTTTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLTNISHNKKTISYAGCVAQLITFLALGAT
ECLLLAVMSFDRYVAICRPLHYVVIMNPWFCLRMIAFSWFTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVAELFFFSVLILLIPVTLILISYGF
IAQAVLRIKSAEGRRKAFGTCGSHMVVVSLFFGTSIYMYLQPPSSTSKDWGKIISLFYGIFTPMLNPLIYSLRNKDMKEAFKRLMLLTFYYKK*
203 >lcl|XP_001252923.1|Plus1113986..114927 NW_001494174 olfactory receptor 1370-like LOC784681 __SEG__ Chr23 {Bos taurus} MNAGNASTPKFFILLGFSDHPWLEMPLFTVVLAAYICTLVGNISIIVVSRVDPQLDSPMYFFLSNLSFLDVCFTTTTTPQLLLNLWGPDKSITYGGCVTQFYVFHFLGAT
ECILLAMMSLDRYVAICKPLRYPVIMQQQLCIFLVVMAWLSGLANSLLQSSLTIQLPLCGNNKVDDFLCEVPVMIKMSCADTTFNVAMLSIVGTFYSLVPLSLILVSYGF
IVATVLRIQSSEGKKKAFNTCSSHVIVVSLFYGPVISMYVQPSTNSQDKNKLMSLSYSLVTPMLNPFIYTLRNKDMKRAMTSLLVLLYHQRRE*
204 >lcl|XP_001252943.2|Plus1complement(155898..156827) NW_001494174 Olfactory receptor 2J3-like LOC784712 __SEG__ Chr23 {Bos taurus} MNDDGKKNATSEAQFVLLGFSDWPQLELVLFVVILMFYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYNGCMIQLYFVLAL
GSTECVLLMVMSYDRYAAVCRPLHYTVLMHPSFCQLLAVASWVSGFTNSALHSFFTFWVPLCGHRQVDHFFCEVPALLRLSCIDTHANELTLMITSSIFVLIPLILILSS
YGAIARAVLRMQSTTGLQKVFGTCGAHLMVVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNRDVRGAVKRLVG*
205 >lcl|XP_001252967.2|Plus12256293..2257246 NW_001492801 olfactory receptor, family 4, subfamily K, member 2-like LOC784745 __SEG__ Chr10 {Bos taurus} MDLVNKSTVSDFVLLGLSKSWKLQTFFLVVFLLFYVTTMVGNSLIVITVISDSHLHFPMYFLLTNLSIIDMSLASFATPKMITDYLSGHKTISFDGCITQIFFLHLFTGT
EIILLMAMSFDRYIAICKPLHYASIISPQMCVALVVVSWVVGVMHSMSQVIFALTLPFCGPNEVDSFFCDLPVVFQLACVNTYVLGLFMISTSGIIALSCFILLFSSYVI
VLVTIRNHSSKGTSKVLSTCTAHFIVVFMFFGPCIFIYMWPLSSFLIDKILSVFYTIFTPILNPVIYTLRNQEVKTAMRKLKNKLLNSSKATPLHYF*
206 >lcl|XP_001252988.2|Plus1492740..493924 NW_001494757 intersectin-1-like LOC785422 __SEG__ Chr3 {Bos taurus} MNGGPNMWAITSEEWTKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPVLAEIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFG
MGSMPNLSIPQSLPPVAPIAPPLSSATSGTTLPSLLMAAPLVPSISTSSLPNGTVSLIQPLSIPYSSSTLPHTSSYSLMMGGFGGANIQKAQSLIDLGSSSSTSSTASLS
GNSPKTGTSEWAVPQPSRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLKAEEFILAMHLTDMAKAGQPLPLALPPELVPPSFRGGKQI
DSINGTLPSYQKAQEEEPQKKLPVTFEDKRKANYEQGNMELEKRRQAMMEQQQREAECKAQKEK*
207 >lcl|XP_001252995.1|Plus12275908..2276879 NW_001492801 olfactory receptor MOR246-4-like LOC784778 __SEG__ Chr10 {Bos taurus} MNQENKSRVAEFVLLGLSSSYELQYFFFMLFNFLYIIIVLGNLLIVLTVISEPALHTPMYIMLSNLSILDVFLATYATPKMIHDFLHKPKTISFEGCMAQIFLLHVFAGG
EMVLLVAMAYDRYVAICKPLHYATIMNLCKCTGLVVGSWVIGVMHSLSQLAFTVNLPFCGPNVVNSYYCDLTLVIKLACTDTYVPEVLMLLDSGLMGVASFLLLLVSYTV
ILVTVQRRSSTDMTKARSTLTAHIIVVTLFFGPCIFIYAWPFSNFQVDKVLSVFSTVFTPILNPIIYTLRNKEVKLAMHKLKTRYVCSRLPSQLSLLRLDVLS*
208 >lcl|XP_001253002.2|Plus1173191..174147 NW_001494174 olfactory receptor 2-like LOC784787 __SEG__ Chr23 {Bos taurus} MSINCSLWQDNSMSVKHFAFVKFSEATEQCFLLFTLILFMFLVSLTGNVLIALAIWTNPALHTPMYFFLANLSLLEIGYTCSTIPKMLQNLVSEARGISREGCATQMFFF
TLFGISECCLLAAMAFDRYMAICSPLHYATRMSRGVCVHLAMVSWGVGCIVSLGQTNYIFSLDFCGPCEIDHFFCDLLPILALACGDTSHNEAAVFVAAILCISSPFLLI
IASYGRILAAVLVMPSPEGRQKALSTCSSHLLVVTLFYGSGSVTYLRPKASHSPGVDKLLALFYTVVTSMLNPIIYSLRNKEVKTALRRTLGKKSNFI*
209 >lcl|XP_001253076.2|Plus1complement(130176..>131057) NW_001501889 olfactory receptor, family 5, subfamily B, member 12-like LOC784897 __SEG__ Chr15 {Bos taurus} DDPQLQIPLFLVFTLIYLLTLVGNLGVITLILLDSRLHTPMYIFLSQLSLMDFAYSTAVTPKVMAGFLTGDKVISYHACAAQFFFFAVFLIMETFLLASMAYDHHAAVCQ
PLHYTNIMTPRVCASMVVGSYVLSFLEASVHTWNIFSLSFCRSRVIDHFFCDAIPLLALSCSDNKRSEIVFFILAGFNIISSVLIILISYLFIFVTILRVRSSEGHQKAF
STCASHLTSVSIFYGTGAFMYLQPGSRHSMSTDKMASVFYAIVIPMLNPLIYSLRNKEVKSAFHRLCGKQHLL*
210 >lcl|XP_001253093.2|Plus1235006..235956 NW_001494174 olfactory receptor 414-like LOC784917 __SEG__ Chr23 {Bos taurus} MSINCSLWRDNSMSVKHFAFTKFSELTEQCWLLFSFILLMFLASLTGNALIALAIWTNSVLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEARGISREGCATQMFFF
ALFGISECYLLAAMAFDRYTAICSPLHYATRMSRGVCVHLAMVSWGVGCIVSLGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGDTSHNEAAVFVVATLCISSPFLLI
IASYVRILAAVLIMSSPEGRRKALSTCSSHLLVVTLFYGSASVSYLRPKSSHSPGVDKLLALFYTVVTSMLNPIIYSLRNKEVKTALWRTLGKKKL*
211 >lcl|XP_001253098.1|Plus1232845..233780 NW_001492804 olfactory receptor 140-like LOC784925 __SEG__ Chr10 {Bos taurus} MDGGNHSVSEFVFLGLTYSWEFQLLLLVFSSVLNVASMTGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVE
MVLLIAMAFDRYVAICKPLHYLSIMSPRMCILFLAAAWALGVSHSLFQLAFIVNLPFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTGNSGFICVSSFFILLISYMFI
LLTVWKRSSGGSPKALSTLSAHITVVILFFGPTMFVYTWPHPNSQMDKFLALSDAVLTPFLNPVIYTFRNKEMKVAMKRAFRPFVIFRKIS*
212 >lcl|XP_001253104.3|Plus1complement(398057..398986) NW_001494175 olfactory receptor, family 7, subfamily C, member 2-like isoform 1 LOC786846 __SEG__ Chr23 {Bos taurus} MNCSKNPDFVLSGLSSDPDKPQLLFGLFLAFYLLSLIGNLLLLLAIGADIHLHTPMYFFLSQLSLVDLCSTTTTAPKMLETLWTSSGLISFSECLAQLYFFAVFANMDNL
LLTAMAIDRYAAICHPLHYALLMTPCRCGLLVGGSWGVAHSDSLIQTLMLTQLSFYTNLEIPHFFCDFKPLLRFSCSDTHLNEDLMMVLTGLLGISPLLCIISSYAHIFL
AVARIPSAQGKKKALATCSSHLSMVILFYISVFATYLKSPSASHASGELGAAIMYALVTPTLNPFIYSLRNKDVKSSLKRILSVKSSWD*
213 >lcl|XP_001253119.2|Plus1complement(201673..202611) NW_001492804 olfactory receptor 1264-like LOC784957 __SEG__ Chr10 {Bos taurus} MGGANCSVVSEFVFLGLSDSWEIQLLLILFFSVFYMASLMGNLLVVLSVSADTSLHSPMYFLLANLSFLDMGFCSTTAPKMIYDLFRKRKAISFGGCLTQIFFIHDIGGT
EMVLLIAMAFDRYVAICKPLHYLTIMSPLMCVLILAAAWVLGLIHSVAQLAFVIELPFCGPNVLDSFYCDLPRLIKLACTETYRLEFMVTANSGLISVGSFFILIISYIF
ILVTVWKHSSGSVSKALSTLSAHVTVVVLFFGPLIFFYTWPFPSSHLDKFLAIFDAVLTPFLNPVIYTFRNKEMKAAMKKLCHQLVSYSKMS*
214 >lcl|XP_001253131.2|Plus1complement(2364321..2365262) NW_001492801 Olfactory receptor 4Q2-like LOC784974 __SEG__ Chr10 {Bos taurus} MDENQTKVVREFILAGFSQTQSIETGLFVLFLLFYVSTWVGNVLIMVTVVYDNHLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFLDNEKLIPYDQCIVQLFFLHVVGA
AEMFLLTVMAYDRYVAICRPLHYTTIMSRGLCCVLVAASWMGGFVHSTVQTILTVRLPFCGPNQVDNFFCDVPPVIKLACADTFVIELLMVSNSGLISTSSFVVLVSSYA
TILVKIRSKEGRRKALSTCGSHLMVVTLFFGPCIFIYARPFSTFSVDKMVSVLYNVITPMLNPLIYTLRNKEVKSAMRKLWDGSGLTWKKQET*
215 >lcl|XP_001253135.1|Plus1794376..795317 NW_001494175 olfactory receptor 1370-like LOC784982 __SEG__ Chr23 {Bos taurus} MNAGNASTPKFFILLGFSDHPWLEMPLFTVVLAAYICTLVGNISIIVVSRVDPQLDSPMYFFLSNLSFLDVCFTTTTTPQLLLNLWGPDKSITYGGCVTQFYVFHFLGAT
ECILLAMMSLDRYVAICKPLRYPVIMQQQLCIFLVVMAWLSGLANSLLQSSLTIQLPLCGNNKVDDFLCEVPVMIKMSCADTTFNVAMLSIVGTFYSLVPLSLILVSYGF
IVATVLRIQSSEGKKKAFNTCSSHVIVVSLFYGPVISMYVQPSTNSQDKNKLMSLSYSLVTPMLNPFIYTLRNKDMKRAMTSLLVLLYHQRRE*
216 >lcl|XP_001253165.2|Plus1157336..158274 NW_001492804 olfactory receptor, family 4, subfamily F, member 15-like LOC785022 __SEG__ Chr10 {Bos taurus} MDVMNQSIVSEFIFLGFTTSWKIQLLLFVFAFLFYSASMMGNLVVVFTVALDSHLHSPMYFLLANLSVIDMVFCSIIVPKMIYGIFKKHKSISFCGCITQIFFSHAAGGT
EMVLLITMAFDRYVAICKPLQYLTIMSPRMCLHFLVTSWTIGLIHSLVQLGFVVDLPFCGPNVLDSFYCDLPRLLRLACTNTQELEFMVTVNSGLISVGSFVLLVISYIF
ILFTVWKHASRGLSKALSTLSAHITVVVFFFGPLMFFYTWPSPTSHLDKYLAIFDAFITPFLNPVIYTFRNKEMNVAMRRLCSRFVHYKNIS*
217 >lcl|XP_001253169.1|Plus1complement(767517..767993) NW_001492907 ACP1 protein-like LOC786125 __SEG__ Chr11 {Bos taurus} MAEQVTKSVLFVCLGNICQSPIAEAVFRKLVTDQNISDNWRIDSAATSTYELGNPPDYRGQACMKKHGIPMSHVARQVTKEDFDTFDYILCMDESNLRDMNRKSNQVKNC
RAKIKLLGNYDPQKQLIIEDPYYGDNADFEAVYQQCVRCCRAFLGKVR*
218 >lcl|XP_001253182.1|Plus189407..90369 NW_001493327 olfactory receptor Olr60 (predicted)-like LOC785036 __SEG__ Chr15 {Bos taurus} MFFSWSFANISFFQPHAFLMIGIPGLEAIHGWISILFSSMYTAALTGNCLILLALTRTPSLHQPMYYFLSMLALTDMGLTLATMPTTLAVLWFDHRLIGFDTCLVQMFFL
HFFSVVESSVLLAMSFDRFVAISNPLRYASVHTNNVIIRIGLAIVARATVSLFPLPFLLKRLNFCPGKILLSHSFCFHADVMKRACADITVNIIYGLYVVLSTVGFDSLL
IVLSYTLILHTVMSLASPRERIRALNTCVSHILAVLVFFIPVIGVSMIHRFGRHLPPIVHALVAYVYLVVPPVLNPIIYSVKSKPIREAMLRVLSEKRKG*
219 >lcl|XP_001253185.1|Plus1759173..760111 NW_001494175 seven transmembrane helix receptor-like LOC785040 __SEG__ Chr23 {Bos taurus} MINDSYFGGFILLGFTGQPQMEMIISWVVFFFYIIALIGNMAIILLSFLDDHLQTPMYFFLRSLAILDLCYTTNIVPQMLVNIWGKDKRITFGGCAFQLFTDMVLCSVEC
ILLAVMSYDRFSAVCKPLHYMTIMNSQLCQGLVGTAWVVGVINCMILSPYAMSLPRCGNHHLDHFFCEMSAMIKIACVDTTAMEVTTFAMCLIIVLAPLLLILVSYGFIA
VAVLKIKSATGRQKAFGTCSSHLIVVSIFYGTVIYMYIQPGNSPNQNEGKLLSIFYSIVTPSMNPLIYTLRNKEFKGAIKRLIGKKKVLWKQ*
220 >lcl|XP_001253193.2|Plus1complement(85569..86504) NW_001492804 rCG26447-like LOC785050 __SEG__ Chr10 {Bos taurus} MDGANHSMVSEFVFLGLTNFWESQLLFVFSSIFCVASMMGNSLIILTVMMNPHLHSPMYLLLANLSFIDLGFSSVISPKMIHDLFKKRKVISFSGCITQIFFIHVIAGVE
MVLLIAMAFDRYIAICKPLHYFSIMNQKMCILLLVAAWIIGLIHSVVQLGFVIKLPFCGPNVLDSFYCDFPWFIKLACTDTYRLEFMVTANSGFISLGSFFILIVSYIFI
LITVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFVYIWPHSTSHLDKFLAVFDVVLTPFLNSVIYTSRNKEMKVAMWKVCSQFIIYRMIS*
221 >lcl|XP_001253218.2|Plus1complement(76430..77368) NW_001492804 olfactory receptor 1307-like LOC785082 __SEG__ Chr10 {Bos taurus} MEGANQSVVSEFLFLGLTNSWEIQLLLFVFSSTFYVASMMGNSLIILTVTCDPHLHSPMYFLLANLSLIDLGVSSVTSPKMIYDLFRKHKVISFGGCIAQIFFIHVIGGV
EMVLLIAMAFDRYVAICKPLHYLTIMSPRMCVFFIVAAWMIGLTHSMVQLAFVVKLPFCGPNVLDTFYCDLPRFIKLACIDTYQLKSMITANSGFISVGSFFILIISYII
IILTLQKQSSAGSSKALSTLSAHITVVVLFFGPLVFVYTWPSPSIPLDKFLAIFDAVLTPLLNPVIYTFRNQEMKVAMRRVCRQLVSYRKIS*
222 >lcl|XP_001253259.3|Plus1complement(34278..35207) NW_001492804 olfactory receptor MOR245-2-like LOC785145 __SEG__ Chr10 {Bos taurus} MNHSMVSEFVFLGLTNSWEIQLLLFMFSSVFYMASMLGNSLIVLTVMRNPHLHSPMYFLLANLSITDLGVSSVISPKMIYDIFRKHKVISFGGCIAQIFFIHIIGGVEMV
LLITMAFDRYVAICKPLHYFTIMSRKMCLLLLVAAWIIGFIHSVVQLGFVVKLPICGPNIIDSFYCDFPQFIKLACTDTFRLESMVTTNSGFISLGSFFILIVSYIFILI
TVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFVYIWPHSTSHLDKFLVVFDTVLTPFLNSVIYTLRNKEMKVAMKKVCSQFIIYGRIS*
223 >lcl|XP_001253272.2|Plus1697297..698229 NW_001494175 olfactory receptor, family 2, subfamily B, member 2-like LOC785162 __SEG__ Chr23 {Bos taurus} MKGTNASTPAGFILLGFSDQPHLEMVLLLVVSVIYILTLMGNTAIILVSYFNPKLHTPMYFFLSNLSFLDLCFTTSVVPQMLWNLKGPDKTISYTGCVIQLYVALGLGST
ECVLLTVMAYDRFNAICRPLHYGVIMHPKLLQQLAALAWISGFVESTVQTILVFQLPLCSHHMVDDFTCEEPALIKIACVNTTFLENELSIASVLYVVIPLGLILVSYGC
IVRSVLKIKSTEGRRKAFGTCGSHLIVVVLFFGTLASIYIQPKSKYTQNYSKFLTLFYTVVTPSLNPLIYTLRNKEAKWALRRLLGRDPS*
224 >lcl|XP_001253298.1|Plus1104622..105608 NW_001502065 olfactory receptor Olfr591 (predicted)-like LOC785207 __SEG__ Chr15 {Bos taurus} MLDYNRSNLKLNTFLLLGIPGLEDAHLWISIPFCLVYLLSLMGNVALLLIIKTDRKLHEPMYLFLCMLSVADLMLTSSTLPKILSLFWFNDREIYFEACLTQMYFIHSLS
TMESGFILAMAFDRFVAICHPLRHSTILTPAVIVGLGLLIVFRGAVLLSPHPFLLRWLSYCKTNVISHTYCEFMALIKLVCSETKIRRAYSLIVAFLTGGLDFILIICSY
VLILFTVFNLPSKAARLKTLSTCVSHVWVILVFYTPAFFSFLTHRFGHHIAPPVHIFIANIYLLIPPMMNPIIYGVKTKRIRDGFLKFLTIKCVQLCKVCESPDHQQR*
225 >lcl|XP_001253299.2|Plus1complement(3405..4346) NW_001492804 olfactory receptor 1307-like LOC785208 __SEG__ Chr10 {Bos taurus} MYGANQSVVSEFVFLGLTNSWEIQLLLFVFSSSFYIASTMGNLLILLTVISDPHLHSSMYFLLANLSFIDLGFSTIFSPKMIYDLFRKHKVMSFSGCITQIFFIHIIGGV
EVVLLIAMAFDRYVAICKPLHYLTIMSPRMCVFFIVAAWIIGLIHSVVQLACMVNLPFCGPNVLDSFYCDLPQLIKLACTDTYQLKFMVTANSGLISVGSFFILIISYII
IILTVQKQSSAGSSKALSTLSAHITVVVLFFSPLMFFYIWPFSSSHLGKFLAIFDAVLTPFLNPVIYTFRNHEMRVAMRRVCKQLVNYRRSLK*
226 >lcl|XP_001253304.2|Plus118759..19694 NW_001495359 olfactory receptor Olr1654-like isoform 1 LOC787611 __SEG__ Chr7 {Bos taurus} MVGGNASSVTDFILVGLFPEFQHSIVLNFVVIFIYILAFLGNLLLIVLIWGDSRLHTPMYILLSQLSLIDLTLTSTIVPKTASNFFTGKRTISWIGCGTQSFFFLMLGMS
ECLILTLMAYDRYVAVCIPLRYPTIMSPRFCLHMVAGCWIGGSIGSFIHTVYPMHFPICGSREIHHFFCEVPVLIKLSCEDTSVYQLVVVVTSIVLLVMPFSLIIASYTL
IFLTVLRMNSVKGRKKALATCSSHLTVVSLFFGPNIFIYMTFTSSHSPEQDQALSLFSNILTPMLNPLIYSLRNKEVVAALMKLVGRCGVS*
227 >lcl|XP_001253316.1|Plus1complement(120322..121281) NW_001502065 olfactory receptor Olr87 (predicted)-like LOC785238 __SEG__ Chr15 {Bos taurus} MSFVNDTTSHPSAFLLLGVPGLEDFHIWIAFPFFVVYLIALVGNVTILFVIKTDQSLHQPMFYFLALLSFIDLGLSTSTIPKMLAIFWFNHRKVSFEACLIQMFFIHTDT
GMESGVLLAMAIDRFVAICYPLRYTTILTNKMVAIMASVAVVRPVLLAIPFCPLLKRLPFCGRYIVPHTYCEHMGIARLASANIRVNIIYGLFTIATLIFDLLLIALSYV
QILQTVFHLPSRDARLKALSTCGSHVCVILAFYTPAFFSFMTHRFGRNVPHYIHILLANLYVVVPPCLNPVIYGVRTKQIWNRVVRIFVKKEGPNILES*
228 >lcl|XP_001253330.1|Plus1289559..290590 NW_001495589 trace amine associated receptor 8-like LOC785256 __SEG__ Chr9 {Bos taurus} MNSSSSTVAAVQLCYEHLNGSCVKTPYSPAPRLILYTVFSFGTVLAIFGNLLVMISILHFNQLHSPTNCLIASLACADFLIGVTVMPFSTVRSVESCWYFGESYCKFHTC
FDGSFCYASIYHLCFISLDRYIAITDPLVYPTRFTMSVSGMCVAFSWLFSVIYSFSLLGSGANAAGLEDLVSALSCVGGCQFAVNQSWVLVNFTLFFIPTLVMIVLYSNV
FLIAKQQARKIENLSNKTGRCSYSYQDRVAKRERKAVKTLGIAVLVFLISWLPYFLDSIIDAFLGFITPTYVYEMLVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKF
LRENSLTVNLFSG*
229 >lcl|XP_001253349.2|Plus1complement(648605..649546) NW_001494175 olfactory receptor 123-like LOC785277 __SEG__ Chr23 {Bos taurus} MGMNSSSVKEDFVLVGFSDQPNLEKILFVVVLVTYLLTLMGNTVIILISSTDSKLRTPMYFFLTHLSLVDICFTTSIVPQLLWNLRGPAKTITALGCAVQLYVSLALGST
ECILLAVMAFDRYAAVCKPLHYAAVMNPRLCQALAGVAWLSGVGNTLTQSTVTLWLPRCGHQWLHHFFCEVPSMIKLACVDIHANEVQLFIASLVLLLLPLALILMSYGH
IVKAIIRIKSVQAWRKALGTCGSHLMVVSLFYGTITAVYIQPNSSYAHTYGKFISLFYTVVTPALNPLIYTLRNKDVKGALGRLFHRARDLGL*
230 >lcl|XP_001253353.1|Plus1274984..276015 NW_001495589 trace amine associated receptor 8-like LOC785282 __SEG__ Chr9 {Bos taurus} MSSASPSAAAVQLCYEHLNGSCVKTPYSPGPRLILYTVFIFGAVLAVFGNLLVMISILYFKQLHSPTNFLIASLACADFLLGVTVMPFSTVRSVESCWYFGQRYCQLHSC
FEGSFCYTSIYHLCFISLDRYIVVTDPLVYPARFTVSVSGMCIASSWLFSIIFSFSLFGTGANAAGLEDVVSALTCVGGCQIAVNQSWVLVSFLVFFIPTLVMITVYFNI
FLIAKQQARKIESLNNKTGRCSDSFQDRVAKRERKAARTLGVAVLAFLVSWLPYFLDSIIDAFLGFITPTYIYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIGTGKV
LRANSSTVNLFSG*
231 >lcl|XP_001253365.1|Plus1361859..364249 NW_001495372 protocadherin beta 5 PCDHB5 __SEG__ Chr7 {Bos taurus} METAPAKTLQKRQVIFLAILLFLWETGSEEIRYSMPEETESGSLVANLAKDLDLRVGELATRGARIHYKGNKQLLQLDITTGNLLLYEKLDREVLCRATDPCILHFQLLL
ENPVQIIQADLQLTDINDHSPEFLERDMLLKIPESVQTGTVFPLKIAQDFDIGSNAVQNYTISPNSHFHVVTHHRGDGRKYPELVLDKALDREKQPELSLTLTALDGGAP
PRSGTTTVRIEVVDINDNAPEFLQSVYEVQIPENSPLNSLVVAVSARDLDAGTYGKVAYALFQGDEVTQPFVINEITGEISLKRALDFEATRFYNVEIAATDGGGLSGKC
TVAIEVVDVNDNAPELTMSRLISSVPENSPETVVAVFSVSDPDSGENGKMVSTIQNDLPFLLKPTFKNFYSLVTERSLDREERAGYNITITVTDMGTPRLKTEHNITVLV
SDVNDNAPTFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFHVGATDRGSPALSSQALVRVLV
ADANDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDAGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHVL
LVDGFSQPYLPAPEAEAAAAAPADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLVDVSGTGTLAQSYQYEVGLRGSTGTGEFKCLKPI
LPTFPLQGTVREIKENSTVRSSFLFN*
232 >lcl|XP_001253387.1|Plus1354247..356634 NW_001495372 protocadherin beta 6 PCDHB6 __SEG__ Chr7 {Bos taurus} MVQRKLHQKKRQVMIFITLILSWEAGSETIRYSVLEETESGTFVANLTKDLGLRMGELAARGARVVFKGNRQHLRLDPGTCDLLLNDKLDREELCGSTEPCVLPFQVLLE
NPFQLFQAALVIRDVNDHAPEFPAREMQLKISEITIPGKVFPLKMAQDLDAGSNGLQSYIISSNPHFHILTRNRKDGRKSPELVLDKALDREEQPELRLTLTALDGGSPS
LSGTTEIQILVLDSNDNAPEFAQEFYEAQVPENSSLGSLVITVSARDLDAGSFGEVSYALFQVDDVNEPFEINANTGEIRLKKKLDFEEFQSYQVDIEATDGGGLSGKCS
VVIKVLDVNDNAPQLTMSSLTSPIPENLPEILVAVFSVSDADSGHNQQVICSIHDNLPFVLRPSVENFYTLVTEGALDREERAEYNITITVTDMGTPRLKTEHNITVLVS
DVNDNAPAFSQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFHVGATDRGSPALSSQALVRVLVA
DANDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDAGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHVLL
VDGFSQPYLPAPEAEAAAAAPADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLMDVSGTGTLSQSYQYEVCLTGDHRTGEFKFLKPVF
PNLLVQDTEREIKESPSCRNSFVFS*
233 >lcl|XP_001253399.1|Plus1231886..232932 NW_001495589 trace amine associated receptor 9 (predicted)-like TAAR9 __SEG__ Chr9 {Bos taurus} MVNNFSQAEAVELCYQNINGSCVKTSYTPGPRAILYAVLGLGAVLAVFGNLLVIIVILHFKQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTC
FDTSFCFASLFHLCCISIDRYIAVTDPLAYPTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEDLVVALTCVGGCQAPLNQNWVLLCFLLFFIPTVVMVFIYGKI
FLVAKYQARKIESTASQAQCSSESYKERVAKRERKAAKTLGIAVAAFLVSWLPYVIDAVIDAYMNFITPPYVYEILVWCVYYNSAMNPLIYAFFYPWFRKAIKLIISGQV
LRVDSSTINIFSEEADID*
234 >lcl|XP_001253410.1|Plus1328676..331066 NW_001495372 protocadherin beta 4 isoform 1 PCDHB4 __SEG__ Chr7 {Bos taurus} METLERIQPNRQVTTFILMVILSQANPAPIRYSVLEETESGSFIAHLTKDLGLEIGELKARSARVVCDDDKQRLLLDRQTGDLLLREKLDREDICGSDEPCVLHFQVFLE
TPVQFFEGELLIQDINDHSPVFPNREMLLKIPENSQPGTVFPLKLAQDLDVGSNGLQKYTINANSHFHVLTRNHSDGKKYPDLVQDKVLDREEQSEFSLTLMALDGGSPP
RSGTSMVRILIMDVNDNAPEFVHTPYEVQVLENSPLDSLILTVLARDVDAGNFGTVSYSLFQASEEIKQTFSINEVTGEIRLTKKLDFEQIKSYHVETEATDGGGLSGKG
TVVIEVVDVNDNAPELTISSLISSIPENAPETVVSIFRIRDRDSGDNGKMICSIPDNLPFILKPTFKNFYTLVTDSPLDRESQAEYIITITVTDMGTPRLKTEHNITMLV
SDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFHVGATDRGSPALSSQALVRVLV
ADTNDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDAGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHVL
LVDGFSQPYLPAPEAEAAAAAPADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLVDVSGTGTLSKSYQYEVCLTGDHRTGEFKFLKPI
FPNLLVQDNEREIKESPNSRNSFVFS*
235 >lcl|XP_001253440.2|Plus1593777..594730 NW_001494175 olfactory receptor 155-like LOC785397 __SEG__ Chr23 {Bos taurus} MEGKNQTALSEFIILGFSDLNELQFLLFTIFFLTYVCTLGGNVFIILVSVLDPHLHTPMYHFLGNLAFLDICYTTTNVPQMMVHLLSEKKSISYGGCVAQLFAFIFFVGS
ECLLLAAMAYDRYIAICKPLRYSVIMNKVLYSRLAASCWTGGFLNSVVHTVLTFRLPFCGNNKINYFFCDIPPLLILSCGDTSVNELALLSIGIFIGWTPFLCIVLSYLY
IISTILRIRSSEGRQKAFSTCASHLVIVLLYYGSAIFTYVRPISTYSLEKDRLISVLYSVVTPMLNPIIYTLRNKDIKEAVKVVGRKWQPPILSFDI*
236 >lcl|XP_001253443.2|Plus1complement(388866..389816) NW_001501890 hypothetical protein LOC785406 __SEG__ Chr15 {Bos taurus} MAKHNNSEVTEFILLGLTDSPELQALLFGIFLVIYLISVMGNLGLIMLIRVSPQLHTAMYYFLSHLAFVDFCYTSSVTPNTLVNFLQEIKRISLPACAIQLFCFIMFVVC
ELYMLSVMAYDRYVAICNPLLYTIVVNKRVCIQMVLSTYLYSFSVGLLQATLTFHLSFCHSNIINHFYCDDVPLVALACHETHHKYIKKLLLFTLAGFNIFFSLFIVLVS
YVFILFAILRIKSAEGRKKAFSTCASHLTSITIFYGTIIFMYMQPETSHSLHTDKISSVFYIVVIPMLNPLIYSLRNKEVKNALKRTMEKVYSSII*
237 >lcl|XP_001253455.2|Plus1583553..584476 NW_001494175 olfactory receptor Olr1654-like LOC785431 __SEG__ Chr23 {Bos taurus} MKGENQTVLFEFIILGFSNLNELKFLLFTIFLVAYICTLGGNTFVILVTMIDPRLHTPMYFFLENLAFLDICYTTTNVPQMMVHLLSERKCISYLGCIVQLFAFIFFVGS
ESLLLAAMAYDRYIAICKPLRYSVIMNKVLYSQLATSCWTGGFLNSVVHTVLTFRLPFCGNNKINYFFCDIPPLLILFCGDTSVNELALLSIGVFIGWTPFLCIILSYLY
IISTILRIRSSEGRQKAFSTCASHLIIVLLYYGSSIFTYVRPISAYSLEKDRLISVLYSVVTPMLNPIIYSLRNKDIKEAAKVVGRK*
238 >lcl|XP_001253464.1|Plus1complement(196086..197021) NW_001502065 olfactory receptor, family 52, subfamily J, member 3-like LOC785443 __SEG__ Chr15 {Bos taurus} MFYHNSSIFHPTTFFLIGIPGLEEVHGWISLPFCSVYLVALLGNVTILLVIKTEETLQEPMFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEISFGACVAQMFLIHAFT
GMEAEVLLAMAFDRYVAICAPLHYTTILTSRVLMGISMCIVIRPVLLTLPMIYLVYRLPFCQAYIIPHSYCEHMGIAKLSCGNIRINDIYGLFVVSFFFLNLVLIGISYV
YILRAVFRLPSQDARLKALSTCGSHIGVICIFCIPSVFSFLTHRFGHKIPRYIHILVANLYLIIPPSLNPIIYGIKTKQIWQPVLRAFIKK*
239 >lcl|XP_001253482.2|Plus1360486..361427 NW_001501890 cOR8V11 olfactory receptor family 8 subfamily V-like LOC785470 __SEG__ Chr15 {Bos taurus} MEEHNRTVLSQFILMGITDRPELQAPLFVLFLIIYVISVVGNLGMVILTKVDSRLQTPMYFFLRHLALTDLGYSTAVGPKMLVNFVVDQNKISYYLCATQMGFFIMFIIN
ELFILATMSYDRYVAICNPLLYTVIMSQRVCKVLVAIPYVYSTFVSLLITIKLFNSFFCGYNVISHFYCDNFPLLSLLCSNTHEIELMIMIFSAFNLTFTLAIVLVSYLL
ILAAILRMKSAEGRQKAFSTCGSHLTVVTVFYGTLTFMYVKPKSSHSFDTDKVASVFYTLVIPMLNPLIYSLRNKDVKYALQKMWRKLCSIFS*
240 >lcl|XP_001253504.1|Plus1complement(221483..222430) NW_001502065 olfactory receptor, family 51, subfamily L, member 1 (predicted)-like LOC785506 __SEG__ Chr15 {Bos taurus} MVVWNNSDTMEPIFILRGFPGLEYVHSHLSIPFCLAYLLAFIGNATVLSVIWTESSLHQPMYYFLSMLALTDLGMSLSTLPTMLAVLCLDVREIQASACYAQLFFIHTFT
FLESSVLLAMAFDRFVAICHPLHYTTILTNSVIGKVGLACLLRSMGVVLPTSLLLRHYHCCHASALSHAFCLHQDVLKLSCSGARISSVYGLSVVIATLGVDSVFILLSY
VLILKAVLGIASHEEQLKALNTCVSHMCVVLIFFVPVIGVSMVHRFGKHLSPIIHILMADIYLLLPPVLNPVVYSIRTKQIRLGILCKFGIRRRF*
241 >lcl|XP_001253602.1|Plus1complement(277061..278098) NW_001502065 olfactory receptor, family 51, subfamily E, member 2-like LOC785646 __SEG__ Chr15 {Bos taurus} MTNTIIVISFFRACPQPTMMIFNNTTSSPSTFLLTAFPGLELAHVWISIPVCCLYIIALLGNTMILFVIFVKQQLHKPMYYFLSMLSAADLCLTITTLPTVLGVLWFHAR
EISFKACLIQMFFVHAFSFLESSVLAIMAFDRFMAICNPLKYATVLKDMMIMVIGLFICVRQLIFIFPMLLALKTVSFQERKELSHPFCYHPDIIRDTYSNPWINSFLGL
FLQLYMTGTDLMFILVSYVLIIRAVLSIVAPKKQKKALNTCVCHICAVTIFYVPMISLSFTHRLLSSTPRVICSILANVYLLLPPVVNPIIYSLKTRTIRQAMLQLLQTK
GSWSRNVRGLRGSWD*
242 >lcl|XP_001253622.1|Plus1complement(60031..61062) NW_001495590 trace amine associated receptor 1-like LOC785678 __SEG__ Chr9 {Bos taurus} MDLTYIPEDVSSCPTFGNKSCPPTNRHFHIRVIMYSIMIGAMFITIFGNLVIIISISHFKQLHSPTNFLILSMATTDFLLGLVIMPYSMVRSVESCWYFGDGFCKFHTSF
DMMLSLASIFHLCSIAIDRFYAVCYPLHYTTTMTISMIKWLLAVCWSAPALFSFGLVLSKANVSGMQNYEILVACFNFCALAFNKFWGTILFTTCFFTPGSVMVGIYGKI
FIVSKRHARVIDNMPENTKGEVRKNLSKRKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLGYSTPMIVLDLLVWLGYFNSTCNPLIHGFFYPWFRKALKYIVSGKIFS
SHSESANLFPEAH*
243 >lcl|XP_001253662.1|Plus1653427..655460 NW_001848878 fibronectin leucine rich transmembrane protein 3 FLRT1 __SEG__ Chr29 {Bos taurus} MVVAHPTAAAATTATPATTVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNV
QVIYLYENDLDEFPVNLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPRTLEELRLDDNRISTIPLHAF
KGLSSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSARLQKLYLQDNAISHVPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLENLAQLLLRNN
PWFCGCNLLWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFEAGAQGGAVNAAAKTTHASDHASVTTPQGSLFTLKAKRPGLRLPDSSLDYPMATGDSAK
TLAIHVKPLTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMDTGNTYVADETPVCAKAETADSSGPATTLNQEQNADP
MAGLPLAGIIGGAVALVFLFLVLGAICWYVHRASELLTRERAYNRGSRKKDDYLESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKGTHTIGYGT
TRGYRDGGIPDIDYSYT*
244 >lcl|XP_001253677.2|Plus1266500..267426 NW_001501890 olfactory receptor, family 5, subfamily T, member 2-like LOC785753 __SEG__ Chr15 {Bos taurus} MKNTTEVTIFVLKGLTDNPEIQFILFFLFLAMYLFTLIGNLGLVVLVIGDCRLHNPMYYFLSVLSSVDACYSSVITPKMLADFMSKNKTILLSECAAQMFLFTTFGTTEC
FLLAAMAYDRYVAIYDPLLYSVSMAPRVYVPLIIASYVGGIVHATVHTVATFSLSFCASNEIRHVFCDIPPLLAISCSDTHTNQLLLFYLVGSIEIVTVLIVLISYSFIL
LAVLRMHSAEGRRKVFSTCGSHLTGVCIFHGTILFMYVRPSSSYALDHDMIVSLFYSVVIPMLNPIIYSLRNKDVKEAMKRKGLENLI*
245 >lcl|XP_001253688.1|Plus1complement(465968..466897) NW_001494175 olfactory receptor, family 1, subfamily F, member 1-like LOC785779 __SEG__ Chr23 {Bos taurus} MNCSKNPDFVLLGLSNDPDKPQLLFGLFLALYLLSLLGNLLLLMVIGADIHLHTPMYFFLSQLSLVDLCFTTTTAPKMLETLWTSNGLISFSECLAQLYFFTVFADMDNL
LLTAMAIDRYAAICHPLHYALLMTPCRCALLVGGSWGVAHSISLVHALLLSQLSFYSNQEIPHFFCDFGPLFRLSCSDTHLNEDLMMVLTGLLGISPLLCITSSYAHIFL
AVARIPSAQGKKKALATCSSHLSMVILFYSSVFASYLKSPSASHASGELGAAVMYALVTPTLNPFIYSLRNKEVKRSLKRILGIESSWH*
246 >lcl|XP_001253692.2|Plus1complement(93228..94238) NW_001495590 trace amine associated receptor 1 TAAR1 __SEG__ Chr9 {Bos taurus} MMSLCHNKINISCVKSSWSNDIRASLYSLMVLIILTTVVGNLLVIISISHFKQLHTLNNWLIQSMATVDFLLGCLVMPYSMVRSIEHHWSFGEVFCKIHTSTDIMLSSAS
IFHLSFISIDRYYAVCDPLRYKTKINILVISLMIFISWSIPALFAFGMIFLELNFKGAEEMYYKHSHCIGSCSVFFSKTSGVLAFMTSFYIPGSIMLCIYCRIYFIAKGQ
ARSIHDAKQKVQIGLEERNGISRSRGRKAAKTLGIVMGVFLTCWCPFFVCMVMDPFLDYTIPPTLNDALIWFGYLNSTFNPMIYAFFYPWFRRALKIILVGKIFQKDSSR
SKLFSE*
247 >lcl|XP_001253701.2|Plus1166962..167930 NW_001493848 olfactory receptor, family 5, subfamily I, member 1-like LOC785806 __SEG__ Chr1 {Bos taurus} MAKENHTIKSEFILTGFTDHPELKTLLFVVFLTVFLITIVGNLGLVILISKEHRLHTPMYIFLGNLALVDSCCACAVTPKMLRNFFSKNRMISFYECMAQFYFLCTVETA
DCFLLAAMAYDRYVAICKPLQYHTMMSKKLCIQMTTGAYIAGNLHSMIHVGLLFRLNFCGSNHINHFYCDILPLYRLSCVDPYVNELVLFIFSGSVQVFTIGSVLISYIY
ILLSIFKMKSKNGRVKAFSTCASHFLSVSLFYGSLFFMYIRPNLLEEGDKDIPAAILFTEVVPLLNPFIYSLRNKEVITILRKILKKEKSQKSLKQMMSTIH*
248 >lcl|XP_001253705.2|Plus1complement(459621..460547) NW_001494175 olfactory receptor, family 12, subfamily D, member 2-like LOC785811 __SEG__ Chr23 {Bos taurus} MLNQTSVTEFLLLGVTDIQVLQPVLFVVFLAIYIVNVAGNGVIMMVVTSDPKLHSPMYFFLGNLSCLDICYSTVTLPKVLENFLSIHRTISFLGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLRYTLIMNHQVCTQMAVTIWIIGFFHALLHSVMTSRLNFCGSNHIHHFFCDVKPLLELACGNTDLNEWLLHSVTGTIAMGPFSLTLLSYFYII
IYLFFKTRSCSMLHKALSTCASHFMVVVLFYTPVVFTYIRPASGSSMDQERIIAIMYSVITPVLNPLIYTLRNKEVEGALRRVIRRRL*
249 >lcl|XP_001253726.1|Plus1complement(320547..321479) NW_001495313 olfactory receptor, family 10, subfamily H, member 1-like isoform 1 LOC787433 __SEG__ Chr7 {Bos taurus} MQGGNFSSAAEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATVWREHSLHTPMYLFLCALSISEILYTFAVIPRMLADLLSTDHSIALRACASQMFFSFTFGFT
HSFLLTIMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWAGGSVIGLVVTVAIFQLTFCGSNEIHHFVCHVQALLKLACGENVSILAMGLGLVCIAALLGCCLLILLSYA
FIVATILKIPSAEGRHKAFSTCVSHLTVVIEHYGFASVIYLKPKGPQSLEIDTLMGITYTVLTPFLSPIIFSLRNKELKIAMKKTFLSKL*
250 >lcl|XP_001253727.2|Plus1108249..109175 NW_001493848 hypothetical protein LOC785848 __SEG__ Chr1 {Bos taurus} MTEDNHSLTTEFILIGFTNHPELKTLLFQVFFTIYLITMVGNLGLVALIVTEHRLHTPMYIFLGNLALMDSCCSCAITPKILENLFSKDRMISLYECMAQFYCLCLAETT
DCFLLAAMAYDRYVAICKPLQYHTMMSKKLCIQMTTGAYIAGNIHPMIHVGLLFRLTFCKSHQINHFLCDVLPLYRHSCVDPYINELMIFIFAGSVLVFTITTVIISYLF
ILFTIFKMKSKEGKGKALSTCASHFLSVSIFYGSLLFMYVRPNSVNDEDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINAMKKIMKNL*
251 >lcl|XP_001253749.2|Plus1complement(142896..143822) NW_001492803 olfactory receptor 49-like LOC785877 __SEG__ Chr10 {Bos taurus} MGNHTTVTEFILLGLSEACELQMLLFLGLLLTYLLTLLGNLLIVVLTLMDRRLHSPMYYFLRNFAVLEIWFTSVIFPKMLTNILTGNRTISLEGCFLQSFLYFFLGTTEF
FLLAVMSFDRYVAICNPLRYVTIMSKRVCVQLVLSSWITGFLLNIIPGFLTFQQPFCGPNIIDHFFCDNFPLLELICADTSLMEILSFILANVSLLGTLSVTATCYGHIL
HTILHIPSAKERQKAFSTCSSHITVVSLFYGSCIFMYVRSGKGGQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQVNKLF*
252 >lcl|XP_001253769.1|Plus1complement(431833..432759) NW_001494175 olfactory receptor, family 12, subfamily D, member 2-like LOC785910 __SEG__ Chr23 {Bos taurus} MLNQTSVTEFLLLGVTDIQVLQPVLFVIFLATYIVNVAGNAAILMVVISDPRLHSPMYFFLGNLSCLDICYSTVTLPKMLENFLSIHKAISFLGCISQLHFFHFLGSTEV
MLLAVMGFDRFVAICKPLHYTVIMNHQVCTQMAVTVWIIGFFHALLHSVMTSRLNFCGSNHIHHFFCDVKPLLELACGNTDLNEWLLHTVTETIAMGSFFLILLSYFYII
IYLFFKTHSCRMLRKTLSTCASHFMLVVLLFGPVFFIYIRPASGSSMDHDRTVAIMYSVVTPVLNPLIYTLRNKEVKGALKRVIRRRP*
253 >lcl|XP_001253773.1|Plus1complement(152609..153550) NW_001501890 cOR8V11 olfactory receptor family 8 subfamily V-like LOC785914 __SEG__ Chr15 {Bos taurus} MERLNGTGSSEFILMGITDRPELQAPLFGLFLIIYVISVVGNVGMIILTKMDSKLQTPMYFFLRHLAFTDLGYSTTVGPKMLVNFVEDQNIISYYSCAMQLAFFLVFIIS
EIFILSAMSYDRYVAICNPLLYPVIMSQRVCWVLVAIPYVYSTFVSLLVTVKLFNLSFCGYRVISHFYCDSLPLLSLLCSNTHEVEMIILILAGFDLIFSLLIVLVSYLL
ILVSILRMSSAEGRHKAFSTCGSHLTVVTVFYGTLLFMYVQPESSHSFDTDKVASILYTLIIPMLNPLIYSLRNKDVKCALHRVWKKSGNLFY*
254 >lcl|XP_001253784.1|Plus1complement(593309..594265) NW_001493369 Olfactory receptor, family 5, subfamily F, member 1-like LOC785930 __SEG__ Chr15 {Bos taurus} MARNNCTLLTEFILLGLADTLELQAILFSLFLVIYTLTVVGNIGMILLIRTDSRLHTPMYFFLAILSFADVSYSSTITPKMLVDFLSEKKTISFAGCFLQMYFFIAFATI
ECILFGLMAHDRYVAICNPLLYSLIMSRTVCLKMAAGAFTAGLLNSVVHTGYVSSLSFCNSNVIHHFFCDSPPIFKLSCSDTRLYESILSTFAGVNIVGTLLVILTSYCY
ILFSIFCMHSGKGRHKAFSTCVSHLTAIILFYSTSIYTYLRPSPSYSLNQDKVASVFYTVVIPMLNPLIYSLRNREVKKALWNVITRKRVPSFLGLFG*
255 >lcl|XP_001253792.2|Plus1complement(138890..139831) NW_001501890 cOR8V11 olfactory receptor family 8 subfamily V-like LOC785944 __SEG__ Chr15 {Bos taurus} METHNGTVLNEFILMGITNCPELQAPLFGLFLIIYVISVVGNLGMIILTKMDSKLQTFMYFFLRHLAFTDLGYSTTVGPKMLVNFIEDQNIISYYFCAMQLAFFLVFIVS
EIFILSAMSYDRYVAICNPLLYPVIMSQRVCWVLVAIPCVYSTFVSLLVTVKLFNLSFCGYRVISHFYCDSLPLLSLLCSNTHEVEMIILILAGFDLILSLLIVLVSYLL
ILVSILRMSSAEGRHKAFSTCGSHLTVIIVFYGTLLFMYVQPESSHSFDTDKVASIFYTLIIPMLNPLIYSLRNKDVKCALHRVWKKSCNLFY*
256 >lcl|XP_001253807.2|Plus193792..94721 NW_001493369 olfactory receptor 1264-like LOC785969 __SEG__ Chr15 {Bos taurus} MESRNNVTYFVLLGLTQNPKEEKVLLFMFLFVYLLTVVGNFLIIVTVAVSKTLNTPMYFFLACLSCMDIAYSSSITPRLISDLFFGEKTITFKSCMTQLFTEHLFSGSGV
FLLLVMAYDRYVAICKPLHYLVIMKQRVCVGLLVVSWVGGFLHSVIQLSTIYGLPFCGPNVIDHFMCDMYPLLELVCTDTYVIGILVVANGGLICTIVFLLLLFSYGVIL
HSLKNLSQEGRRKALQTCGSHITVVVCFFVPCIFIYVRPAKTFYIDKSLSVFYTVITPMLNPLIYSLRNSELIYAMKKLWKRNIISHIK*
257 >lcl|XP_001253872.2|Plus1263829..264755 NW_001492803 olfactory receptor 49-like LOC786081 __SEG__ Chr10 {Bos taurus} MGNHTTVTEFILLGLSEACELQMLLFLGLLLTYLLTLLGNLLIVVLTLMDRRLHTPMYYFLHNFAVLEIWFTSVIFPKMLTNILTGNRTISLASCFLQLFLYFFLGTTEF
FLLAVMSFDRYVAICNPLHYVTIMSKRVCVQLALFSWIMGFLLIAIPCSIIFQQPFCGPNIIDHFFCDSFPLLELVCADTSLIELLGFILANVSLLGTLSVTATCYGHIL
HTILRLPAAKERWKAFSTCSSHITVVSLFYGSCIFMYVRSGKSSQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQVNKLF*
258 >lcl|XP_001253924.1|Plus1complement(11735..13075) NW_001502400 neuropeptide Y receptor Y5 NPY5R __SEG__ Chr6 {Bos taurus} MDSELKDYYNKTSAGENNTAALRNSDFPVWDDYKSSVDDLQYFLIGLYTLVSLLGFMGNLLILMALMRKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFG
RVMCHIMPFLQCVTVLVSTLILISIAIVRYHMIKHPVSNHLTANHGYFLIATVWTLGFAMCSPLPVFHSLVELQETFGSALLSNRYLCVESWPSDAYRIAFTISLLLVQY
ILPLVCLTVSHTSVCRSISCGLSNKENQLEEKEMINLTLHPSQKSGPQVKLPSSQKWSYSFIRKHRRRYSKKTACVLPAPARPPLENRPGRLPEHAGSRKSPLPSSSKFI
PGVPTCFEVKPEENSDVHEMRVNQSIMRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRSLI
HCLHMS*
259 >lcl|XP_001253927.2|Plus1106944..107870 NW_001508689 olfactory receptor 157-like LOC786155 __SEG__ ChrX {Bos taurus} MAMDNATAVFEFLLIGISNYPEWRVTFFTLVLITYLSTLLGNGLIIFLIYIDPHLHTPMYFFLSNLSFLDLCYGTVSMPQALVHCFSAHPYLSYPRCLTQISVSLALGTA
ECLLLAVMAHDRVVAIGNPLRYSVVMNSSVCVWLAATSWGASLVLTSMLILPLRLHFCEANVINHFVCEILSLLKLACSDTSLNELLILITSIFTLLLPFGFVLLSYVRI
AAAVLRIRSAQGRLKAFSTCASHVTVVVIFYGAAISMYMKPQSKSSSDQDKFISVFYGALTPMLNPLIYSLRNKDVKGAMRKVMAKRT*
260 >lcl|XP_001253958.1|Plus1complement(72787..73746) NW_001501890 olfactory receptor, family 8, subfamily K, member 1-like LOC786201 __SEG__ Chr15 {Bos taurus} MDPMEKHNHTAMHKVTEFVLTGITDSPELQAPLFGIFLVIYLVTVTGNLGMVILTHLDSKLHTPMYFFLRHLSITDLGYSTVIGPKMMVNFVVHKNTISYNWCATQLAFF
ETFIITELFILSAMAYDRYVAICKPLLYVVIMAQKVCWALVLTPYLYSTFVSLFLTLKLFKLSFCGSNVISYFYCDCVPLISLLCSDTHELELIILIFSGCNLLCSLLIV
LVSYMFILVTILRMNSSKGRYKAFSTCSSHLTAVVVFYGTLLFMYLQPKSSHTFAVDKMASVFYTLVIPMLNPLIYGLRNKEVKDALRRTLINRCKIPN*
261 >lcl|XP_001253973.1|Plus1complement(54635..55561) NW_001501890 olfactory receptor MOR185-2-like LOC786220 __SEG__ Chr15 {Bos taurus} MANRNFTQVTEFILIGVSERPDLQIPLFFVFLVIYGLTVTGNLSIITLTSVDSRLQTPMYFFLRHLAIINLGNSTVIAPKMLISILVKKHTTSFYECATQLGGFLVFIVA
EIFMLAVMAYDRYEAICNPLLYMVVVSRQACFLLVSLTYFYSFSTAVVVSCSVFSVSYCSSNVINHFYCDTVPLLALSCSDASFPETVVFISASTNLMFSITVVVASYFN
IILSILRIHSSEGRKRAFSTCASHMTAVSIFYGTLLFMYLQPRNNHSLDTDKLTSVFYTLVIPMLNPMIYSLRNKEVKAALRKFLTNY*
262 >lcl|XP_001253994.2|Plus1complement(49800..50732) NW_001501890 hypothetical protein LOC786247 __SEG__ Chr15 {Bos taurus} MANGNFTQVIEFILIGVSERPDLQIPLFFVFLVIYGLTVTGNLSIITLTSVDSQLQTPMYFFLRHLAMINLGNSTVIAPKMLINFLVKKHTTSFYECAIQLGGFLVFIVA
EIFMLAVMAYDHYVAICNPLLYMVVVSRRVCFLLVSLTYLYSFSTSIVTSFSVFSMAYCSFNVINHFYCDIVPLLALSCSNTSFPETVVFISASTNLMFSITVVVTSYFN
IILSILRICSSEGRKRAFSTCASHMTAVSVFYGTLLFMYLQPRNNHSLETDKMASVFYTLVIPMLNPMIYSLRNKDMKAALKRFLTNSCC*
263 >lcl|XP_001254009.2|Plus1complement(42421..43368) NW_001501890 olfactory receptor, family 8, subfamily J, member 3-like LOC786272 __SEG__ Chr15 {Bos taurus} MAHENFTRVIEFILTGVSERPDLQIPLFFVFLVIYGLTVTGNLSIITLTSVDSRLQTPMYFFLRHLAIINLGNSTVIAPKMLINFLVKKHTTSFYECATQLGMFLVFIVA
EIFILAVMAYDRYVAICNPLLYLAVVSRRVCFLLVSLTYLYSFSTAIVASSSVFSMSYCSSNVINHFYCDIVPLIALSCSDTSFPETVVFVSASTNLVFSIITVVASYFN
IVLSILRIRSSEGRKRAFSTCTSHMTAVSVFYGTLLFMYLQPQTNHSMGADKMASVFYTLVIPMLNPMIYSLRNKDVKAALKRFLTNSCCSFKLI*
264 >lcl|XP_001254231.2|Plus1complement(11682..12611) NW_001502331 olfactory receptor 366-like LOC786596 __SEG__ Chr11 {Bos taurus} MMRGNQSHITEFLLLGLTSDPKQQVWLFASFLAMYLVNVGGNSVIIAAIRGDAHLHTAMYFFLSNLSLVDICFTTVIMPQTLLNMLTQRKAILFAQCLAQMYFFVAFGTT
DSFLLGAMAMDRYVAICHPLHYTTTMNPRHCLQLVTASWLVSHLHSFTHTILMARLSFCGPNIIHHFFCDVQPLLTLSCSDTSLNELLAFTEGSFVIMSPFIFITVSYVY
IIHAVLRVPSGRGRYKVFSTCGSHLTVVALFYGTVISVYIRPSSTYSVTKDRVITVIYTVVIPMLNPFIYSLRNKDMKQAMKKLMRKTN*
265 >lcl|XP_001254246.2|Plus1complement(27129..28070) NW_001502331 olfactory receptor, family 1, subfamily F, member 1-like LOC786610 __SEG__ Chr11 {Bos taurus} MTRGNQSHITEFLLLGLSSDPKQQVWLFASFLVMYLVNVGGNSVIIAAIQGDVRLHTPMYFFLSNLSFVDICFTNVIVPRMLANMQSKSKKVPFTQCLMQMYFFVACAIT
DSFLLAAMALDRYVAICHPLRYTTTMNPRCCLQLVTVSWLVSHLHSLTHTILMARLSFCGPNIIHHFFCDVQPLLMLSCSDTSLNELLAFTEGSFVIMSPFIFITVSYVY
ITRAVLRVPSGRGRYKVFSTCGSHLTVVALYYGTAISVYIHPSSTYSVTKDRVVTVIYTVVIPMLNPFIYSLRNRDMKQALRKLARRKEQNKH*
266 >lcl|XP_001254257.1|Plus1818293..819462 NW_001493332 hCG1820409-like LOC786625 __SEG__ Chr15 {Bos taurus} MAPRAGQPEHRGPLLPGLLLVAAALSRPAAPCPFQCYCFGGPKLMLRCASGAELRQPPRDVPPDARNLTIVGANLTVLRAAAFAGGDADGEEAAEGGVRLPHLTALRLTH
NNIEVVEDGAFDGLPSLTALDLSHNPLRTLGGGAFRGLPALRSLQLNHALARGGPALLAALDAALAPLDELRLLGLAGNALSRLPPAALRRPRLEQLDVHLNALAGLDPD
ELRALERDGGLPAPRLLLADNPLRCGCAARPLLAWLRNSTERVPDARRLRCAAPRALHNRPFLDLEEAQLRCADSDADSRGDEVELAGPELEASYVFFGLVLALIGLIFL
MVLYLNRRGIQRWMRNLREACRDQMEGYHYRYEQDADPRRAPARAAPAGSRATSPGSGL*
267 >lcl|XP_001254355.1|Plus11006528..1007469 NW_001501769 olfactory receptor 157-like LOC786765 __SEG__ Chr8 {Bos taurus} MFQANQTSVTMFFFLGFSHYPKGEIIIFMLCLLMYLTTLLGNMILISITILDSRLHTPMYFFLSNLSCLDIWYTSSAFPPMLINFVSGENTISFLGCAAQMYFSLAMGST
ECVLLSMMAYDRYVAICNPLRYPTIINKRVCVQIAAGSWVTGCFTALVETVFVLQLSLCGRSVISHFACEILAVLKLVCVDTTKAQLIILVFTILLVPMPMLLICISYAF
ILSNILRISSVDGQSKAFSACAAHLSVVVLFYGTALSMYLKPSAIDSQEIDKFIALVYGALTPMLNPIIYSLRNKEVKAAVKKLLIGNSLVLS*
268 >lcl|XP_001254392.1|Plus1complement(162438..163388) NW_001502331 olfactory receptor, family 1, subfamily F, member 1-like LOC786822 __SEG__ Chr11 {Bos taurus} MDAANESSEGSPFILLGLTTNPSQQRPLFMLFLVLYVAGILGNGLIVAAIQASPALYTPMYFLLAHLSFADLCFTSVTVPKMLANLLAHNRSISLAGCLTQMYFFFALGV
TDSCLLAAMAYDRYVAIRHPLHYATRMSRAMCTALVGTAWLVSHVHSLLHILLMARLSFCASHQVPHFFCDHQPLLRLSCSDTWHIQLLIFTEGAAVVVTPFLLILASYG
AIAAAVLRLPSATGRLRAVSTCGSHLAVVGLFYGTVIAVYFQPTSRYEAERGRVATVMYTVVTPMLNPVIYSLRNRDVQGALRALFTQRRISGADS*
269 >lcl|XP_001254422.3|Plus1complement(170960..171922) NW_001502331 olfactory receptor Olr434-like LOC786864 __SEG__ Chr11 {Bos taurus} MTPENFTWTWGSPAEFILLGITDRWDLRLTLFLIFLPVYLVSLLGNAGMVLLIHIDAQLHTPMYFFLANLSLLDACYSSAIGPKMLVDQLLPRTSIPYAACVLQMFLFTG
LADAECCLLAAMAYDRYVAIGNPLLYTTATSRRLCLVLLGASGLGGAVSAVVHTTFTFRLSFCGSREVNSFFCDIPPLLAISCNDTSLNELLLFAVCGFIQTATVSAIAV
SYGFIAGAVIRMRSAESRWRAASTCGSHLTGVAMLYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKEVKEALRRTWSRCCGPRRRHQ*
270 >lcl|XP_001254436.2|Plus143252..44169 NW_001501761 olfactory receptor 853-like LOC786879 __SEG__ Chr7 {Bos taurus} METKNQTDIAEFLLLGLSEDPEEQPLLFGLFLTIYLVTALGNLLIMLAIGSDSHLHTPMYFFLSHLSFTDLCFSTTTVPKMLVNIERRSKSISYTGCLTQVCFVLLFAGL
ENFLLAAMAYDRYVAICHPLRYVVIMNPCLCGLLILLSLVISSADALLHTLMVFRLSFCTELEIPHFFCELDQVIKVACSDTLINNIVVYLVTSILGGVPLLGIIFSYTQ
IVSSILRMPSAGGKYKAFSTCGSHLSVVSLFYGTAFGVYISSALTHSSKETAIASLMYTVVPPMLNPFIYSLRNRDMKQALRKLI*
271 >lcl|XP_001254531.1|Plus1446621..449011 NW_001495372 protocadherin beta 15 PCDHB15 __SEG__ Chr7 {Bos taurus} MEAGVERFRQQRQVLILFLLLGVTFAGWESRRYSVMEEIESGSFVANLVKDLGLGVGELAAREARVVSEDNEPRLQLDLQTGKLTLNEKLDREEMCGPTDPCVMHFQVLL
KKPLGVFRAELLVRDINDHAPEFPEREMTLKIPENSPPGTVFPLKKAQDLDVGNNNIQNYSISPNSYFHVSTRNRGDGRKYPELVLDRELDREKQALLRLTLTALDGGSP
PRSGTTQVRILVLDINDNAPEFAQAHYQVQVLENSPVGALVVKVSARDLDTGTNGEVSYSLFYSSQEMSPTFELNSLSGEVRLIKKLDFETVSSYDLDIDAFDGGGLSGK
CSVSIEVVDVNDNAPELTISSLTSPIPENSPETEVALFRIRDRDSGENGKMTCSIQDDLPFILKPSEENFYTLVTNGALDRESKAEYNVTITVTDLGTPRLKTEHNIIVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFRVGATDRGSPALSSQALVRVL
VADANDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDAGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPAPEAEAAAAAPADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLVDVSGTGTLSQSYQYEVCLTGGTGTNEFKFLKP
VLPSILESNFERKSEGSPTLQNRLGI*
272 >lcl|XP_001254579.2|Plus17520..8467 NW_001492991 olfactory receptor Olr418-like LOC787071 __SEG__ Chr11 {Bos taurus} MERLNQTSSVTEFILLGLSSRPEDQKPLFILFLIIYLITITGNLLIILAIHSHPQLHTPMYFFLSVLSFTDIWYTTTIVPKMLVDFLLEKKTISYAGCLTQMYFIYALGN
IDSCLLVAMAYDRYVAICDPFHYVTIMSHQRCVLMVAFSCSLPHFHSLLHILLLNQLTFCDSNIIHHFLCDLSPLIKLSCSPTFVNEIVLMTEASAFLVTPFLCIVFSYI
RILVVVLKIPSAAGKCKAFSTCGSHLTVVTLFYGSIFYVYLQPVSTYTVRDHMATIVHTILSSMLNPFIYSLRNKDLKQGLRKLVGRRGLQAATS*
273 >lcl|XP_001254662.2|Plus1complement(2525628..2526566) NW_001492801 odorant receptor MOR10-like LOC787189 __SEG__ Chr10 {Bos taurus} MSKANYSSVSEFVFLGLSTSRPVQHFLLAFSTVFYVIIVLGNFLVVFTVTFDPHLHSPMYFLLANLSSIDLCFSTLTVPKMISDLYSGHKTISFQGCVTQIFVLHTLGGS
EMVLLTAMAFDRYVAICKPLHYLTIMSPRVCLLLLCGAWAIGLIHSVVQLAFVIHLPFCGPNEIDSFYCDLPWFIKLACIDSYRMEFMVTANSGFISMGTFFLLIISYVF
ILVTVWKHSSGGLRKALSTLSAHITVVVLFFGPCIFVYMWPFPTVTVDKFLAILDFLVTPILNPAIYTLRNKDMKTAMSRLSNQLLSLRKVS*
274 >lcl|XP_001254677.1|Plus1328411..329352 NW_001492991 olfactory receptor, family 1, subfamily J, member 4-like LOC787209 __SEG__ Chr11 {Bos taurus} MRPENQSHMSEFLLLGLPICPEQQGMFFVLFLSMYLTTVLGNLLILLLIRLDPRLHTPMYFFLSHLAFTDISFSSVTVPKMLINMQTQDQSIPYAGCIAQMYFFLLFGCI
DNLLLVAMAYDRYVAICHPLHYTTIMREGLCMFLLAGSWLLSCVIALSHTILLAQLSFCEDNIIPHFFCDLAALLKLSCSDTSVNELVIFTAGTAVVILPLSGILVSYGL
IGVSILRVPSTKGICKALSTCGSHLSVMSLFYGTIMALYFSTSSGKSKDKDMIASLMYTLVIPMLNPFIYSLRNRDMKLALGFLFKSNNLLIK*
275 >lcl|XP_001254704.2|Plus1complement(2479109..2480095) NW_001492801 odorant receptor MOR10-like LOC787247 __SEG__ Chr10 {Bos taurus} MYERNDTSVSEFVFLGLSASRPVQHFLLAFSTVFYVTIVLGNLLVVFAVTFDPHLHSPMYFLLANLSSIDLCLSTLTVPKMISDLYSGHKTISFQGCVIQIFVLHTLGGS
EMVLLTAMAFDRYVAICKPLHYLTIMSPQVCLLLLCGAWAIGLIHSVVQLAFVIHLPFCGPNEIDSFYCDLPWFIKLACVDSYRMDFMVTANSGFISMGTFFLLIISYVF
ILVTVWKRSSDGLHKALSTLSAHITVVVLFFGPCIFVYMWPFPTVPVDKFLAILDFLVTPILNPAIYTLRNKDMKTAMRRLVTHGSTAYFKQLHEIQVVIYKFGAVFF*
276 >lcl|XP_001254707.1|Plus1294997..295938 NW_001492991 olfactory receptor Olr413-like LOC787249 __SEG__ Chr11 {Bos taurus} MRLENQSHVSEFLLLGLPIQPKQQGVFFALFLGVYLTMVLGNLLILLLIRLDPRLHTPMYFFLSHLAFTDISFSSVTIPKMLINMQTQDQSIPYAECIAQMYFFLLFGCI
DNLLLVAMAYDRYVAICHPLHYTTIMREGLCMFLLAGSWLLSCVIALSHTILLAQLSFCEDNIIPHFFCDLAALLKLSCSDTSVNELVIFTAGTAVVILPLSGILVSYGL
IGVSILRVPSTKGICKALSTCGSHLSVVSLFYGTIMALYFSTSSGKSKDKDMIASLMYTLVTPMLNPFIYSLRNRDMKLALGFLFRRNNFLIQ*
277 >lcl|XP_001254747.2|Plus12455254..2456159 NW_001492801 olfactory receptor Olr750-like LOC787306 __SEG__ Chr10 {Bos taurus} MEEANQSVVSEFIFLGLCDSWDLQAFLLVAFSSLYLITILGNVFIVLLVIADLHLHSPMYFLLANLSFSDLCFSSVTTPKLIIDFLKENKTISFRGCMCQMFFGHFFGGG
EMVLLVMMAYDRYVAICKPLHYSSIMNTKMCIQLVTTSWIIGFVHSISQLAIITQLPFCGPRKLDSFFCDIPLVIKLVCMDTYILEVLTNANSGVLATVCFILLLISYSY
ILLTVCHQSKGGASKALSTCTAHITVVMLFFGPCIFIYLCPLSITWVDKFLAVFYGIITPLLNPVIYTLRNKEIRNAIKRL*
278 >lcl|XP_001254754.2|Plus1complement(1166520..1167740) NW_001494530 G protein-coupled receptor 44 GPR44 __SEG__ Chr29 {Bos taurus} MLANVTTKPLCPLLEQMSRLQSHSNSSIRYMDHVSVLLHGLASLLGLVENGLILFVVGCRMRQTVVTTWVLHLALSDLLATASLPFFTYFLAVGHSWKLGTTFCKLHSSI
FFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLALWVLAVINTVPYFVFRDTIPRLDGRIMCYYNVLLLSPGPDRNATCDSRQTALAVSKFLLAFAVPLA
IIASSHLAVSAQLRHRGRRRSSRFVRLVAAVVAAFALCWGPYHVFSVMEARAHANPSLRPLVWRGLPFVTSLAFINSVINPLLYVLTCPDVLRKLRRSLRSVLESVLVDD
SDLAAGGSNRRRRRASSTNASASSISESSGHRLHALWPARLLDWLRGDPAAPPQRDRTPSQDERGPLNRALSTTSG*
279 >lcl|XP_001254755.2|Plus1267749..268309 NW_001494754 vav 2 oncogene-like LOC787315 __SEG__ Chr3 {Bos taurus} MLSRPAPGSQVGSLCATAAAEPAGAHEERAGLAAAAARRRRTRAGIGAEPGAGPGIRPPRRLLLRTVAGKGPAAAGVGGAEERRRLHLRCLHRPGSVQAPSGMEPWKQCA
QWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQVTRPARSPPPPAGISH*
280 >lcl|XP_001254802.2|Plus1complement(570231..571175) NW_001493369 Olfactory receptor, family 5, subfamily F, member 1-like LOC787385 __SEG__ Chr15 {Bos taurus} MARKNYTLLTEFILLGLADSLELQITLFCLFSVIYTLTVVGNVGMILLIRADSRLHTPMYFFLANLSFVDVCYSSTITPKMLVDLLSEKKSISFAGCFLQMYFFLALATT
ECILFGLMAHDRYVAICNPLLYSLIMSRTVCLKMAAGAFTAGLLNSMVLTSCISSFNFCSSIVIHHFFCDSPPLFKLSCSDTHLYESILSIFAGVNIAGSLLVILTSYCY
ILFSIFHMHAGEGRRKAFSTCASHLTAIILFYSTSIYTYLRPTSSYSLTQDKVASVFYTVVIPMLNPLIYSLRNREVKKALWNVVTRKRISSFL*
281 >lcl|XP_001254811.2|Plus1complement(3682..4620) NW_001495047 olfactory receptor 49-like LOC787401 __SEG__ Chr5 {Bos taurus} MKNQTSITTFILLGLTDDIRLKNLLFIFLFLSYTLSISGNLSIITLTLIDSHLKTPMYLFLQNFSFLEISFTTACVPRFLYSIPSGDKSITYAACASQLLFTDLFAVTEF
FLLAIMSYDRYVAICKPLHYTTIISIRVCKNVILFCWVAALIIILPPIMLGLELEFCDSNIIDHFCCDASPILKISCSDTWLIEQMVIVCAVLTFIITLICVVLSYIYII
STILRFPSALQRKKAFSTCSSHVIVVSITYGSCIFIYVKPSAKDEVAINKGISLLITSISPMLNPFIYTLRNKQVKQAFLHSIKNIAFCSKI*
282 >lcl|XP_001254823.2|Plus1250805..251845 NW_001494731 C2 calcium-dependent domain containing 4D C2CD4D __SEG__ Chr3 {Bos taurus} MWLLEKAGYRAGAAEPRARWAPSSLFPKRRTPCPLAHPCPNVLTPDRIPQFFIPPRLRDPGGALPHSGGRGLPATCSLPHLAGREGWAFLPESPHTRRRESLFHWPPPTP
AGGLPPAPSRLHVSAPDLRLCQAPDSDTASSPDSSPFGSPRPGPDRPRPRSLSRVQASSAGSSPHASRRAGPPTPPLFHLDFLCCQLRPTQESVLHLEPRGGQLRLSAEY
PAGPGRLRLRLVSAEGLPRSRAGPGSGGGGCCVVLRLRPRARPRGQRSRVVKCSTNPIFNEDFFFDGLGPPDLAAHSLRAKVLDRGAGFRRDVLLGECETPLIALLPPLG
AGLGPGASLVPAHLSL*
283 >lcl|XP_001254829.3|Plus1complement(548768..549733) NW_001493369 olfactory receptor Olr555-like LOC787428 __SEG__ Chr15 {Bos taurus} MQSRNVNLEREDHLKITETNLTIMMEFVLLGFTDIPQFQWFLFGIFLVIYMIILLGNGVIILITRVDAILQTPMYFFLRNFSFLEICYVSITLPRMLMDLWTQKGTISLF
TCATQMCFFLILGTTECFLLAVMAYDCCVAICDPLHYPLVMCPEVRIRLVVASWISAVPVQIGQTCQIFSLPFCGSNTINHFFCDIPPLLKLACGDIFVNEMVVYIFGIL
FVTVPFLLILGFYIRIISTILKLPANTGWTKAFSTCSSHITVVLLFYGSATVTYLKPKSNQHEGIDKMISLFYTILTPMVNPIIYSLRNKDVRKAMRKFLP*
284 >lcl|XP_001254833.1|Plus1671188..671409 NW_001494716 guanine nucleotide binding protein gamma 11 GNG11 __SEG__ Chr3 {Bos taurus} MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSREDPLVKGIPEDKNPFKEKGSCIIS*
285 >lcl|XP_001254839.2|Plus1complement(31429..32436) NW_001495047 olfactory receptor 780-like LOC787442 __SEG__ Chr5 {Bos taurus} MSLNSAVQTFLTFTSRFGKIQESIMRNHTTVTVFILLGLTEDPQLQVLLFIFLFLTYILSITGNLTIITLTLVDPHLKTPMYFFLQNFSFLEISFTTSCIPRFLYNISTG
DRTITYNACAIQLFFTYLFGVTEFFLLATMSYDRYMAICKPLHYMTIMSNKLCKTMIICCWMVALMTILPPLSLGFHLEFCDSNVIDHFACDASPLLKISCSDTWLIEQM
VIACSVLILIITLICVVFSYIYIIRTILKFPSLQQRKKAFSTCSSHMIVLSISYGSCIFIYVKPSAKEGNINKGVSLLISSISPMLNPFIYTLRNKQVKQAFNDSLKKAA
FLLRK*
286 >lcl|XP_001254842.2|Plus1<527605..528621 NW_001493369 olfactory receptor, family 5, subfamily I, member 1-like LOC787446 __SEG__ Chr15 {Bos taurus} WNVKMKTEMSGSPSDLDLYRIQMKNSTEVTMFILMGFTDDSEVQIFLFLLFLAIYLFTMIGNLGLVFLVIMDSRLHNPMYYFLAALSFLDACYSSVITPKMLINFLSENK
TISFLGCATQMFLFLTCGTTECFILAAMAYDRYVAIYNPLLYLVTMSPRVYVPLIISCYVVGVLHATLHTGATFTLSFCGSNEIRHVFCDIPPLLAISCSDTRMNQLLVF
YFAGSIEISTILIVLISYGFILLAILRMGSAEGRRKVFSTCGSHLTGVSIFHGTVLFMYVRPSSSYALDHDMIVSVFYTIIIPMLNPIIYSLRNKDVKDAMKKVLGKNWF
INKVYFSH*
287 >lcl|XP_001254847.1|Plus12563848..2564780 NW_001494522 olfactory receptor MOR167-3-like LOC787455 __SEG__ Chr29 {Bos taurus} MAPGNGSFVTAFILVGLTDQLDLQVPLFFLFLLMYMVTVIGNLSLIILIGIHSHLHTPMYFFLLNLSFTDLCYSSVFTPKMLIDFLSKENIISYMGCMTQFYFFCFFVVS
ECYVLTSMSYDRYVAICKPLLYNTAMSPKVCFSLMLGSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDIHPLLQLSCTSTYVTELVVFIMACINIIVPSLTIFVSYGL
ILSSILHIKSTEGRSRAFSTCSSHIIAVSLFFGSGAFVYLKSSSTGSLDEGKISSVFYTNVVPMMNPLIYSLRNKDVKSALRKTLRRRKY*
288 >lcl|XP_001254891.2|Plus1complement(94863..95801) NW_001495047 olfactory receptor 791-like LOC787518 __SEG__ Chr5 {Bos taurus} MRNHTSLPTFILLGLTDDPPMQVLIFIFLLVSYLLSVTGNLTIIILTLLDSRLKTAMYFFLKHFSFLETLFTSVCIPRFLYSLSTGDKTISYNACVSQLFFIFLFAVTEF
FLLAIMSYDRYVAICKPLHYATIMNSRICGRLVICCWIAGGLVIFPPLCLGLNLEFCDYHVIDHFLCDASPMLKISCSDTWFIEQMVVALAVLTNIGTFLCVVLSYIYII
KTIIKFPSAQQKMKAFSTCSSHMIVVSITYGSCIFIYVKPSAKDEVAINKGVLVLTTSVAPMLNPFIYSLRNKQVKEAFTDLIKRISMISKK*
289 >lcl|XP_001254906.2|Plus1complement(108947..109885) NW_001495047 olfactory receptor, family 6, subfamily C, member 2-like LOC787535 __SEG__ Chr5 {Bos taurus} MRNHTVITTFILLGLTEDPQLQVLVFVFLFLTYLLSITGNLTIIILTFLDSHLKTPMYFFLRNFSFLEISFTTVCIPRFLYSISSGDNSITYNACASQIFFIGLFGATEF
FLLAAMSYDRYVAICKPLHYMTIMNGRVCTILVFCCWISGLMIIITPLSMGLQLEFCDSNAIDHFGCDAAPLFKISCSDTWFIEQIVIICAVVTFIITLIGVVLSYMYII
RTILRFPSASQRRKAFSTCSSHMIVVSITYGSCIFIYIKPSAKEEVDINKGVSVLTTSVAPLLNPVIYTLKNKQVKQAVSDIIKKIAFFLHN*
290 >lcl|XP_001254922.1|Plus1904826..905773 NW_001495357 olfactory receptor MOR254-1-like LOC787559 __SEG__ Chr7 {Bos taurus} MDAYNQTTVTHFILIGLSDCPEVRYPLFVVFAIIYQVTVRGNGAILLAIGTEKKLHTPMYYFLASLSLLDIFCPSVTVPKMLENLLTEKHSISFTGCALQLYFLVALVGT
EVFLLSVMAYDRYVAICFPLRYTLIITKVRCVKLTAGTWTAGFLNSLLHTVSMFHLSFCKSNQVNQYYCDIPPVLVLSCSSTYVAEMLILVEGGILGISSFLVTFISYFY
IVSAILKIQSTGGKHKAFSTCASHLLVVCLFGGTTVFTYVRPYSSQHFPARDRLISMLYGIITPMLNPMIYSLRNTEVKGALRRVLCHRVYSLQV*
291 >lcl|XP_001254940.1|Plus1complement(738366..739334) NW_001493314 olfactory receptor 78-like LOC787584 __SEG__ Chr15 {Bos taurus} MSSPNVTESHPSSFLLLGIPGLEVAQIWLGFPFCVVYLIALIGNIIILLVIWTDRSLHQPMFYFLAMLSVIDLSLSTATIPKTLGIFWFSLQELCFGCCIAQVFFIHFFT
VMESIVLLAMGFDRYVAICNPLRYSMTLTNRVIGMIGMVVVLRSLCMIAPIIFLLLRLPYCGHRIIPHTYCEHMGVARLACASISANVYYGLGNISILFLDVLLIIISYA
RILNTVFHLPSQDARLKALNTCSSHICVILAFFCPALFSFLTHRFGHSIPQYIHILLANLYVVVPPALNPVIYGIRTKQIQERVQSIFVKKKKIELEVIHSA*
292 >lcl|XP_001254965.3|Plus1611722..612648 NW_001494524 olfactory receptor Olr1242-like LOC787625 __SEG__ Chr29 {Bos taurus} MAPGNDSFVTEFILLGLTDRPDLQPPLFLLFLGMYMITILGNLGLIILISLNSNLHTPMYFFLFNLSFIDLCYSSVFTPRMMINFTSKKNIISYMGCMTQLYFFCFFVIS
ECYVLTSMAYDRYVAICNPLLYNVAMSPKVCSSLVLSSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDVHPLLQLSCTSTYVNELVVFIVVGINIIVPSFTIFVSYCL
ILTNILQIKSTEGRSKAFSTCTSHIIAVSLFFGSMSFMYLKPSSAGSMDEEKISSVFYTNVVAMMNPLIYSLRNKDVKTALRKTLSRR*
293 >lcl|XP_001254979.1|Plus1complement(795687..796652) NW_001493314 olfactory receptor, family 52, subfamily N, member 2-like LOC787652 __SEG__ Chr15 {Bos taurus} MSGANISSMTPGFFILNGVPGLESTHIWISLPFCFMYIIAVVGNCGLIYLIGHEEALHHPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIDFNGCLAQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYATILTSAVIAKAGLATLLRGVMLIFPFTFLTKRLPYCRGNFIPHTYCDHMSVAKVSCGNFRVNAIYGLMVALLIGVFDMCCIAVSY
TMILRAVVSLSSTDAHHKAFSTCTSHICAIVITYVPALFTFFTHRFGGHSVPHHIHIIVANLYLLLPTTMNPIVYGIKTKLIHEGVIKFLLGEKVVFTQDT*
294 >lcl|XP_001254984.2|Plus1241593..242531 NW_001495047 olfactory receptor, family 6, subfamily C, member 1-like LOC787659 __SEG__ Chr5 {Bos taurus} MKNYTEITDFILLGLSDDPQLQVVIFVFLLITYMLSITGNLTIIILTLLDVHLQIPMYFFLRSFSILEVSFTTVTIPRFLATIITGDKTISYNDCMAQLFFFILLGVTEF
YLLAAMSYDRYIAICKLLHYMTIMNHRVCTLLVLASWLASFLITFPLLMFSLQLDYCKSNAIDHYTCDFSPLLQLSCSDTKFLEIMVFSCAVFTLMFTLALIILSYTYII
RTILRIPSTTQRTKAFSTCSSHMIVISISYGSCIFMYMNPSAKDRVSLSKGVAVLNTSVAPMLNPFIYTLRNQQVKRAFIDMARKNVLFSRK*
295 >lcl|XP_001254986.1|Plus11091768..1092736 NW_001495357 olfactory receptor 49-like LOC787662 __SEG__ Chr7 {Bos taurus} MDQRNKTIVTEFILLGFQNGKEVEILLFSAFLLMYMISLIGNTMIILLVCGDYCLHSPMYFFVANLSFLEVAITSTVVPKMLANTFSLTKAISFVGCLTQSFFYFLLGST
EFFILAVMSFDRYVAICNPLRYAIIMNKQTCISLLLGSYIGAFLSILVSSMLTAPLPFCGPNVINHFFCDSAPVLKLVCADISVAELADFVSSVLLLLGSLLLTGVSYTY
IIITIFRIPSVQGRHKAFSTCVSHITVVTLYYGSSIFIYVRPQKGNVTDVNKFATVLNTIVTPMLNPFIYSLRNEKVKDSLRDGVNKYVIMLTNLRSLKSKK*
296 >lcl|XP_001254987.2|Plus1217574..218530 NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC787665 __SEG__ Chr7 {Bos taurus} MEPGNSTQIPEFLLLGFSEGPELQPLIFGLFLSMYLITVFGNLLIILAVSSDPHIHTPMYFFLSNLSFVDICLTSTIIPKMLQSTQTQSKVITYEGCIIQVYFYLFFAGL
DDLLLTVMAYDRYVAICHPLHYTVIMSPWFCGLLVLLSWVLSSMHSLLQSLMILRLSFCSDLEIHHFFCETTWLIQLACSDPFLNNMVMSFGSVILGGGPLAGILYSYSK
IVSSICGISSAQGQCKAFSTCASHLSVVSLFYCSALGVYLSFTATHSSHTSAIVSVMYTVVTPMLNPFIYSLRNKDINRALKRFFGMETFRKGPFTLS*
297 >lcl|XP_001254995.2|Plus13631160..3632092 NW_001494955 olfactory receptor 438-like LOC787688 __SEG__ Chr4 {Bos taurus} MGSNQTWITEVTLLGFQVDSALEFFLFGLFSLFYTLTLLGNGVILGLICLDSRLHTPMYFFLSHLAIIDISYASNNVPKMLANLVSQKTTISFVPCIMQTFLYLAFAAAE
CLILVVMSYDRYVAICHPLHYTFIMSWRVCTVLTSTSWAFSFLWDLVHLVLILKLPFCGPHEINHFFCEILSVLKLACADTWLNQIIIVASCVCILVGPLCLVLGSYARI
LAAILRIQSAEGRRKAFSTCSSHLCVVGLFFGSAIVLYMTPRSSHSQEQRKILSLFYSLFNPMLNPLIYSLRNAEVKGALRKTLGKKRSV*
298 >lcl|XP_001254999.3|Plus1complement(661273..662205) NW_001494524 olfactory receptor 893-like LOC787694 __SEG__ Chr29 {Bos taurus} MNMENASSVTEFILMGLTEQPKLQLPLFFLFLLNYLVTGLGNLCLMILICLNSHLHTPMYFFLFNLSFIDLCYSSVFNPKMLMNFISKRNVISFTGCMSQLFFFCFFVSS
ECYVLTAMAYDRYVAICKPLLYTVAMSPQVCSLLMSGSYVMGFAGAIVHTGCMMRLIFCGSSIISHYMCDILPLLQLSCSSTYANEFVVSAVVGTVVIVSSLIILISYAL
ILYNILHIPSSKGWSKALSTCGSHITTVGLFYGFGLLTHIRPPSSSFVEQGKFFSVLYTNVVPMLNPLIYSLRNKDVKIAVKKTLKRITK*
299 >lcl|XP_001255012.1|Plus1complement(287634..288689) NW_001495047 olfactory receptor, family 6, subfamily C, member 68-like LOC787720 __SEG__ Chr5 {Bos taurus} MLDESNKQESSHHWLFSSLNSAVQISLTFTGRFGKIQESIMRNHTTVTLFILLGLTDDPQLQILLFIFLFITYILSITGNLTIITLTLMDPHLKTPMYFFLQNFSFLEIL
FTTTCIPRFLYNLSTGDRVITYKACFIQLFLTDLFGVTEFFLLATMSYDRYVAICKPLHYMTIMSNKLCKTMVICCWMAALMTILPPLSLDFHLEFCDSNIIDHFACDVS
PLLKISCSDTWLIEQMVIACSVLILIITLLCVVLSYIYIIRTILKFPSLQQRKKAFSTCSSHMIVLSISYGSCIFIYIKPSAKEEVNINKGVSLLISSISPMLNPFIYTL
RNKQVKQAFDGSLKKIAFLLR*
300 >lcl|XP_001255023.1|Plus13685129..3686061 NW_001494955 olfactory receptor OR7-15-like LOC787740 __SEG__ Chr4 {Bos taurus} MKGNQSWIAEFILLGFQLSEDMELLLFVIFILLYTFNLLANGMILGLISLEPRLHTPMYYFLSHLAITDVAYASSHLPNMLENLVKHKKTISYFSCTMQMVSYLAFASVE
CLTLVVMSYDRFVAICHPLQYTVIMNWRVCTFLAIACWVCGFSLAIVQVSLFLRLPFCGPQKVNHFFCEISSVLKVTCGDIWINEMFLFADGVFILVGPLSLMLVSYVSI
LWAILKNQSKEGRKKAFSTCSSHLCVVGFYFSIAMMVYLAPDSSHQEEQKKILFLFYTFFNPLLNPLVYSVRNAQVKAAFHKVLQKNRSV*
301 >lcl|XP_001255033.2|Plus1complement(1188965..1189936) NW_001495357 olfactory receptor Olr1654-like LOC787758 __SEG__ Chr7 {Bos taurus} MEIWNNRTTGTDFVLLGLFHCILIPKLLFTFIFLVFLVALIVNIMMVILIWLNSHLHTPMYFLLSQLSLMDLLYISTFVPKIAIDFLSGRNNISYTNCGIQLFLFMTLVG
AECLLLAVMAYDRYVAICHPLHYSILMCPTVCIFMVAGTWLGALINAFVHVVYVLNLPFCGSREIHHFFCEIPALLKLVCADTSLYENGLFISGVIFLLFPISAIVASYG
QIFSTVLRLELNMGMRKALSTCSSHMIVVILFYGTAIIKYFLPKAYHTAEQDKVVSVFYTILTPMLNPLIYSLRNKEMSGALRKVLRRKITKLISIENRRRKN*
302 >lcl|XP_001255044.1|Plus11073174..1074118 NW_001494955 olfactory receptor 49-like LOC787774 __SEG__ Chr4 {Bos taurus} MLKNYSSTTEFYLLGFPGSKELHNILFATFFFFYLVTVMGNILIIVIVCVDKRLQTPMYFFLGHLSVLEMLTTTVTVPLMLWGLLLPGMQAISLTACCVQLYLYLSLGTS
EFILLAVMAVDRHVAVCNPLRYTIITNSHTCLWVVIVSWVFGFLFQIWPVYATFHLTFCKSNVLDHFYCDRGQLFKLSCDDSLFTEFILFLMAVFVLFGSLIPTIVSYTY
IISTILKIPSGSGQWKAFSTCASHFTCVVIGYSSCLFLYVKPKQTQAAEYNRVASLMVLVITPCLNPFIFTLRNDKFREVFRDAMKSCYRLLKA*
303 >lcl|XP_001255060.2|Plus1complement(340096..341028) NW_001495047 olfactory receptor, family 6, subfamily C, member 76-like LOC787797 __SEG__ Chr5 {Bos taurus} MRNRTSVTEFILLGLTDDPKMQAAIFFFLFLTYVLSVSGNLTIIILTLLASHLKTPMYFFLRNFSFLEILFTSVCNPRFLISILTGDKSISYNACAAQLFFFILLGSTEF
FLLASMSYDRYVAICKPLHYTTIMSNKICYQLVGGSWLAGFLVIFPPLTIGLQLDFCDSNIIDHFTCDSAPLLQISCTDTSTLELMSFVLALLTLMSTLMLVILSYSYIL
RTILRIPCAQQRKKAFSTCSSHMIVVSISYGSCIFMYVKTSAKEGVALTKGVAMLNTSVAPMLNPFIYTLRNQQVKQAVKDVVRKMFSKH*
304 >lcl|XP_001255077.2|Plus11253981..1254919 NW_001495357 olfactory receptor Olr1654-like LOC787816 __SEG__ Chr7 {Bos taurus} MENWNTTSDFILLGLLNHTGAHQFLFVLVLITAFTSFVGNALMFLLILLDSGLHRPMYFLLSQLSLMDMILVITIVPKMAADYLTGRMFISQVGCGFQIFFFLTLEGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWQLCLRMTLGSWFLGAADGLMQAAATLNFSFCRTHEIDHFFCEAPSLVRLACADTSVFEYAMYVCCVLMLLVPISLILISYSLIL
AAVLQMCSNEARKKAFTTCSSHISVVGLFFGAAIFTYMRPKSFRSANHDKIVSAFYTIFTPVLNPLIYSLRNSEVKGALRKCMDQCAALSHD*
305 >lcl|XP_001255099.1|Plus1442985..443929 NW_001495047 olfactory receptor Olr1012-like LOC787866 __SEG__ Chr5 {Bos taurus} MKNHTRPTEFILLGLSDDPELQIVIFLFLIITYILSVTGNLTIIILTLVDSHLQTPMYFFLRNFSILEISFTTVCIPRFLGTIITRNKTISYNDCTAQLFFFIFLGITEF
YLLTAMSYDRYVAICKPLHYTTIMNNRVCVLLVFCAWLAGFLNIFPPVILFLQLDYCSSNIIDHFACDYFPLLKLSCSDTWLLEVIGFYSAIEILLFTLALIILSYMFII
KTILRLPSASQRKKAFSTCSSHIIVISISYGSCIFMYTNPSAKEKASLNKGASILNASVPPMMNPFIYSLRNQQVKQAFKETIQKVIFFSSKCK*
306 >lcl|XP_001255112.2|Plus1399702..400670 NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC787882 __SEG__ Chr7 {Bos taurus} MEPGNNTQSSELFLLGFSEDPELQPLIFGLFLCMYLITVFGNLLIILVIISDFHLHTPMYFFLSNLSFVDICFTSTTIPKMLKNIENQSKVITYEGCIVQVYFCIFLAGL
DDFLLIVMAYDLFVAICHPLHYTVVMNPRLCGLLVLVSWMVSAMHSLLQSLVALQLTFCTKVEIPQFFCELNQMVQLACSDTFLNNMVMYLASVLLAGGPFAGILYSYSK
IVSSIRRISSTQGKFKAFSTCASHLAVVFLFYCMSLGVYLSSAATHSSHSSAIASVMYTVVTPMLNPFIYSLRNKDIKRALKRVCEIVGIKRPIVLGQMKCP*
307 >lcl|XP_001255122.1|Plus1complement(1305655..1305987) NW_001494731 cyclic AMP phosphoprotein, 19 kD LOC787895 __SEG__ Chr3 {Bos taurus} MFKEVSEAASTEKQKELEDKVTSPEKAEKVKLIARDPHLGQKPRGSDFLRKCLQKGKKYFNSGDYNMAKMKNKQLPIAVPDKTEITGNHKPTPQDLSQRKPCLVASKLTG
*
308 >lcl|XP_001255124.2|Plus11399238..1400170 NW_001495357 olfactory receptor Olr1654-like LOC787898 __SEG__ Chr7 {Bos taurus} MENWNITADFILLGLFNHTGAHQFLFVLVLIIAFTSLVSNALMLLLILLDPRLHRPMYFLLSQLSLMDLMLISAIVPKMAIDYLTGRKFISPAGCGFQIFFFLTLGGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWKVCLSMILGSWFLGAVDGLMQAAATLNFSFCSTREIDHFFCEAPTLVHLACADTSVFEYVMYICCVLMLLIPISLILISYSLIL
AAVLHMHSNEARKKAFATCSSHLSVVGLFFGAGIFTYMRPKSYKSANYNKVVSVYYTIFTPVLNPLIYSLRNSEVKGALQKCMNRCAAYE*
309 >lcl|XP_001255132.1|Plus1complement(486350..487288) NW_001495047 olfactory receptor, family 6, subfamily C, member 3-like isoform 1 LOC787913 __SEG__ Chr5 {Bos taurus} MRNYTEITEFILLGLSDDPQLQVVSFIFLLITYMLSITGNLTIIILTLLDAHLQTPMYFFLRNFSLLEVSFTTVSIPRFLATIITGDKTIPFNDCMAQLFFFIFLGVTEF
YLLAAMSYDRYIAICKPLHYLTIMNHKVCTLLVLASWLASFLIIFPLVMLFLQLDYCKSNVIDHFSCDYFPLLYLSCSDTKFLEIVGFSCAVFILLFTLALIILSYTYII
RTILRIPSTTQRTKAFSTCSSHMIVISISYGSCIFMYMNPSAKDRVSSSKGVAVLNTSIAPMLNPFIYTLRNQQVKRAFMDTARKTIFFSSK*
310 >lcl|XP_001255145.2|Plus11455861..1456799 NW_001495357 olfactory receptor Olr1654-like LOC787932 __SEG__ Chr7 {Bos taurus} MENWNITADFILLGLFNHTGAHRFLFVLVLIVAFTSLVGNALMLLLILLDPRLHRPMYFLLSQLSLMDLMLISTIVPKMAVDYLTGRKFISPAGCGFQIFFFLTLGGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWKVCLSMILGSWFLGAVDGLMQAAATLNFSFCSTHEIDHFFCEAPTLVRLACADTSVFEYVMYICCVLMLLIPMSLILISYSLIL
AAVLQMHSNEARRKAFATCSSHISVVGLFFGAAIFTYMRPKSYRSAKHDKFVSAFYTIFTPMLNPLIYSVRNSEVKGALRKCMDQCTALSLD*
311 >lcl|XP_001255146.1|Plus1complement(41165..42130) NW_001502138 cOR52P3 olfactory receptor family 52 subfamily P-like LOC787934 __SEG__ Chr15 {Bos taurus} MVSPNHTFLDSSVFILMGIPGLEEFHLWLSLPVCLLGTATIVGNITILVVIVTEPALHKPMYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHMSASACLAQMFFIHAFC
MMESTVLLAMAFDRYVAICHPLRYTTVLTDTIIVRIGVVAMVRGSILMLPCPFLIQRLSFCQSHVIPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSY
FLIARAVLRLSSHEARSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHTHIILANVYLLFPPALNPMVYGVKTKEIQERVVRVFQKGQGTGLKAPE*
312 >lcl|XP_001255155.2|Plus1complement(521511..522449) NW_001495047 rCG29204-like LOC787945 __SEG__ Chr5 {Bos taurus} MRNHTMLTEFVLLGISDNPELQVVIFIFLFLAYVLSVVGNLTIIILTLTDCHLKTPMYYFLRNFSFLEITFTSVSIPRFLGAIITKVKTISYNNCLAQLFFFIFMGVSEF
FLLTAMSYDRYAAICKPLHYTTIMNKKICTLLVFSSWLGGFLTIFPPLMLILQLDFCASNIIDHFSCDYFPILRLSCSDTWLLEMIGFYFAFVTLLFTLALVILSYMCII
TTILRIPSATQRKKAFSTCSSHMIVISISYGSCIFMYVKPSAKERASLTKGVAILNTSIAPMLNPFIYTLRNEQVKQALKNLVHKVILSRNK*
313 >lcl|XP_001255156.2|Plus11479351..1480289 NW_001495357 Olfactory receptor, family 2, subfamily L, member 8-like LOC787946 __SEG__ Chr7 {Bos taurus} METYNRTSDDFILIGLFSPSRIGLFLFMFIVLIFLMALFGNLSMILLIFLDTHLHTPMYFLLSQLSFIDLNYISTIVPKMASNFLFGNKSISFIGCGIQSFFFLTLAVAE
ALLLTSMAYDRYVAICFPLHYPIRISKRVCVLMITGSWIMGAINSCAHTTYALHIPYCRSRAINHFFCDVPAMLTLACIDTWVYEYTVFVSTTLFLVLPFIVIACSYGRV
LFAVYHMNSAEGKKKAYSTCSTHLTVVTFYYAPFVYTYLHPRSFRSPTEDKALAVFYTILTPMLNPLIYSLRNKEVMEALRRVTQRLCSVKM*
314 >lcl|XP_001255169.1|Plus1complement(1511359..1512297) NW_001495357 Olfactory receptor, family 2, subfamily L, member 8-like LOC787963 __SEG__ Chr7 {Bos taurus} MENYNQTSTYFTLLGLFPSSRIGLFLFILIVLIFLMALFGNLSMFLVIFLDTHLQKPMYFLLSQLSLVDLTYISNIVPKMACDFLFGNKSISFIACGIQSFFFLTLAGAE
GLLLASMAYDRYVAICFPLHYPIKISRRVCVLMIIGSWLLGSINSCAHTIYALHIPYCRSKAINHFFCDVPAMLTLACMDTWVYEYTVFVSTTIFLLLPFTCIVFSYGRV
LLAVYRMHSAEGKKKAYSTCSTHLTVVTFYSAPFAYTYLRPKSLRSPTEDKVLAVFYTILTPTLNPVIYSMRNKEVMGALRRAIQRICSVRM*
315 >lcl|XP_001255189.2|Plus1642591..643547 NW_001495047 olfactory receptor Olr1012-like LOC787991 __SEG__ Chr5 {Bos taurus} MKNHTRPTEFILLGLSDDPEFQIVTFLFLIITYILSVTGNLTIIILTLVDSHLQTPMYFFLRNFSILEISFTTVCIPRFLGTIITRDKAISYNNCTAQLFFFIFLGITEF
YLLTAMSYDRYVAICKPLHYTTIMNNRVCVLLVFCAWLAGFLNIFPPVILFLQLDYCGSNIIDHFACDYFPLLQLSCSDTWLLEVIGFYSAIVILLFTLALIILSYMFII
KTILRLPSASQRKKAFSTCSSHIIVISISYGSCIFMYANPSAKEKASLTKGVAILNTSVAPMMNPFIYTLRNQQVKQAFKDTIQKFIFFSSKCKYLQH*
316 >lcl|XP_001255203.1|Plus1complement(683842..684783) NW_001495047 olfactory receptor, family 6, subfamily C, member 1-like LOC788009 __SEG__ Chr5 {Bos taurus} MRNHTETIEFILLGLSDNPQLQVVIFVFLLITYMLSITGNLTIITLTLLDAHLQTPMYFFLRNFSILEVSFTTVSIPKFLATIITGDKTISFNDCIAQLFFFILLGVTEF
YLLSAMSYDRYIAICKPLRYMTIMNHRVCTLLVFSSWLVSFLIIFPALMLLLNLDYCRSNIIDHFTCDYFPLLQLSCSDTNFLEMMGFSCAVFTLMFTLALIILSYTYII
RTILRIPSTSQRTKAFSTCSSHMIVISISYGSCIFMYIKPSAQDRVSLSKGVAVLNTSVAPMLNPFIYSLRNQQVKQAFKDMARKTIFQKQMK*
317 >lcl|XP_001255204.1|Plus11609097..1610041 NW_001495357 olfactory receptor Olr1566-like LOC788011 __SEG__ Chr7 {Bos taurus} MGCENHTSSSDFILLGLFSSSQTSLIFLSIIFIVFIITITENTMMIILIHRESKLHTPMYFLLSHLSFIDILHTSNIVPKMITDFLSGSKTISFVACGFQIFLSLTLLGG
ECLLLAAMSYDRYVAICHPLRYPILMNDYVSVLMAGGAWFIGIINSIVHTAYALHFPFCGSRAIDHFFCEVPAMLVLSCVDTTHYEQAAYASGIIFLFIPSSLIFASYVQ
ILLTVLQMKSKKARKKSFSTCFFHMTVVIMYYGPFIFTYMRPKKYHTPGQDKLLAIFYTILTPSFNPIIYSIRNKDVLDAMKNMLRSNFLHKML*
318 >lcl|XP_001255218.2|Plus1complement(692168..693106) NW_001495047 rCG29204-like LOC788027 __SEG__ Chr5 {Bos taurus} MRNHTMLTEFVLLGISDNPELQVVIFIFLFLAYVLSVVGNLTIIILTLTDCSLKTPMYYFLRNFSFLEITFTSVSIPRFLGAIITKVKTISYNNCLAQLFFFIFMGVSEF
FLLTAMSYDRYVAICEPLHYTTIMNKKICTLLVFSSWLGGFLTIFPPLMPILQLDFCASNIIDHFSCDYCPIWQISCSDTWLLEMIGFYFAFVTLLFTLALVILSYMCII
TTILRIPSATQRKKSFSTCSSHMIVISISYGSCIFMYVKPSAKERASLTKGVAILNTSIAPMLNPFIYTLRNEHVKQALKNLVHKVILSRNK*
319 >lcl|XP_001255221.1|Plus1complement(548582..549535) NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC788031 __SEG__ Chr7 {Bos taurus} MVPRNLTHVSGFLLLGFSEETDLQPIIFGLFLSMYLITVFGNLLIILAVSSDSHLHNPMYFFLSNLSFVDICFTSTTIPKMLWNIQTQNKVITYEGCITQVYFFTLFLGL
DDFLLTVMAFDRFVAICHPLYYKVIMSAQLCGLLVLVSWVINVLHSFLQTLMVLSLSFSREVIIPHYFCELKQLVQLACSDTFLNDMVMYFATVLLGGAPLAGILYSYSR
IVSTICEISSAQGKYKAFSTCASHLSVVSLFYCMCLGVYLSSAATQSSHSSATALVMYTVVTPMLNPFIYSLRNKDIKTALKAFFRRTMIKTPVVLS*
320 >lcl|XP_001255232.2|Plus11701678..1702634 NW_001495357 Olfactory receptor, family 2, subfamily L, member 8-like LOC788055 __SEG__ Chr7 {Bos taurus} MENYNQTSTDFILLGLFPSSRFGKFFFILIFLIFLIALFGNLFMILLIFLDTHLHTPMYFLLSQLSFIDLNYISTIVPKMAYNFLFADKSISFIGCGIQSFFFLTLGGAE
TLLLTFMAYDRYVAICFPLHYPIKISRKVCMLMIIGSWIMGSINSCAHTTYAFRIPYCKSRAINHFFCDVPAMLTLACMDTWIYEYTVFMSTIFFLLLPFIGIACSYGRV
LFAVYHMHSTKGRKKAYSTCSTHLTVVTFYYMPFAYTYLRPRSFRTPTEDKALAVFYTILTPMLNPVIYSLRNKEVIGALRRLIHRFCSVKLSTNILA*
321 >lcl|XP_001255240.1|Plus1complement(729314..730258) NW_001495047 olfactory receptor Olr1012-like LOC788067 __SEG__ Chr5 {Bos taurus} MKNHTRPTEFILLGLSDDPELQIVIFLFLIITYILSVTGNLTIIILTLVDSHLQTPMYFFLRNFSILEISFTTVCIPRFLGTIITRNKTISYNDCTAQLFFFIFLGITEF
YLLTAMSYDRYVAICKPLHYTTIMNNRVCVLLVFCAWLAGFLNIFPPVILFLQLDYCSSNIIDHFACDYFPLLKLSCSDTWLLEVIGFYSAIEILLFTLALIILSYMFII
KTILRLPSASQRKKAFSTCSSHIIVISISYGSCIFMYTNPSAKEKASLNKGASILNASVPPMMNPFIYSLRNQQVKQAFKETIQKVIFFSSKCK*
322 >lcl|XP_001255248.1|Plus11739409..1740347 NW_001495357 olfactory receptor, family 2, subfamily L, member 8-like LOC788079 __SEG__ Chr7 {Bos taurus} MENCNQTSTDFILLGLFPSSRFGLFLFILIVLIFLLALFGSLSMILLIFLNIHLHKPMYFLLSQLSLIDLNYISTIVPKMAYNYLFGNKSISFIGCGVQSFFFLTLAGAE
ALLLASMAYDRYVAICFPLHYSIKITRRVCVLMIIGSWIMGSINSCAHTTYALHIPYCRSRAINHFFCDVPAMLTLACIDTWVYEYTVFVSTTLFLLCPFIGIVCSYGRV
LRVVHHMNSAEGKKKAYSTCSTHLTVVTFYYAPFVYTYLRPRYLRSPTEDKVLAVFYTILTPVLNPVIYSLKNKEVMEALRRAIQRICSVKM*
323 >lcl|XP_001255254.2|Plus1complement(248148..249062) NW_001493093 olfactory receptor 1264-like LOC788089 __SEG__ Chr13 {Bos taurus} MEMNSSVNEFILLGLTQNLLKEKVVSVIFLFLYLGTLLANFIIVMTIRYSQTLQSPMYFFLFYLSFADACFSTTTAPRLIVDSVSEKKAISFNECMTQIFAFHFFGCMEI
LVLVLMSFDRYVAICKPLQYTAIMSQCVCDTLVKLAWVGTCIHSSAQILLALKLPFCGPNVIDHYFCDIQPLLQLACVDAYVINLLIVFNSGTICMVSFLLLLISYVLIL
HSLSNCSREGRRKALSTCTSHIIVIVLFFIPCIYIYARPLTVFPVDKMVAVFYTIVTPLLNPLIYTLRNAEIKQAMRRLWCNKV*
324 >lcl|XP_001255268.2|Plus1760075..761019 NW_001495047 olfactory receptor Olr1012-like LOC788114 __SEG__ Chr5 {Bos taurus} MKNHTRPTEFILLGLSDDPELQIVIFLFLIITYILSVTGNLTIIILTLVDSHLHTPMYFFLRNFSILEISFTTVCIPRFLGTIITRDKAISYNNCTTQLFFFIFLGITEF
YLLTAMSYDRYVAICKPLHYTTIMNNRVCVLLVFCAWLVGFLNIFPPVILFLQLDYCGSNIIDHFTCDYFPLLQLSCSDTWLLEVIGFYSAIVILLFTLALIILSYMFII
KTILRLPSASQRKKAFSTCSSHMIVISISYGSCIFVYINPSAKEKASLMKEVAILNTCVAPMMNPFIYTLRNQQVKQAFKDTIQKFIFFSSKCN*
325 >lcl|XP_001255278.1|Plus1complement(764299..765237) NW_001495047 olfactory receptor, family 6, subfamily C, member 1-like LOC788126 __SEG__ Chr5 {Bos taurus} MRNNTEIRDFILLGLSDDPQLQVVMFVFLLITYMLSITGNLTIITLTLLDIHLQTPMYFFLRSFSILEVSFTTVTIPKFLSTIITGDKTISFNNCMTQLFFFIFLGVTEF
YLLVAMSYDRYIAICKPLHYMTIMNHRVCTLLVLASWLTSFLIIFPLLMFFIQLDYCKSNVINHFTCDYFPLLYLSCSDTKFLEILGFSCAVFILLFTLALIILSYTYVI
RTILRIPSTTQRTKAFSTCSSHMIVISISYGSCIFMYVNPSAKDRVSLSKGVAVLNTSVAPMLNPFIYTLRNQQVKRAFMDMARKTMFFSRK*
326 >lcl|XP_001255292.2|Plus1complement(776452..777387) NW_001495047 olfactory receptor, family 6, subfamily C, member 3-like LOC788144 __SEG__ Chr5 {Bos taurus} MNHTVITEFVLLGLSDDPELQIVIFLFLLITYVLSVTGNLTIITLTWVDSHLQTPMYFFLRNFSFLEISFTTVCIPRFLGAIITKDKTISYNNCAAQLFFFIFMGVTEFY
ILTAMSYDRYVAICKPLHYTTIMSRKLCSLLVLCAWLGGFLTIFPPLMLLLQLDYCASNVIDHFACDYFPLLQLSGSDTWFLEIIGFYFALVTLLFTLALVILSYMYIIR
TILRIPSASQRKKAFSTCSSHMIVISISYGSCIFMYANPSAKEMASLTKGVAILNTSVAPMLNPFIYTLRNQQVKQAFKDMVYKAVLSANK*
327 >lcl|XP_001255307.1|Plus1complement(784064..785002) NW_001495047 olfactory receptor, family 6, subfamily C, member 1-like LOC788160 __SEG__ Chr5 {Bos taurus} MRNYTEITEFILLGLSDDPQLQVVSFIFLLITYMLSITGNLTIIILTLLDAHLQTPMYFFLRNFSLLEVSFTTVSIPRFLATIITGDKTIPFNDCMAQLFFFIFLGVTEF
YLLAAMSYDRYIAICKPLHYLTIMNHKVCTLLVLASWLASFLIIFPLVMLFLQLDYCKSNVIDHFSCDYFPLLYLSCSDTKFLEIVGFSCAVFILLFTLALIILSYTYII
RTILRIPSTTQRTKAFSTCSSHMIVISISYGSCIFMYMNPSAKDRVSSSKGVAVLNTSIAPMLNPFIYTLRNQQVKRAFMDTARKTIFFSSK*
328 >lcl|XP_001255330.1|Plus11955762..1956724 NW_001495357 olfactory receptor Olr1654-like LOC788190 __SEG__ Chr7 {Bos taurus} MDNNTWMTSYTERLDFTLVGIFSQSQHPALLCLVISVIFLMALSGNIILMFLIYSDAHLHTPMYFFISQLSFMDMMYISVTVPKMLTDQITGVNKISVPECGIQMFLYVT
LAGSEFFLLASMAYDRYMAICHPLHYPVLMNHRVCLFLASGCWFLGSVDGFLFTPITMTFPFCRSQEIHHFFCEVPAVLKLSCSDTSLYEIFMYLCCVLMLLIPVTIISG
SYYFILLTIHRMNSAEGRKKAFATCSSHMTVVILFYGAAIYTYMLPNSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVTGALKKMLNMGIVFQETIK*
329 >lcl|XP_001255335.2|Plus1complement(874414..875058) NW_001495047 olfactory receptor 810-like LOC788199 __SEG__ Chr5 {Bos taurus} MGNHTRVVVFILAGLTSDPQMKIVLFIFLLLTYLLSITCNLIIITLTLVDTHLKTPMYFFLRNFSFLEISYTTTCIPKLLVMMATGDKTISYNSCVSQVFFAILLGASEC
YLLEAMSYDHYIAICKPLHYTTIMNSKICMQLVLSCWVAGFFVIFPPLLYGLNLDFCASNVVDHFYCDSTPLLQISCSXXXXXXXXXXXXXXXXXXYTNFVLEF*
330 >lcl|XP_001255347.2|Plus1complement(887030..887968) NW_001495047 olfactory receptor, family 6, subfamily C, member 74-like LOC788210 __SEG__ Chr5 {Bos taurus} MRNHTTVTTFILLGLSNDPQLQVVIFLLLFFTYLLSITGNLIIITLTLLDSHLKTTMYFFLRNFSFLEISFTTVCIPKFLVSMATGDKTISYNNCAARCFLLFSWVQPIF
FLLAAMSYDRYEAICKPLHYTTIMSDRVCNLLVFASWLAGFIIIFPPLLVGLQLDFCAANTVDHFVCDVSPILQLSCTDTEKVEIMMLLSAILTLLVTLVLVIFSYTNII
RTILKIPSSQKRRKAFSTCSSHMVVVSISYGSCIFMYVKPSAKQRVSLNKGIALLSTSVAPMLNPFIYTLRNRQVKYAFKLMIKNIEAFLMK*
331 >lcl|XP_001255352.2|Plus1complement(917528..918469) NW_001495047 olfactory receptor 822-like LOC788220 __SEG__ Chr5 {Bos taurus} MENRTSVTVFILVGLTEDPKLKIVLFIFLLPASCYLLSISGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISYTTVCIPKLLASMATGDKTITYNCCAAQLFFVFLLGAS
EFYLLAAMSYDHYVAICKPLHYTTIMSNKICIQLVLSSWMAGFLIIFPGLILGLTLDFCNSNVIDHFYCDTAPLLQISCTDTHLFEMLSFILALMTLLITLVLVILSYTY
IALTIIKIPSANQRKKAFSTCSSHMIVISLSYDSCIFMYVKPSAKQRISLVKGVAVLNISVAPILNPFIYTLRNQQVKQAFKNLLQRLLSLFK*
332 >lcl|XP_001255365.2|Plus1complement(947385..948323) NW_001495047 olfactory receptor Olr1063-like LOC788242 __SEG__ Chr5 {Bos taurus} MGNQTSVIEFILLGLTSDAKLQAVLFLFLLLTYVLNIMGNLTIIILTLLDHRLQTPMYFFLRNFSVLEVSFTSVFVPKMLVSIGTGDKTISFAGCFTQYFFAILLGATEF
YLLAAMSFDRYVAICKPLHYTTLMSRRLCIQLVLCSWFSGFLVVIVPHVMTLQLPFCASNIINHYCCDYTVLLHLSCSDTRFIEVIEFVLAAVTLIFTLMLVILSYTYII
RTILRIPSAQKRKKAFSTCSSHMIVVSLSYGSCIFMYINPSVEDAATFNKGVAVLNTSVAPLLNPFIYTLRNKQVKIAFRHLVSKIITFSRK*
333 >lcl|XP_001255375.1|Plus11075131..1076075 NW_001495047 olfactory receptor Olr1012-like LOC788258 __SEG__ Chr5 {Bos taurus} MKNHTRPTEFILLGLSDDPELQIVTFLFLIITYILSVTGNLTIIILTLVDFHLQTPMYFFLRNFSILEISFTTVGIPRFLGTIITRDKTISYNDCTAQLFFFIFLGITEF
YLLTAMSYDRYVAICKPLHYTTIMNDRVCVLLVFCAWLAGFLNIFPPVILFLQLDYCGSNIIDHFACDYFPLLKLSCSDTWLLEVIGFYSALEILLFTLALIILSYMFII
KTILRLPSASQRKKAFSTCSSHMIVIFISYGSCIFMYANPSAKEKASLNKGASILNASVPPMMNPFIYSLRNQQVKQAFKDTIQKVLFFSRKCK*
334 >lcl|XP_001255377.2|Plus1complement(89148..90110) NW_001502739 olfactory receptor 78-like LOC788263 __SEG__ Chr15 {Bos taurus} MSGANISSMTPGFFILNGVPGLESTHIWISLPFCFMYIIAVVGNCGLIYLIGHEEALHHPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIDFNGCLAQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYATILTSAVIAKAGLATLLRGVMLIFPFTFLTKRLPYCRGNFIPHTYCDHMSVAKVSCGKVKVNAIYGLLAALLIGGFDIFCISMSY
TMILRAVVSLSSADARHKAFSTCTSHICAIVITYVPALFTIFTHRFGEKSIPPHVHIIIANLYLMLPPTLNPIVYGVKTKQIREGVIKLLFKEKDILSAK*
335 >lcl|XP_001255393.2|Plus1complement(1120690..1121628) NW_001495047 olfactory receptor 810-like LOC788285 __SEG__ Chr5 {Bos taurus} MGNHTRVVMFILAGLTSDPQTKIVLFIFLLLTYMLSITCNLIIITLTLVDTHLKTPMYFFLRNFSFLEISYTTTCIPKLLVMMAIGDKTISYNSCMTQLFFAFLFGASEC
YLLAAMSYDHYVAICKPLHYTTIMNSKICMQLVLSCWVAGFFVIFPPLLYGLNLDFCASNVVDHFYCDSTPLLQISCSDTKLIEMMGFISAVVTLVITLVMVIISYTCIA
LTILRIPSASHRRKAFSTCSSHMIVISLTFGSGIFIYVKPSVKQRISFSKGISVLNTSVVPFLNPFIYTLRNQQVKKAFMNTIHRVVSFSKE*
336 >lcl|XP_001255394.1|Plus1complement(2099540..2100502) NW_001495357 olfactory receptor, family 2, subfamily W, member 1-like LOC788287 __SEG__ Chr7 {Bos taurus} MPKATGNTNKSFPVGFVLLGYSEFPQLEMVLFWIVIFLYTMIILSNMTIILLSYMNPQLYTPMYFFLSNLSFLDLCFTTTVVPQMLFNLWGPDKSITYIGCIIQLGMVLC
VGATQGVMLVVMAFDRYVAICQPLRYTIIMHPQFCWKLVLMSWLSGLIECVTQTPITFQLPFCVHHCLDDFVCQVPSLIRLTCGDTSTTEWQMTISAVFFTILPIGLILT
SYGYIAQTLGKIQSEEGRQKAIATCSSHLTVVFMFYGTVAMVYTDPKNQFASKHGKFVSFFFTVITPLLNPLIYTLRNKEVKSVLQRQLRKGISIRKKRN*
337 >lcl|XP_001255400.3|Plus1complement(1133626..1134555) NW_001495047 olfactory receptor 821-like LOC788298 __SEG__ Chr5 {Bos taurus} MRNHTTVTTFILLGLSNDPQLQVVIFLLLFFTYLLSITGNLIIITLTLLDSHLKTTMYFFLRNFSFLEISFTTVCIPKFLVSMATGDKTISYNNCAARCFLLFSWVQPIF
FLLAAMSYDRYEAICKPLHYTTIMSDRVCNLLVFASWLAGFIILFPPLLMGLQLDFCAANTVDHFVCDVSPILQLSCTDTEKVEIMMLLSAILTLLVTLVLVIFSYTNII
RTILKISSFQKRRKAFSTCSSHMVAVSISYGSCIFMYVKPSAKQRVSLNKGIALLSTSVAPMLNPFIYTLRNRQVKYAFKLMIKILRLS*
338 >lcl|XP_001255404.1|Plus130680..31645 NW_001502739 olfactory receptor 669-like LOC788304 __SEG__ Chr15 {Bos taurus} MLVSNNSCVPPKYFILNGIPGLERVHVWISLPFCTMYIISLLGNLGLVYLIHHEESLHHPMYFFLAMLSLIDLFSCTTILPNALCIFWFNLKEINFNACLVQMFFVHGFT
GVESGVLMLMALDRYVAICYPLHYATILTNPIIAKAGLVTFLRGALLMIPFPFLVKRLPFCQSNIISHTYCDHMSVVKLSCASIKVNVIYGLVVALLIGVFDISCIFVSY
TMILRAVVSLSSADARQKAFSTCTAHISAIIVTYVPALFTLFTHRFGGHSIPSCLHIIVANLYLLLPPTLNPIVYGIKTKQIRDNVIKLLQGEKGASTQDK*
339 >lcl|XP_001255418.2|Plus1complement(1164802..1165737) NW_001495047 olfactory receptor 822-like LOC788322 __SEG__ Chr5 {Bos taurus} MENHTSVTVFILVGLTEDPKLKIVLFIFLFLTYLLSISGNLTIITLTLLDSHLKTPMYFFLRNFSFLEISYTTVCIPKLLASMATGDKTITYNCCAAQLFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTTIMSNKICIQLVLSSWMAGFLIIFPGLILGLTLDFCNSNVIDHFYCDTVPLLQISCTDTHLFEMLSFILALMTLLITLVLVILSYTYIA
LTIIKIPSANQRKKAFSTCSSHMIVISLSYDSCIFMYVKPSAKQRISLMKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFKNLLQRLLSLFK*
340 >lcl|XP_001255419.2|Plus1complement(2181832..2182785) NW_001495357 olfactory receptor Olr1654-like LOC788323 __SEG__ Chr7 {Bos taurus} MDNSTWVANHTGQLDFILMGLFSQSKHPALLCVVIFVIFLMALSGNSILILLIHSNAHLQTPMYFFISQLSLMDVMYISVTVPKMLMDQVMGVNEISASECGMQMFLYLT
LVGSEFFLLAAMAYDRYVAICHPLRYSILMSHRVCHILVSGCWFLGSVDGFMLTPVTMTFPFCKTREIHHFFCEVPALMKLSCSDTSLYETLMYLCCVLMLLIPVTVISS
SYSFILLTIHRMNSAEGRKKAFTTCSSHMTVVILFFGAAIYTYMLPSSYHTPEKDMIVSAFYTILTPVLNPLIYSLRNKDVTGALKKMLNMGSVTIL*
341 >lcl|XP_001255443.2|Plus1complement(1225774..1226712) NW_001495047 olfactory receptor 810-like LOC788357 __SEG__ Chr5 {Bos taurus} MGNHTRVVVFILAGLTSNPQMKIALFIFLLLTYVLSITCNLIIITLTLVDTHLKTPMYFFLRNFSFLEISYTTTCIPKLLVMMATGDKTISYNSCVSQVFFAFLLGASEF
YLLAAMSYDRYVAICKPLHYTTIMNSKICMQLVLSCWVAGFFVIFPPLLYGLNLDFCASNVVDHFYCDTTPLLQISCSDTKLIEMIGFISAAVTLVITLVMVIISYTCIA
LTILRISSASHRRKAFSTCSSHMIVISLSYGSCIFMYVKPSVKQRISFSKGISVLNTSVAPLLNPFIYTLRNQQVKKAFMNMIHRVVSFSKE*
342 >lcl|XP_001255446.2|Plus12269311..2270273 NW_001495357 olfactory receptor Olr1654-like LOC788361 __SEG__ Chr7 {Bos taurus} MDNSIWVANYTEQLDFILMGLFSQSKYPILLCVVIFVIFLMALSGNIMLILLIYSDAHLHTPMYFFISQLSLMDMIYISVIVPKMLMDQVMGKNKISAPECGMQMFLYLT
VGGSEYFLLAAMAYDRYVAICHPLHYSTLMSHKMWLLLVSGCWFLGSVDGFMLTPITMTFPFCRSREIHHFFCEVPAVMKLSCSDTSLYETLMYLCCVLMLLIPVTIISS
SYSFILLTIHRMNSAEGRKKAFMTCSSHMTVVILFYGTSTYSYMFPSSYHTSEKDMAVSIFYTILTPVLNPLIYSLRNKDVTGALKNLLNVESAFQRTMK*
343 >lcl|XP_001255455.2|Plus1complement(1250159..1251097) NW_001495047 olfactory receptor, family 6, subfamily C, member 74-like LOC788372 __SEG__ Chr5 {Bos taurus} MRNHTTVTTFILLGLSNDPQLQVAIFLLLFFTYLLSVTGNLIIIILTLLDSHLKTPMYFFLRNFSFLEILFTTVCIPKFLVSMATGDKTISYNNCAAQLFFTILLGATEF
FLLAAMSYDRYVAICKPLHYMTIMSDRVCNLLVFASWLAGFIIIFPPLLVGLQLDFCAANTVDHFVCDVSPILQLSCTDTEKVEIMMLLSAILTLLVTLVLVIFSYTNII
RTILKIPSSQKRRKAFSTCSSHMVVVSISYGSCIFMYVKPSAKQRVSLNKGIALLSTSVAPMLNPFIYTLRNRQVKYAFKLMIKNIEAFLMK*
344 >lcl|XP_001255473.2|Plus11289631..1290572 NW_001495047 olfactory receptor Olr1061-like LOC788396 __SEG__ Chr5 {Bos taurus} MSGNQSLCTHFTFVAFSSLAELQPVLFIVFLTIYLFTMGGNLLIIGLIWGTPSLHTPMYFFLVNLSFLEMCYITSVVPQMLVHLLVETKIISVASCAAQMYVFSILGLTE
CCLLAAMAYDRFVAICHPLHYSLLMGPGVCLKLAAASWTTGVMVESAQTTWIFTLPFCGTGRIQHFFCDIMPVVELACVDTSHNEIVMFVLSMLFIMTPCLLILCSYVRI
LVTILRIPSATGRSKAFSTCSSHILVVSLFYGTALFTYLQPKAAHTPETDKATALMYTVVTPALNPVIYTLRNKEVKEAFQRLTPRSTLSLTP*
345 >lcl|XP_001255485.2|Plus11295318..1296259 NW_001495047 olfactory receptor, family 2, subfamily B, member 2-like LOC788413 __SEG__ Chr5 {Bos taurus} MSGNQSLCTHFTFVAFSSLAELQPVLFIVFLTIYLFTMGGNLLIIGLIWGTPSLHTPMYFFLVNLFFLEMCYITSVVPQMLVHLLVETKIISVARCAAQMYVFSILGLTE
CCLLAAMAYDRFVAICHPLHYSLLMGPGVCLKLAAASWTTGVMVESAQTTWIFTLPFCGTGRIQHFFCDIMPVVELACVDTSHNETTLFAISVLFIMTPCLLILCSYVHI
LVTILRIPSATGRSKAFSTCSSHILVVSLFYGTALFTYLQPKAAHTPETDKATALMYTVVTPALNPVIYTLRNKEVKEAFQRLTLWSTLSLTP*
346 >lcl|XP_001255497.2|Plus11301007..1301948 NW_001495047 olfactory receptor, family 2, subfamily B, member 2-like LOC788428 __SEG__ Chr5 {Bos taurus} MSGNQSLCTHFTFVAFSSLAELQPVLFFVFLTIYLFTMGGNLLIIGLIWGTPSLHTPMYFFLVNLSFLEMCYITSVVPQMLVHLLVETKIISVARCAAQMYVFSILGLTE
CCLLAAMAYDRFVAICHPLHYSLLMGPGVCLKLAAASWTTGVMVESAQTTWIFTLPFCGTGRIQHFFCDIMPVVELACVDTSHNETTLFAISVLFIMTPCLLILCSYVHI
LVTILRIPSATGRSKAFSTCSSHILVVSLFYGTALFTYLQPKAAHTPETDKATALMYTVVTPALNPVIYTLRNKEVKEAFQRLTLWSTHRQMI*
347 >lcl|XP_001255504.1|Plus1complement(1333703..1334650) NW_001495047 olfactory receptor, family 5, subfamily I, member 1-like LOC788438 __SEG__ Chr5 {Bos taurus} MKNKLNKNYSEVMEFILLGFQTSPDVQILLFLLFLLIYMVTVVGNISMLVVIKIDSRLHTPMYFFLRNLSYLDLCYSTVIAPKTLATFLSKDKRISYNGCATQFFFFALF
VGTEGFLLAVMAYDRFSAICSPFLYTVRMSQQACVRLVIASYICGCINSMIQTGFTFSLRFCGENRLDHFFCDVPALIKISCVDTLVNETVLFILSALIIITTTTIILVS
YACILSTVLKISSTHGRSKTFSTCSSHFTVVSLFYGTVFFMYAQPGAISSPEKNKIIAVFYTLIIPMLNPLIYSLRNREVKNAVKRILLRKKSFH*
348 >lcl|XP_001255569.3|Plus1complement(377989..378915) NW_001494525 olfactory receptor Olr1242-like LOC788537 __SEG__ Chr29 {Bos taurus} MALGNGSFMTQFILMGLRDQPDLQLPLFFLFLVMYMVTVMGNLSLIILIGLSSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINIISKKIISYIGCMTQLYFFSFFGISE
CYVLTSMAYDRYVAICNPLFYNVAMSPKVCSSLMLGSYLMAVLDATTLITCMLRLTFCDANTINHYLCDIHPLLQLSCTSTHIIELEVFIVGGINIIVPSLTIFVSYGLI
LTNIFHIKSTEGRSKAFRTCSAHIIAVSLFFGSSAFMYLKPSSVSVDDGKISSVFYTNVVPMVNPLIYSLRNKDVKLALRKTLRMGKF*
349 >lcl|XP_001255585.1|Plus1complement(394529..395461) NW_001494525 olfactory receptor Olfr906-like LOC788554 __SEG__ Chr29 {Bos taurus} MAPGNGSFVTQFILMGLTNQPDLQLPLFFLFLGMYIVTVIGNLGLIILILLNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINFISKKNIISYMGRMTQLYFFCFFVIS
EIYVLTSMAYDRYVAICNPLLYNVVMSPKVCSTLMLGSYLMAFSGAMAHTGCMLRLTFCDVNTINHYFCDIHPLLQLSCTSTYVNELVVFTVVGINITVPSLTIFISYGL
IFSSIFHIRSTEGRSKAISTCSSHIIAVSLFFGSCAFMYLKPSSAGSLDEQKVSSLFYTNVVAMMNPLIYSLRNKDVKTALRKTVSGIQF*
350 >lcl|XP_001255591.2|Plus1complement(710962..711660) NW_001494534 hypothetical protein isoform 1 LRRN4CL __SEG__ Chr29 {Bos taurus} MPHSPCLLWLLAVTSLVPGTQPLVAGDLEGDELDETPLPAVPCDYDHCRHLQVPCQELQRAGPAACLCPGLSSALQPPHPPRLGEVRVEADMGRAEVHWCAPSSPVNQYW
LLLWEGGGAPQKGPSFNSTVRRAELKGLNPGGAYVVCVVAANDAGESRAPGPGAEGLDSADGPNLGPCGRLTVPPRPLTLLHAAMGVGSALALLSCSALVWHFCLRQRWG
CPRRGRPSHAGL*
351 >lcl|XP_001255596.2|Plus1complement(400604..401536) NW_001494525 olfactory receptor Olr1242-like LOC788573 __SEG__ Chr29 {Bos taurus} MAPGNGSFVTKFILLGLTNQPDLQLPLFFLFLGMYMVTVLGNLGLITLIALNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINFLSKKNIISYMGCMTQLYFFCFFSIS
ECYVLTSMSYDRYVAICKPLLYNGAMSPKVCSSLMFGSYLMAFSGAMAHTGCMLRLTFCDANTINHYFCDILPLLELSCTSTYVSELEVFIVVGINIIVPSLTIFVSYGL
ILTNILHISSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPPSAVSMDEGKISSVFYTNMIPMMNPLIYSLRNKDVKLALRKTLSRSQF*
352 >lcl|XP_001255617.2|Plus1complement(425678..426607) NW_001494525 olfactory receptor Olr1242-like LOC788607 __SEG__ Chr29 {Bos taurus} MAPGNDSFMTQFILAGLTDQSVLQLPLFFLFLVMYMVTVMGNLSLIILIGSSSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINITSEKKIISYMGCMTQLYFLCFFGIS
ESYVLTSMAYDRYVAICNPLLYNTAMSPKVCSSLMLGSYLMAFFEATTLIGCMLRLTFCAANTINHYLCDIYPLLQLSCTSTYIIELEVIIVSGINITVPSLTIFVSYGL
ILSNILHISSTEGRSKAFSTCSSHIIAVSLFFGSSAFVYLKPSSVSADDGKISSVFYTNVIPMMNPLIYSLRNKDVKLALRKTLCVAEF*
353 >lcl|XP_001255624.1|Plus1complement(1318165..1319103) NW_001495356 olfactory receptor, family 2, subfamily Y, member 1-like LOC788617 __SEG__ Chr7 {Bos taurus} MGSFNTSFREGFILMGFSDWSQLEPILFVFILVFYSLTIFGNTTIITLSLLERQLHTPMYFFLRHLSFLDLCYTTSTVPQLLINLHGLDRTISYKGCVVQLFSSLALGST
ECVLLVVMAFDRYAAVCHPLHYTAIMHPHLCQTLAIASWVGGCMNSLVQTGLMMAMPLCGLHLLNHFFCEMTVLLKLACEDTEGTETKMFVARAIILVVPVLLILGSYVY
IVQTVLKVRSVAGRRKAFGTCGSHLLVVSLFYGSAIYTYLQPMHSYSESEGKFVALFYTIVTPMLNPLIYTLRNKDVKGAVRKVLGRGRYSM*
354 >lcl|XP_001255630.1|Plus1complement(1286603..1287613) NW_001495356 olfactory receptor, family 7, subfamily A, member 17-like LOC788626 __SEG__ Chr7 {Bos taurus} MEPHNDTQISEFLLLGFSEEPELQPLIFGLFLSMYLITVFGNLVIILLVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIKTQSKIITYEGCITQIYFFILSAVL
DIFLLTVMAYDRFVAICHPLYYTVIMNPRLCVLLVLVSWVVCMLNSLLQSLMLLQLSFCTDVKIPHFFCDLSQIIQLACSDTFLNNMVMYFASVLWGGGPLAGILYSYSK
IVSSIHGMSSSQGKYKAFTTCASHLLIVSLFFCTSLGVYLSSAATHGSQSSATASVMYTVVTPMLNPFIYSLRNKDIKGAMKRFFVMESLKRPMVLGLERCPWLKGSKLQ
SVVVIL*
355 >lcl|XP_001255638.2|Plus1complement(1264584..1265552) NW_001495356 olfactory receptor, family 7, subfamily A, member 17-like LOC788638 __SEG__ Chr7 {Bos taurus} MVPGNDTQNSGFLLQGLSVEPELQPFIFGIFLSMYLITLFGNLLIILAVISDSRLHTPMYFFISNLSFVDICFTTTTILKMLINIQIQSKVISYGGCIAQMYFYMQFAAL
DDFLLTVMAYDRFLAICHPLHYTAIMNPRLCGLLVLLCWIISALFSLLESLLVLQLSFCTDLEIPHFFCEIKQVVLLACCDTFLNDVFMYFTSVLLGGGPLAGILYSYSK
ILFSIHRISSPQGKYKAFSTCVSHLSVVFLYYCSSLGVYLSSTGTHSSHSSATASVMYTVVTPMLNPFIYSLRNKDIKSALKRFFQMAVIKRKIVLDLKNHP*
356 >lcl|XP_001255639.1|Plus1complement(724840..725778) NW_003101172 olfactory receptor Olr87 (predicted)-like LOC788640 __SEG__ Chr15 {Bos taurus} MSFVNDTTSHPSAFLLLGVPGLEDFHIWIAFPFFVVYLIALVGNVTILFVIKTDQSLHQPMFYFLALLSFIDLGLSTSTIPKMLAIFWFNRRKVSFEACLIQMFFIHTDT
GMESGVLLAMAIDRFVAICYPLMYTTILTNKMVAIMASVVVGRPVLLVIPFCPLLKRLPFCGRYIIPHTYCEHMGIARLACANIRVNIIYGLFTIAALIFDLLLISLSYV
QILQTVFHLPSRDARLKAFSTCGSHVCVILAFYTPAFFSFMTHRFGRNVPLYIHILLANLYVVVPPCLNPVIYGVRTKQIWGRVVRIFFKKE*
357 >lcl|XP_001255683.1|Plus1complement(819636..820571) NW_003101172 olfactory receptor, family 52, subfamily J, member 3-like LOC788703 __SEG__ Chr15 {Bos taurus} MFYHNRSIFHPTTFFLIGIPGLEEVHAWISLPFCSVYLVALLGNVTILLVIKTEKSLQEPMFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEINFGACVAQMFLIHAFT
GMEAEVLLAMAFDRYVAICAPLHYTTILTSRVLMGISMCIVIRPVLLTLPMIYLIYRLPFCQTYIIPHSYCEHMGIAKLSCGNIRINGIYGLFVVSFFVLNLVLIGISYV
YILWAVFCLPSQDARLKALSTCGSHIGVICVFYIPSVFSFLTHRFGHKIPRYIHILVANLYLIIPPSLNPIIYGIKTKQIWEPVLRAFIKK*
358 >lcl|XP_001255687.2|Plus1743..1678 NW_001495359 olfactory receptor Olr1654-like LOC788709 __SEG__ Chr7 {Bos taurus} MVGGNASSVTDFILVGLFPEFQHSIVLDFVVIFIYILAFLGNLLLIVLIWGDSRLHTPMYILLSQLSPIDLTLTSTIVPKTASNFFTGKRTISWIGCGTQSFFYLMLGVS
ECLILTLMAYDRYVAVCIPLRYLTIMSPRFCLHMVAGCWIGGSIGSFIHTVYPMHFPICGSREIHHFFCEVPVLIKLSCEDTSVYQLVVVVTSIVLLVVPFSLIIASYTL
IFLTVLCMNSVKGRKKALATCSSHLTVVSLFFGPNIFIYMTFASSHSPEQDQALSLFSNILTPMLNPLIYSLRNKEVVAALMKLVGRCGVS*
359 >lcl|XP_001255689.1|Plus1complement(299774..300703) NW_001493372 olfactory receptor 16-like LOC788711 __SEG__ Chr15 {Bos taurus} MEEINKTAKVQFFFRPFSADPKVQALISVAFLAMYLTSLGGNALIALIVQINHSLHTPMYFFLANLAALEILYTSCLAPLALANLLSMGRTPISITGCGTQMFFFVFLGG
ADCVLLAVMAYDRLMAIRYPLGYTLLMSWPLCVQLMVGSLKLGFLLSLPLTVLIFRLPFCNNSEIYHFFCDMPAVMRLACADTHVHQSALYAISFTVLSIPLSMIFVSYV
FIVVTVLRIRSTEGRRRACSTCSAHLSVVLLQCGCTSFMYLSPRSSYSPETGRVVSVVYTFITPILNPLIYSMRNKELKNALRRALRRL*
360 >lcl|XP_001255701.2|Plus1complement(849680..850621) NW_003101172 cOR51P3 olfactory receptor family 51 subfamily P-like LOC788731 __SEG__ Chr15 {Bos taurus} MSVFNDSVLYPCFLLTGFSGLESRYGLISLPIFLVYATSVAGNITILFIIRTEPSLHQPMYYFLSMLAFTDLGLSTTTLPTMFSVFWFHAREISFNGCLVQMYFIHVFSI
IESAVLLAMAFDRLVATRAPLRYAAILTNDVIIGIALAITGRALALVFPASFLLKRLQYRPVNILSYPFCLHQDLIKTTVSSRRVSSIYGLMVVICSMGLDSVLLLLSYI
LILGTVLSIASRTERVKALNTCISHICAVLTFYTPMIGLSMIHRYGQNASPFVHVFMANVYLLVPPLMNPIVYSVKTKQIRDRILKKFNQQKV*
361 >lcl|XP_001255707.2|Plus1complement(857542..858489) NW_003101172 olfactory receptor, family 51, subfamily L, member 1 (predicted)-like LOC788739 __SEG__ Chr15 {Bos taurus} MVVWNNSDTMEPIFILRGFPGLEYVHSHLSIPFCLAYLLAFIGNATVLSVIWTESSLHQPMYYFLSMLALTDLGMSLSTLPTMLAVLCLDVREIQASACYAQLFFIHTFT
FLESSVLLAMAFDRFVAICHPLHYTTILTNSVIGKVGLACLLRSMGVVLPTPLLLRHYHCCHASALSHAFCLHQDVLKLSCSGARISSVYGLSVVIATLGVDSVFILLSY
VLILKAVLGIASHEEQLKALNTCVSHMCVVLIFFVPVIGVSMVHRFGKHLSPIIHILMADIYLLLPPVLNPVVYSIRTKQIRLGILCKFGIRRRF*
362 >lcl|XP_001255708.2|Plus1complement(366647..367633) NW_001492804 odorant receptor MOR10-like LOC788740 __SEG__ Chr10 {Bos taurus} MDGGNCSVVSEFLLQGLTSSWEIQILLFVLFTVFYIASMLGNLLIVLTVLSDHHLHSPMYFLLANLSFIDTGVSSIATPKMISDLFRRHKVISLRGCITQMFFIHTVGGA
EMVLLTVMAYDRYVAICKPLHYPTIMSLRMCTSLLAVAWTIGLIHSVTQLAFVVNLPFCGPNEMDSFYCDFPRFIKLACTDTYRLEFLVTANSGFISMGTFFILIVSYIF
ILVTVRKHSSGGSSKALSTLSAHITVVVFFFGPCIIVYVWPFPTLPIDKFLAIFDVLITPFMNPIIYTLRNKEMKMAMRRLFGKVLSFRKCSHAQSKKFRLILTLLGN*
363 >lcl|XP_001255722.1|Plus1342882..343811 NW_001492804 olfactory receptor Olr784-like LOC788764 __SEG__ Chr10 {Bos taurus} MNHSVVSKFVFLGLTNSWEIQLLLFVFSSVFYMASMLGNSLILLTVTMNPHLHSPMYFLLANLSFIDLGVSSVISPKMIYDLFRKHKVISFGGCITQIFFIHIIGGVEMV
LLIAMAFDRYIAICKPLHYFTIMSRKKCILLMVAAWIIGLIHSIVQLVFVAKLPFCGPNIIDSFYCDFPRFIKLACTDTYRLEFMVTANSGFISLGSFFILIVSYIFILI
TVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFVYIWPHPTSHLDKFLAVFDAVLTPFFNSIIYTFRNKEMKMAMRKLCSHFIIYRRIS*
364 >lcl|XP_001255730.1|Plus1906574..907527 NW_003101172 olfactory receptor 78-like LOC788777 __SEG__ Chr15 {Bos taurus} MAPLNDTNIEVLRFFLIGIPGLEKSHFWISIPFSSVYFLSLLGNFTILFFIKTEPSLHEPTHYFLSMLSISDLGLSLSFSPITLGLFLFGVHGIHAATCFAQEFFIHLFT
VIEASVLLVMAFDQYVAMHHPLRYSTILTSSQVIKTGVLLTSKNIMLILPLPFLLQRLTYCHQNLLLHSYCLHQGVMKVACSDNRVNVVYGLCATLSSILDLLFITFSYM
MILKTVLGIATPREQPKALNTHISHICAVLIFCVPVLSAAMLHQFASGVSPMIHILMADVFLLVPLLMNPIVSCVKTHQIRKKVMGKFCSKRSLSMQ*
365 >lcl|XP_001255731.2|Plus1309263..310204 NW_001492804 olfactory receptor 1307-like LOC788778 __SEG__ Chr10 {Bos taurus} MYGANHSVVLEFVFLGITNSWEIQLLLFVFSSIFFMASIMGNSLIILTVTSDPHLHSPMYFLLANLSFIDMGVSSVSSPKMIYDLFRKHKVISFSGCIAQIFFIHVIGGV
EMVLLIAMAFDRYIAICKPLHYLTIMSPRMCVFFLVSAWMIGLMHSMVQLAFVVNLPFCGPNVLDSFYCDLPRFIKLACIDTYQLEFMVTANSGFISVGSFFILIISYIV
IILTVQKHSSGGSSKALSTLSAHITVVVLFFGPLIFFYVWPFPSTHLDKFLAFFDAVLTPFLNPVIYTFRNQEMKMAMRRVCQQLVNNKRSLE*
366 >lcl|XP_001255743.1|Plus1929132..930073 NW_003101172 olfactory receptor, family 51, subfamily G, member 2-like LOC788796 __SEG__ Chr15 {Bos taurus} MPLRSLENSSSMSSTFLLSGIPGLEHMHTWISIPLCFIYIVSILGNCTIILIIKTEPSLHEPMYLFLSMLALTDLGLSLCTLPTVLGIFWVGARDIGHDACFAQLFFIHC
LSFLESSVLLSMAFDRFVAICRPLHYASILTNTVIGRIGLASLGRSVALIIPLPFMLKRFPYCGSPVLSHSYCLHQEVMKLACADIRANSIYGMFVIVSTVGIDSLLILF
SYALILRTVLSIASRAERLKALNTCVSHICAVLLFYTPMIGLSVIHRFGKQTPHLFQVILGFVYLLFPPLMNPIIYSVKTKQIRDRVTHAFCS*
367 >lcl|XP_001255744.2|Plus1264372..265328 NW_001492804 olfactory receptor 1307-like LOC788797 __SEG__ Chr10 {Bos taurus} MDGANQSVVSEFVLLGLTNSWEIQLLLFVFSSTFYVASMMGNSLIILTVTCDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHRVISFRGCIAQIFFIHIVGGV
EMMLLIAMAFDRYVAICKPLHYLTIMNPRMCISLLVAAWIIGFLHSMVQLPFVVNLPFCGPNVLDSFYCDLPRLIKLACVDTYQLEFMVMANSGFISIGSIFILIISYIV
IILTVQKHSSGSSSKALPTLSAHITAVALFFGPLIFIYTWPFPSTHLDKFLAIFYAVLTPFLNPVIYTFRNQEMKVAMRRVCRQLVSYRKISVVMPVL*
368 >lcl|XP_001255763.1|Plus1complement(959766..960803) NW_003101172 olfactory receptor, family 51, subfamily E, member 2-like LOC788825 __SEG__ Chr15 {Bos taurus} MTNTIIVISFFRACPQPTMMIFNNTTSSPSTFLLTAFPGLELAHVWISIPVCCLYIIALLGNTMILFVIFVKQQLHKPMYYFLSMLSAADLCLTITTLPTVLGVLWFHAR
EISFKACLIQMFFVHAFSFLESSVLAIMAFDRFMAICNPLKYATVLKDMMIMVIGLFICVRQLIFIFPMLLALKTVSFQERKELSHPFCYHPDIIRDTYSNPWINSFLGL
FLQLYMTGTDLMFILVSYVLIIRAVLSIVAPKKQKKALNTCVCHICAVTIFYVPMISLSFTHRLLSSTPRVICSILANVYLLLPPVVNPIIYSLKTRTIRQAMLQLLQTK
GSWSRNVRGLRGSWD*
369 >lcl|XP_001255786.1|Plus1complement(1001366..1002322) NW_003101172 olfactory receptor 572 (predicted)-like LOC788864 __SEG__ Chr15 {Bos taurus} MADNNHSHFQHLYFVLTGIPGLELKYYWMAFPLGAIYVIALFGNGVIISTIKSELSLHIPMYYFLCMLALADTGLALCTMPSMLGIFWFNYKSIAFDACLVQMYFIHTFS
AIESGVLVAMAFDRVVAIWKPLRYGTILTNSVVCRTGAVIWTRAICVVFPVPFLIKRLPFYRSNVLSHSFCLHQDVMSLACASTQVNSLYGLIAVIFTKGSDSLSILLSY
AFLLRTVMAIASGEGRLKALNTCVSHICAVLIFYVPLIGVSVIHRFGKHVSPLTHALMANAYLLIPPVLNPIVYTMKTKEIRRKLIQMFVAAKVTAEG*
370 >lcl|XP_001255792.1|Plus11029122..1030090 NW_003101172 olfactory receptor, family 51, subfamily S, member 1 (predicted)-like LOC788872 __SEG__ Chr15 {Bos taurus} MSTFLTHSTLNASTSMAPTFLLVGLPGLSAVPSWWAVPLITVYLLSALGNGAILWIIALEPTLHRPMYFFLFLLSVSDVGLSTALMPTLLGLAFANTHAVSASACLLQMF
FVHVFSVMESSVLLAMALDRALAICCPLHYPTLLTNGVISKICVAIAFRCLGLHLPLPFLLAHMPYCRPQVLTHSYCLHPDIARLACPGGGGAVYSLFVVLSAMGLDPLL
ILFSYGLIGRVLQGFGSCEDRWKAGQTCAAHLSAVLLFYVPMVLLALIDHLRMPIPQPARTLLSYVHFLLPPLINPILYSVKMKEIRERIHKRLKPRKVGCA*
371 >lcl|XP_001255799.2|Plus1complement(1036346..1037296) NW_003101172 olfactory receptor 570-like LOC788881 __SEG__ Chr15 {Bos taurus} MLPLNASEAAVSTFLLIGIPGLEGVHIWISIPICLMYLMAILGNCTILFVIRTEPSLHEPMYLFLSMLALSDLGLSFSSLPTMLRIFLFNAMGISVDACIAQEFFIHGFT
DMESSVLLIMSFDRFVAICNPLRYRSILTSSRVLHIGLAFAFKSILLVLPLPFTLKRLRYCNKRLLSHSYCLHQDVMKLACSDNRVNFYYGLFVALCMMSDSMLIVVSYV
FILKTVLGIASHREWLKALNTCVSHICAVLIFYVPIITLALMHRFPKHTPPVAMILMADAFLLVPPLMNPILYCVKTQQIRVKVLEKLEKLGLKSK*
372 >lcl|XP_001255835.2|Plus1complement(2447980..2449002) NW_001494040 formyl peptide receptor-like 1-like LOC788930 __SEG__ Chr21 {Bos taurus} MDLTNSTDFLLNDSTLIRNRIHIPKSASKVIVVVLLFMSFLIGTITNGLYLWVLKFKMKKTVNTLLYFHLILSYFISILFLPFLAISHLQDNHWSFGRATCKIFNSILYA
TMFASVFFLSAISVDRYLLTFHPVWSQLHRTPRWASSIILGVWIFAAALSTPYVVFRETHDDHKGTVTCQNNYGVSTDWESKKMQTLRKWIHVACFSSRFLLGFLLPFLI
ITFCYERVARKMKARGLLKSGKPFKVMMTAIVSFFVCWMPYHVYQGLLLTENRSLFFQLTVLLTVITTTFNTVFSPTLYLFIGENFRKVFKKSVLVLFESTFSEDSSAER
TENLNSEADM*
373 >lcl|XP_001256024.1|Plus1167707..168633 NW_001493369 olfactory receptor 1256-like LOC789201 __SEG__ Chr15 {Bos taurus} MEPRNNVTYFVLLGLTKNPKEQKVLSVMFLFFYILTLMGDLVIIMNITVSKTLNSPMYFFLASLSFIDVTYSSCITPRMISDLFLGEKIISFESCMTQLYTEHFFGGSEI
ILLVMAYDCYEAICKPLYSLVIMRQRVCVVLLVVSWVGGFLHSATQLSTVCGLPFCGPNVIDHFMCDMFPLLRLVCTDTYLIGILVLANGGLICTLGFLLLLVSYGVILH
SLKNLSQEGRRKTLHTWGSHITVVICSSVPSIFVKARPAKTFPIDKSLSVFYTVISPMLNPLIYSLRNSELTNAMKKVWRRNIISHFN*
374 >lcl|XP_001256054.1|Plus1complement(1018752..1019699) NW_001495312 olfactory receptor 374-like LOC789246 __SEG__ Chr7 {Bos taurus} MAEIGANLTLVSEFLLLGLSEDPKQQRLLFILFLSMYLVTQLGNLSIILAIATDVRLHTPMYFFLANLAFVDICFTSTTIPKMLANHVSGHKGIPYAGCLAQMFFFIWFA
GIDSFLLTTMAYDRYKAICHPLHYALSVTPQLCSVLVAASWTAAFGNALTHTVLLTRLSFCTHNQIPHFFCDLSPLLKLACSDTFLNNAVVYTVGALPIITPFVGILVSY
TRIFAAVLRIPSTRGKRKAFSTCGSHLSVVSLFYGTIIGVYFSPMSSHAAQKDTAAAVMYTVVTPMLNPFIYSLRNSDMKGALGALISRRPVFIQ*
375 >lcl|XP_001256076.2|Plus1346669..347613 NW_001493369 olfactory receptor 73-like LOC789281 __SEG__ Chr15 {Bos taurus} MDMRNQSAGITFILSGFSEYPQLQVPLFLVFLAVYTVSVVGNLGMIVIIRINPKLHTPMYFFLRHLSFLDFCYSSVTTPKILEILVADTRTISYVGCMMQFFLGCTLVIT
ETFMLAVMAYDRFVAVCNPLLYTVAMSPKLCSLLVAGTYTWGGLCSLTITCSLLKLTFCGSNVIHHFGCEYSAIISASCSDSYFSKMTCFIIATLNEVCSLLIILASYIF
IIVTIIKLPSAGGLQKAFSTCASHLTAITIFHGVMLLLYCVPNSGSSWLFIKVATVLYTVVIPMLNPLIYSLRNNDVKETIRKLVNTKMFSHPM*
376 >lcl|XP_001787365.2|Plus1complement(65600..66577) NW_001502138 olfactory receptor 654 (predicted)-like LOC787901 __SEG__ Chr15 {Bos taurus} MTDCNASQGHPSFFLLQGIPGMEDKHKWISIPFSSMYFVTILGNCTILFTISTEHSLHKPMFLLLGMLALTDLGMSTTTIPKVLCIFWFDQSDISFKGCLVQLFFLHSIS
ALQSAILMSMAFDRYVAICEPLRYATILSNSRIGLIGLVSLVRAVLLILPMPILLQKMPFHARHVIPTTYCEHMAVVKMVCVDTTVNRVYGLVVALLVAGVDISAIASSY
VVIIRAVMRLSSKEAHQKAVNTCTTHICVMLLYYTPPLFSFLAHRFGHGIPPHVHTILGSLYFLVPPMLNPIIYAVKTKEFRDKLTKYGCWRKEPIDITYGQKPV*
377 >lcl|XP_001787370.2|Plus1complement(84542..85519) NW_001502138 olfactory receptor 654 (predicted)-like LOC531173 __SEG__ Chr15 {Bos taurus} MTDCNASQGHPSFFLLQGIPGMEDKHKWISIPFSSMYFVTILGNCTILFTISTEHSLHKPMFLLLGMLALTDLGMSTTTIPKVLCIFWFDQSDISFEGCLVQLFFLHSIS
ALQSAILMSMAFDRYVAICEPLRYATILSNSRIGLIGLVSLVRAVLLILPMPILLQKMPFHARHVIPTTYCEHMAVVKMVCVDTTVNRVYGLVVALLVAGVDISAIASSY
VLIIRAVMRLSSKEAHQKAVNTCTTHICVMLISYTPSLFSFLTHRFGQGIPPHVHTILGSLYFLVPPMLNPIIYAVKTKEFRDKLTKYGFWRKKLINIIHDQKPL*
378 >lcl|XP_001787506.1|Plus11208388..1209323 NW_001493648 olfactory receptor Olfr464-like LOC512973 __SEG__ Chr19 {Bos taurus} MASGNLTWVSEFVLLGLSQTQELQLFLFLVFLLVYTTTVMGNLLIMITVTSDSRLHTPMYFLLRNLAVIDLCYSTVTSPKMLVDFLHETKTISYHGCMAQIFFFHLLGGG
TVFFLSVMAYDRYIAISRPLHYITIMNTRVCVGLVVAAWVGSFVHSIVQLVLMLPLPFCGPNTLDNFYCDIPQMLRLACTDTSLLEFLMISNSGMLALIWFLLLLISYTV
ILVMLRSQSGQARRKAASTCTTHIIVVSMIFIPCICIYARPFTSFPMDKTVSISYTVLTPMLNPIIYTLRNREMQAARKRLGKRLVISSRE*
379 >lcl|XP_001787509.1|Plus11259362..1260297 NW_001493648 olfactory receptor, family 4, subfamily D, member 2-like LOC783663 __SEG__ Chr19 {Bos taurus} MESGNHTWVPEFVFLGLSQTQELQLVLFLVFLFVYITTVMGNLLIMVTVTSDSRLHTPMYFLLRNLAIIDLCFSSVTAPKMLVDSLAEKKTISYQGCMTQIFFFHFLGGA
MVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVASWVGGFIHSISQVALMLPLPFCGPNILDNFYCDVPQVLRLACTDISLLEFLIISNSGVLVLIWFLLLLVSYSA
ILVMLRSHSGKARRKAASTCTTHIIVVSMVFVPSIYLYARPFTSFSMDKAVSISQTIMTPMLNPMIYTLRNQEMQAAVKRLGRHPLACKSE*
380 >lcl|XP_001787511.2|Plus1complement(125989..126957) NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC787574 __SEG__ Chr7 {Bos taurus} MEPGNETQISEFLLLGLSKKIELQTLIFGLFLSMYLITVIGNLLLILAVSSDPHLHTPMYFFLSNLSFVDVCFTSTTIPKMLKNIRTKNKAITYEGCITQIHFFLLFATM
EIFLLTVMAYDRFVAICHPLRYTIIMNPRVCGLLALMSWMMSVLNSLLQSLMVLWLSFCTDLEIPHFFCEITQVVQLACSDTFLNDIVLYFATMLLGSVSLTGILYSYSK
IASSIRRISSAQGKYKAFSSCASHLSVVSLFYCTALGVYLSSGTTHSSQSSATASVMYTVVTPMLNPFIYSLRNKDIRRALRRIIGMAVLYGPIVLGLKKYA*
381 >lcl|XP_001787523.1|Plus1170231..171202 NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC787604 __SEG__ Chr7 {Bos taurus} MESGNGTQSSNFLLLLGLSGESELQPLIFGLFLFMYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTESQVITYEGCITQMYFYILFAG
LDDFLLTVMAYDRYVAICHPLHYMVIMSPQLCGLMVLISWIMSVLYSLLHSLMVLRLSFCTDLEIPHFFCEIKELVQLAYSSTFLNNTMMQFGAGLLGGGTLTGILYSYS
KIVSSIYRISSAQGKCKAFSTCASHLSAVSLFYCTSLGVYLSSAASHSSLSSAAASVMYTVVTPMLNPFIYSLRSKDIKRALKRCFGMETVSRSFVLGLKQCT*
382 >lcl|XP_001787545.1|Plus1complement(362107..363051) NW_001493369 olfactory receptor, family 5, subfamily I, member 1-like LOC100140748 __SEG__ Chr15 {Bos taurus} MEKENCSSVTEFIFLGITSDLEVKVTLFAMLLVVYLINLLGNLGMIILIRMDPQLQTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAKNKPIPFYGCALQFLVACTFADS
ECLLLAVMAYDRYRAISSPLLYALSMSSGVCSLLVAGVYLVGMTDALIHTTLAFHLCFCGSNEINHFFCDLPPLYLLSCSDTQVNELTVFIVFGVIELSSISGVLISYCY
IILAVSKIHSAEGRFKAFSTCTSHLTAVAIFQGTMLFMYFRPSSIYSLDQDKMTSLFYTLMIPMLNPLIYSLRNKDVKNALGKLKNKRWFQRFI*
383 >lcl|XP_001787728.1|Plus1complement(406032..406952) NW_001493369 olfactory receptor, family 5, subfamily I, member 1-like LOC520162 __SEG__ Chr15 {Bos taurus} MKRGNCSSLTEFILWGITDKPEVKMILFIMFVIVYLINLLANLGMIILIRMDPQLHTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAKKRSISFCGCALQFLVFSNFIDC
ECLLLAVMAYDRYKAISSPLLYVVSMSSRLCSLLMAGVYLLGIIDTLIHTILAFRLCFCGSNVINHFFCDLPPLLSLSCSDTRVNELALFIFFGCVELTSISGVLVSYCY
IILAVLKIHSAEGRFRAFSTCTSHLTAVAIFQGTVFFMYFRPSSSYSLDEDKMSSLFYTLVIPMLNPLIYSLRNKDVKQALQKLKL*
384 >lcl|XP_001787767.1|Plus158544..59485 NW_001502164 olfactory receptor 1087-like LOC514057 __SEG__ Chr15 {Bos taurus} METHNGTVLSEFILMGITDRPELQAPLFGLFLIIYMISAVGNLGMVILTKVDSRLRTPMYFFLRHLALTDLGYSTSVGPQMLVNFVVDQNKISYHLCATQLAFFIVFIIS
ELFILATMSYDRYVAICHPLLYTVIMSQRVCWALVAIPYLYSTLVSLLVTVNIFNSSFCGYNIISHFYCDSLPILSLLCSNTHEIELIILVLSGFNLIFSLLIVLVSYLL
ILAAIVRMNSTEGRRKAFSTCGSHLTVVTVFYGTLIFMYVQPESSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVKYALQRTWKKLCNIFP*
385 >lcl|XP_001787905.1|Plus1complement(831039..832115) NW_001492799 leukotriene B4 receptor 2-like LTB4R2 __SEG__ Chr10 {Bos taurus} MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRSARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVL
LTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAALVLATPAAVYRHLGADHVCQLCHPSAAHAAAHLSLETLTAFVLPFGLVLGCYGVTLARLRGVRWGAGRRVT
RVGRLVGAIVLAFGLLWAPYHAVNVLQALAALAPPEGAFARLGGAGQAARAGTTALAFFSSSVNPVLYLFTAGDLLPRAGPRFLMRLFEGSGEARGGGRSREGTLELRTT
PRLKVVGRAGGNGDPGGGAQKDSQGWDP*
386 >lcl|XP_001787911.1|Plus1891696..892634 NW_001493369 olfactory receptor 1105-like LOC100139830 __SEG__ Chr15 {Bos taurus} MADSNVSGITEFILLGLTDNPELNTVLFVVFLLIYLITVLGNVWIITITLVSDQLHSPKYFFLIQLAFLDFCYSSVFIPKLLVNYVVGQKVISYSGCLLQYSFVSLFLTT
ECFLLAAMAYDRYLAICRPLHYKGLMTPTFCIHLVTASYLLGCANSLTHLSGLLSLSFCGHNVINHYFCDIPLLFQLACSDTHYSEALFTILSGATSVATFLMVVSSYLG
ILLTVLKTRSLRSRYKAFSTCASHLTIVSVFYGTMIFTYLGTSSSYPDEKAKILSVFYTLLLPILNLLIYSIRNTEAKEAMKRIIMRKIFAQ*
387 >lcl|XP_001787960.1|Plus1256732..257676 NW_001502065 olfactory receptor, family 51, subfamily E, member 2-like LOC785593 __SEG__ Chr15 {Bos taurus} MSIINVSHAEITTFILVGMPGLEYAHIWISIPICNMYLIALLGNCIILFIIKTEPSLHEPMYYFLSMLTLSDMGLSFSSLPTMLRIFLFKASEISANACFAQQFFIHGFT
ALESSVLLIMSFDRFLAIHNPLRYSSLLTTLRVAQIGIVCFFKSFLLVLPFPFTLRMLKYCEKRQLSHSYCLHQDVMKLACSDNQIDVIYGFFGALCLMVDFMLIAVSYI
LILKTVLGIASQKEQLKALNACVSHICAVIIFYLPIINLAIVHPFVQHVSPLFNVLMANVLLLVPPLMNPIVYCVKTRQIRVKVVAKLCQKQIY*
388 >lcl|XP_001788143.1|Plus154867..55790 NW_001493368 olfactory receptor 480-like LOC509125 __SEG__ Chr15 {Bos taurus} MEKNNHTVTEFILVGFTTDPKMQLVLFVVFLGVYSMTLVGNTTLIALICNDSRLHTPMYFLIGNLSFLDVWYSSVYTPKILVTCISEDKSISFTGCAVQFFFSAGLAYSE
CYLLAAMAYDRYAAISSPLLYAQVMSRRLCICLVIYSYTGGFVNAIILTSNTFTLNFCGGNIIDDFFCDVPPLVNLACDVKETYQDVLYFLLASNVITPTVLILASYAFI
IAAILRIRSTQGRLKAFSTCSSHLISVTLYYGSILYIYSRPSSSYSLERDKMVSTFYTVVFPMLNPMIYSLRNKDVKAALKKLSRFT*
389 >lcl|XP_001788169.1|Plus1<1657393..1658346 NW_001493845 olfactory receptor, family 5, subfamily I, member 1-like LOC783917 __SEG__ Chr1 {Bos taurus} FQRSSIKDMETKNVTELTEFILTGLTHQPEWQIPLFLLFLMIYLITIVGNLGLIMLICNDPHLHIPMYLFLGNLAFVDTWLSSTVTPKMLLNFFTMSKMISLSECKIQFF
SFAICVTTECFLLATMVFDRYVAICKPLLYPVIMTNRLCIWLLVLSFLGGIFHAIIHNAFLLRLTFCNSIIVNHFYCDIIPLFKISCTDPSINFLIVFIFAGSIQTFTIS
IVLVSYTLVLFTILKKKSLQGVRKAVSTCGAHLLSVSLYYGPLLFMYVLPGSAQENDQNMMDSLFYTVIIPFLNPIIYSLRNKKVIDSLTKMLKRNV*
390 >lcl|XP_001788189.1|Plus1complement(1324988..1325923) NW_001495357 olfactory receptor Olr1654-like LOC787850 __SEG__ Chr7 {Bos taurus} MENWNITADFILLGLFNHTGAHRFLFVLVLIVAFTSLVGNALMLLLILLDPRLHRPMYFLLSQLSLMDLMLISTIVPKMAVDYLTGRKFISPAGCGFQIFFFLTLGGGEC
FLLAAMSYDRYVAICHPLRYPVLMSWKLCLSMILGSWLLGAVDGLMQAAATLNFSFCSTHEIDHFFCEAPTLVRLACADTSVFEYVMYICCVLMLLIPISLILISYSLIL
AAVLQMHSNEAHKKAFATCSSHISVVGLFFGAAIFIYIRPKSYRSAKHDKFVSAFYTIFTPVLNPLIYSLRNSEVKGALRKCMDQWHCLKS*
391 >lcl|XP_001788390.1|Plus1complement(54694..55638) NW_001502241 olfactory receptor, family 51, subfamily E, member 2-like LOC784437 __SEG__ Chr15 {Bos taurus} MSIINISHAEITTFILVGMPGLEYAHIWISIPICNMYLIALLGNCTILFIIKTEPSLHEPMYYFLSMLTLSDMGLSFSSLPTMLRIFLFKASEISANACFAQQFFIHGFT
ALESSVLLIMSFDRFLAIHNPLRYSSLLTTLRVAQIGIVCFFKSFLLVLPFPFTLRMLKYCEKRQLSHSYCLHQDVMKLACSDNQIDVIYGFFGALCLMVDFMLIAVSYI
LILKTVLGIASQKEQLKALNTCVSHICAVIIFYLPIINLAIVHRFVQHVSPLFNVLMANVLLLVPPLMNPIVYCVKTRQIRVKVVAKLCQKQIY*
392 >lcl|XP_001788439.1|Plus1complement(352540..354270) NW_001494732 hypothetical protein KPRP __SEG__ Chr3 {Bos taurus} MCDQQQIQCYQPHPQYCVTCSPCYISQTPCANSQVVVQAPCEMQIVECPAPCPVQVSQVKCQAPCQSKTTEVKGQAPRESKTIQVKGKAPCESKTTQVKGKASCESKTTQ
VKGQAPSQPQFTCVQCQVPCQSEVSYVQCEGPCPVQTCYVECAPVCYTETCYVECPGQSYVPCPAPQPVQTYVTGPLVCQPQGRFSTQCQYQGSYSGCDPQLQSRASFST
WAPQCQTRGSYGSFPAQSRSRSTSRCLPPRQLQPSYRSCSPPRRSEPYYSSSCLPSRCSLGSYNYCTPPRRSEPIYNSDCSRRPTLGCSQRCGPKCRIEISSPRCPRQVP
PQKCPVQIPPIRRCSESCAPRPSWGTSCPDLRSRAEPCPLPSFHPPRRLDQCPEPSLRRSPPPAPCPRPLPAPRTCSRPERCVSPEFRPCSPPRRLSEPCLYPEPRPVPY
PAPRHPRPVQCDLSAPRPYPQPYERQESFPLLEPIPLPEPIPLPSPCPSPEPCVEPRPNPCTGDLGCHESSPHRLDTEAPICGPAGYNWWQDSEPGCRPCDVGLPESQGL
GGCGDQGGVSVGMKGGTRGGVKGAYF*
393 >lcl|XP_001788472.2|Plus1285198..286133 NW_001494525 olfactory receptor, family 8, subfamily G, member 1-like LOC516022 __SEG__ Chr29 {Bos taurus} MDPGNHSLVTEFLLAGLTEHPRLQLPLFLLFLGIYVVTVVGNLGMIILIGLSSHLHTPMYYFLSSLSFIDLCQSTVITPRMLVNFVTEKNVISYPECITQLYFFLLFAIS
ECYMLAAMAYDRYVAICSPLLYNIIISHQACFSLIWGVYMMGLICAFSHTGCTLRVHFCKLDMINHYFCDLLSLLKLSCSSTYVNELLVLCFSALNIFAPSLIIVSSYVF
IISSVLHIPSMRGRSKAFSTCSSHISAVAIFYGSAAFMYLQPSSVSSMDEGKVSSVFYTIVVPMLNPLIYSLRNRDVNVALKKILERRIFF*
394 >lcl|XP_001788480.1|Plus1complement(368178..368897) NW_001494525 olfactory receptor 924-like LOC100138844 __SEG__ Chr29 {Bos taurus} MTTLNHSSVSEFILEGLTKCPELQLPLFLLFLGIYVVTVVGNLGMIFLIAISSQLHSPMYYFLSHLSFIDLCYSSVITPKMLVNFVLEKNVISFLECMAQLYFFLIFVIA
EGYLLTAMAYDRYVAICSPLHYNIIMSHRVCSIMMGVVYSLGLFGATVHTTRMSMLSFCGSHVISHYFCDILPLLSLXXXXXXXXXXXXXXXXXLKSMCQTCSRRQQIEN
CCDSIQLAITTPASPLPQP*
395 >lcl|XP_001788498.1|Plus158117..59061 NW_001493327 olfactory receptor 560 (predicted)-like LOC784976 __SEG__ Chr15 {Bos taurus} MSNLQNTTSSSIIFMLTGVPGLEAFHTWISIPFCFLYATALSGNSLVLFAIITQPSLHKPMYYFLSMLSTTDLGLSVSTLFTMLGIFWFNAREISFNACLSQMFFIKFFT
VMESSVLLAMAFDRFVAISDPLRYAIILTDSRITQIGVAIVIRGTLTLTPMVALLTRLSYCHSRVLHHSYCFHPDVMKLSCTDTRLNNAVGLTAMISTVGVDSILIPFSY
VLIIKTILSIASPEERKKAFSTCISHIGAVAIFYIPLISLSFVHRFGKRAPAYVHTMIANTYLLIPPVMNPVIYSVKTKQICRAVIKILHSKDT*
396 >lcl|XP_001788550.1|Plus1103148..104089 NW_001492989 olfactory receptor Olr413-like LOC540359 __SEG__ Chr11 {Bos taurus} MRPENQSHMSEFLLLGLPICPEQQGMFFALFLSMYLTTVLGNLLILLLIRLDARLHTPMYFFLSHLAFTDISFSSVTVPKMLINMQTQDQSIPYAGCIAQMYFFLLFGCI
DNLLLVVMAYDRYVAICHPLHYTTIMREGLCMFLLAGSWLLSCVIALSHTILLAQLSFCEDNIIPHFFCDLAALLKLSCSDTSVNELVIFTAGTAVVILPLSGILISYGL
IGVSILRVPSTKGICKALSTCGSHLSVMFLFYGTIMALYFSTSSGKSKDKDMIASLMYTLVTPMLNPFIYSLRNRDMKLALGFLFKSNNLLIK*
397 >lcl|XP_001788579.1|Plus1complement(2537957..2538898) NW_001494955 olfactory receptor 49-like LOC614281 __SEG__ Chr4 {Bos taurus} MSNHSSATEFCLLGFPGSQELHHILFAIFFLFYSVTIMGNTIIIVIICVDKHLHSPMYFFLGHLSAVEMLATSIIVPMMLWGLLLPGMQTVSLTACVTQLFLYLALGTTE
FALLGVMAVDRYVAVCNPLRYNTIMNSHTCISVVTGSWVFGFLSEIWPVYATFQFTFCKSNMLDHFYCDRGQLLKLSCGDTLFTEFVLFLMAVFIVIGSLVPTIVSYIYI
TSTILKMPTASGRRKAFSTCASHLTFVVIGYGSCLFLYVKPKQTQAAEYNKIVSLLIFVLTPFLSPFIFTLRNDKVKEALRDGVKRCGQLLKD*
398 >lcl|XP_001788597.2|Plus1complement(354213..355142) NW_001501761 olfactory receptor 18-like LOC514883 __SEG__ Chr7 {Bos taurus} MEPHNLTSVSEFLLLGLSDDPELQLLLFGLFLSMYLVTILGNLLIILAVTSDSHLHSPMYFFLSNLSLTDVSFTTTTIPKMLVNLQTHIKSITYAGCLSQVTFFSLFVCL
ESLLLTVMAYDRLVAICHPLHYLVIMNPLLCGLFVLVSFSISLLTSLLHYLVMSQLTFCPEVEIPHFFCDLSQLLNLACSDTSTNNILIYFIGTIFGGIPLSGILYSYTQ
IMSSILRISSLGGRYKAFSTCGSHLVVVCLFYGTGLGVYLSSAASSSPRKGAVASVMYTVVTPMLNPFIYSLRNKDIKSALWRIISRIA*
399 >lcl|XP_001788727.1|Plus16124181..6124768 NW_001493674 hypothetical protein LOC100139067 __SEG__ Chr19 {Bos taurus} MTHSCCSPCCQPICRNTCCESSCCKPCCPPTCCQTTCCRTTCCRPTCVTTCCQPSCCSKPCCQPTCCESICCQPSCPPTYYQTSETTCCRTTCRKPTCVTTCCQPTCCVS
SSCGQTFSGSSCSQSCCQPACCAPVYCHRICYHPTCLCLPGCQDQSCGSSCCQPCSRPVCCQTTCCRTTCCHPSCVSSCCQPSCC*
400 >lcl|XP_001788745.1|Plus1784087..785028 NW_001494175 olfactory receptor, family 2, subfamily B, member 3-like LOC616747 __SEG__ Chr23 {Bos taurus} MNWANESSPKEFVLLGFSDKPWLQKPLFILLLISYTTTIFGNVSIMMVCILDPKLHTPMYFFLTNLSILDLCYTTSTVPHMLTNISHNKKTISYAGCVAQLITFLALGAT
ECLLLAVMSFDRYVAICRPLHYVVIMNPWFCLRMIAFSWFTGFSNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIVAELFFFSVLILLIPVTLILISYGF
IAQAVLRIKSAEGRRKAFGTCGSHMVVVSLFFGTGIYMYLQPPSSTSKDWGKIVSLFYGIFTPMLNPLIYSLRNKDMKEAFKRLMLLTFYYKK*
401 >lcl|XP_001788755.1|Plus13768493..3769422 NW_001494955 olfactory receptor OR7-15-like LOC787786 __SEG__ Chr4 {Bos taurus} MERNQSQITEFILVGFQLSKNMELLLFGIFSLLYVCNLLANGMILGLICLDPRLHSPMYFFLSHLAIIDISFPSSNLPTFLENLVKHTKSISFDPCTVQMLFNLTFGSIE
CLILLAMSYDRYVAICHPLQYTVIMNWRVCSILAIACWACGFALALVQVILLLRLPFCGPQKVNHFFCDIRSVLKLACGDIWMNEMFLFADGVLYLVGPLALVLVSYMRI
LWAILKIQSKKGRKKAFSTCSSHLCVVGFYFGLAMIVYMVPDNSQQEEHLKILFLFYTLFNPLLNPLVYSVRNAQVKAAFHRVLQKKTT*
402 >lcl|XP_001788794.1|Plus1207566..208528 NW_001494174 hypothetical protein LOC784858 __SEG__ Chr23 {Bos taurus} MSFNCSLWQDNSMSVKHFAFVKFSEVTEQCFLLFSFILFMFLASLTGNALIALAIWTNPALHTPMYFFLANLSLLEIGYTCSTIPKMLQNLVSEARGISREDCATQMFFF
TLFGISECCLLAAMAFDRYTAICSPLHYATRMSHGVCVHLAMISWGMGCIVGLGQTNYIFSLDFCGPCEIDHFFCDLPPILALACGNTSHNEAAVFVAAILCISSPFLLI
IASYGRILAAVLVMPSPEGRQKALSTCSSHLLVVTLFYGSASVTYLRPKASHSPGVDKLLALFYTVVTSMLNPIIYSLRNKEVKTALRRTLGKKNVLTHG*
403 >lcl|XP_001788829.1|Plus1108160..109098 NW_001493372 olfactory receptor 1425-like LOC530068 __SEG__ Chr15 {Bos taurus} MELGNGTRVKEFIFLGLTQNQELSLVLFLFLLLVYVTTLLGNLLIMVTVTRDSRLHTPMYFLLRNLSVADISFSSITAPKVLADLLVQRKAISFNGCFTQMFFFHLIGGV
DVFSLSLMAFDRYVAITKPLHYVTIMSRGRCTALIVASWAGGFVHSIVQISLLLPLPFCGPNVLDTFYCDGPQVLTLACTDTAVLELLMISNSGLLTTLWFVFLLVSYMV
ILLLIRSQAGESRGKAISTCTAHITVVTLHFVPCIYVYARPFTVLPTDKAISVTFTVISPLLNPLIYTLRNQEMKAAMRRLRGRLGPSDCID*
404 >lcl|XP_001788851.1|Plus1complement(4791..5723) NW_001502331 olfactory receptor Olfr367-like LOC786573 __SEG__ Chr11 {Bos taurus} MNETSISDFLLLGFSQHPEHQTLLFGLFLAVYLVTVLGNLLIILAISSDPHLHIPMYFFLANLSFTDTCFSCTIVPKVLLNIHTQHYTISHTGCLVQMFFFMELTLLDDF
LLAVMAYDRYVAICLPLHYTTIMGPQRCLLLLAASWLSSHLLAFSVCLLVSQFSFCASHAIPHFFCDLLPLLKLACSDTHIFQLMMFAEAALSGVVPFTCVLVSYAHIIH
TILRIPSAGGKHKVFSTCGSHLTVVTLFYGTLFLVYFQPTSFYSADTGMAASVVYTMVTPMLNPFIYSLRNRDIKGALCRFFSRGKCSTL*
405 >lcl|XP_001788962.1|Plus1149185..150195 NW_001508794 casein kinase I-like LOC100138998 __SEG__ ChrX {Bos taurus} MASSSGPKADVLVGGRYKLVREIGSGSFGHVHLAIDLTNHEQVAVKLESQNTRQPRLLYEKELYNILQGGVGIPQIRWYGQETDYNVLVMDLLGPSLEDLFNFCSRRFSM
KTVLMLADQMISRIEYVHTQNLIHRDIKPENFLMGTGQQWKELFLIDFGLAKKYRDNRTGQHIPYRSGKSLTGTPSFASISAHIGIEQSRRDDMESIGHVLMYFNRGSLP
WQGLKAATMKQKCEQISEMKMTTPVDVLCKGFPAEFAMYLKHCRGLSFEEAPDYRYLRQLFHMLFRKLNYQYDYAFDWIVLKQKAEQQAASSSGEGQQAQTPTGKSDKTK
SEMKHS*
406 >lcl|XP_001788985.1|Plus12106116..2107072 NW_001492801 olfactory receptor 773 (predicted)-like LOC530485 __SEG__ Chr10 {Bos taurus} MLSKMDKRNLSVVSEFMLLGLCQSWNKQVLLLLIFCMLYLIIVSGNIVIMILIITDPRLHSPMYFLLANLSFVDMWRSSVTTPKMITDFVRENKTISFGGCMCQILFVHF
VGGGEMVLLVVMAYDRYVAICKPLHYSSIMNLQKCIGLVVTSWTIGFVHAMSQMAVIVQLPFCGPREIDSFFCDIPLVIKLACIDSYNLGILMNADSGVLAMTCFILLLI
SYTYILLTVHQSSKAGTSRALSTCTAHITVVVLFFGPCIFIYVWPLSITWVDKFLAVFYSVITPLLNPAIYTLRNKEIKNALKRFRGYYLHSKKNINA*
407 >lcl|XP_001789047.1|Plus1complement(2562558..2563487) NW_001492801 olfactory receptor, family 4, subfamily L, member 1-like LOC787134 __SEG__ Chr10 {Bos taurus} MDLKNGSVVTEFILQGFSAAWELQIVFFVTFSLIYGATVLGNALIMVTVTCSSTLHSPMYFLLGNLSFLDMCLSTVTTPKMIRDLLTEHKTISIWGCMAQMFFMHLFGGV
EMTLLIAMAFDRYVAVCKPLHYRKIMNHRLLNRFVILSWTIGFTHTMSQMVLTVNLPFCGPHIIDNIFCDLPLVIKLACVETYTLELFVIADSGLLSLICFLLLLVSYTV
ILATVQRRSSGGLSKALSTLSAHITVVSLFFGPCIFIYAWPFKSFASNKVLAVFYTVITPLLNPIIYTLRNQKMQEAMKKLRFQNVSST*
408 >lcl|XP_001789049.1|Plus1complement(2571068..2572006) NW_001492801 Olfactory receptor 4K3-like LOC100139489 __SEG__ Chr10 {Bos taurus} MEKQNHSVVAEFILLGLTESHELQIFFFFFFSIIYIAILLSNLIIILVVKLDPQLQSPMYFLLVNLSFIDMSLASFATPKMIGDLISENKAISYEGCMAQIFFLHLLGGS
EIMLLVAMAIDRLIAICKPLHYKNIMSHRICIRLALLSWTTGFVHSVSQIVFIVTLPFCGPNVVDSFFCDLPQVIKLACTDTYVLDLLVIAFSGLLSLFCFIFLFISYSI
ILITVHHHSSSGYSKAMSTLSAHITVVVLFFGPCLFIYIWPFSHVFIDKIFSVFYTIFTPFLNPIIYSFRNKDMKKAIIKIKTKNVSSRSAF*
409 >lcl|XP_001789061.1|Plus160595..61527 NW_001502368 olfactory receptor Olfr1279-like LOC100140382 __SEG__ Chr10 {Bos taurus} MDGPNDSVVSEFVLLGLSGSYETKVFLTLIFSWIYLGIILGNLFILLLVIFNSHLHSPMYFLLANLSFIDMGVASTTVPKMITDLLNEYKIISFQGCMVQICFIHIMGGV
EMVLLIAMAFDRYTAICKPLYYLNIMNPKICVSFVITGWVIGVTHAMSQFAFIINLPFCGPNKVDSFYCDFPRIIKLACTDGAKFEFIVAANSGFMSMGTFFLLILSYIF
ILVTVWKRSSGDLSKAFVTLSAHITVVVLFFTPCMFLYVWPFPRSSIDKYLFIADFALTPVLNPIIYTLRNKEIKVAIKRLIKRHYVKFC*
410 >lcl|XP_001789150.1|Plus1complement(279391..280332) NW_001492804 olfactory receptor 1307-like LOC788790 __SEG__ Chr10 {Bos taurus} MYGANQSVVSEFVFLGLTNSWEIQLLLFVFSSSFYIASTMGNLLILLTVISDPHLHSSMYFLLANLSFIDLGFSTIFSPKMIYDLFRKHKVMSFSGCITQIFFIHIIGGV
EVVLLIAMAFDRYVAICKPLHYLTIMSPRMCVFFIVAAWIIGLIHSVVQLACMVNLPFCGPNVLDSFYCDLPQLIKLACTDTYQLKFMVTANSGLISVGSFFILIISYII
IILTVQKQSSAGSSKALSTLSAHITVVVLFFSPLMFFYIWPFSSSHLGKFLAIFDAVLTPFLNPVIYTFRNHEMRVAMRRVCKQLVNYRRSLK*
411 >lcl|XP_001789279.1|Plus1complement(2639075..2640019) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC613990 __SEG__ Chr19 {Bos taurus} MTGRNQTIVSEFLLLGLPIRPDQRDLFYTLFLAMYVTTVLGNLLIMFLIRLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQDMQSHVPSIPYAGCLTQMYFFLFFADL
ESFLLVAMAYDRYVAICFPLHYTTIMSPRLCLFLVVLSWVLTTFHAMLHTLLMSRLHFCEDSVIAHFFCDMSALLKLSCSDTRVNELVIFITGGLILVIPFLLIITSYAQ
IVSSTLKVPSAKGICKAFSTCGSHLTVVSLFYGTVIGLYLCPSASNSTVKETVMATMYTVVTPMLNPFIYSLRNRDMKGALGRVFYKKKTPFSL*
412 >lcl|XP_001789498.1|Plus191751..92686 NW_001493372 odorant receptor MOR10-like LOC788587 __SEG__ Chr15 {Bos taurus} MELGNGTRVKEFIFLGLTQNQELSLVLFLFLLLVYVTTLLGNLLIMVTVTRDSRLHTPMYFLLRNLSVADICFSSITAPKVLADLLVQRKAISFNGCFTQMFFFHLIGGV
DVASLSLMAFDRYVAITKPLHYVTIMSRGRCTALIMASWAGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLTLACTDIFILELLMISNSGLLTTLWFVFLLVSYMV
ILLLIRSQAGEGRGKAISTCTAHITVVTLHFVPCIYVYARPFSTLPTDKAVSVTFTVISPLLNPLIYTLRNQEMKAAMRRLRGRLGPSDKE*
413 >lcl|XP_001789508.1|Plus12558425..2559354 NW_001494522 olfactory receptor Olr1214-like LOC790885 __SEG__ Chr29 {Bos taurus} MAPGNESSVTEFILLGLTQQPGLQLPLFFIFLAVYVVTVVGNVGLIILIGLNPHLHTPMYYFLFNLSFIDLCNSSVITPKMLMSFVSQNIISYAECMTQLCFFSFFVIDE
CFILTSMAYDRYVAICKPLLYKVSMSHQVCLMLTVGVYAMGLVGAMAHTGCMLRLSFCDGNIINHYMCDIPPLLQLSCTSTSINELEIFIVVGVNVIVPSVTIFVSYTLI
LLNILRIRSAEGRSKAFSTCSSHIIAVSLFFGSATFMYLKPFPAGSLDEDKVSTVFYTIVGPMVNPFIYSLRNKDVHVALSKTIRKRVF*
414 >lcl|XP_001789526.1|Plus12674518..2675453 NW_001494522 olfactory receptor 979-like LOC526286 __SEG__ Chr29 {Bos taurus} MTNMSLVTTFILTGLPHSPELDTLLFGIFLVIYALTVVGNLLILLVITVDPHLHTPMYYFLSNLSFIDMWFSTVTVPKMLMTLVSPEGSPISFPGCVAQLYSFHFLGSTE
CFLYTVMSYDRFLAISYPLRYASVMSGRTCALLATTTWLSGSVHSAVQTTLTFRLPFCGPNQIQHYFCDAPPILKLTCADTSANEVVIFVNIGVVALGCFFLIVLSYVSI
IHSILKIHTSEGRWRAFQTCASHCTVVLCFFVPCVFIYLRPGSKEAMDRIVAVFYTVMTPLLTPVVYTLRNKEVKKALLTLKDKVAYSQSK*
415 >lcl|XP_001789540.1|Plus11024378..1025490 NW_001494894 G protein-coupled receptor 85 isoform 2 GPR85 __SEG__ Chr4 {Bos taurus} MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAF
MLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQF
VAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTSRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFA
QAGINPFVCIFSNRELRRCFSTTLLYCRKSRLPREPYCVI*
416 >lcl|XP_001789543.1|Plus1161271..161477 NW_001495263 guanine nucleotide binding protein (G protein), gamma 5 LOC100138801 __SEG__ Chr7 {Bos taurus} MSGSSSIAAMKKVVQQLRLEAGLDRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL*
417 >lcl|XP_001789798.1|Plus1<307223..308119 NW_001494141 lipid phosphate phosphatase-related protein type 3-like LOC517754 __SEG__ Chr23 {Bos taurus} SYFCEKTFSHTLPRVSTPSLDDPARRHMTIHVPLDASRSKQLISEWKQKSLEGRGLGLPDEGSPAHLRTPAEPMAEEEEEEEEEEEEEEEEGEEGGPALPSLYPTVQARP
GLGPRVILPPRPGPQPLVHIPEEGAQAAAGLSPNSSAAVRAKWLMMAEKSGAAVATASAQPRMANPPRLLQVIAMSKAPGAPGPKAAETASSSSASSDSSQYRSPSDRDS
ASIVTTDAHAPHHPVVHLSAGNGPWEWKAAEVRAKVMEGEGGYELGDLARSFRGGAKPPGISPGSSVSDVDQEEPRFG*
418 >lcl|XP_001790229.1|Plus1complement(14476..15417) NW_001501761 olfactory receptor 414-like LOC786833 __SEG__ Chr7 {Bos taurus} METDNQTSSSEFIRLGLSEKPEQETLLFALFLCMYVVTVVGNLLIILAISTDSHLHTPMYFFLANLSLVDFCLASDTVPKMLVSIQIKSKSISYSCCLTQMYFFHFFGIM
DSVLIAVMAYDRFVAICHPLHYTSIMSPRLCVLLVGGPWVFSGFISLTHILLMARLVFCGNIELPHYFCDLTPLLRLSCTDTSVNKIFVLIVAGMIIATPFICILASYAH
IIVAIVKVPSAGGRKKTFSTCSSHLSVVVLFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALMKLVNRKITSSS*
419 >lcl|XP_001790382.1|Plus1complement(316862..317806) NW_001493322 Olfactory receptor, family 2, subfamily D, member 3-like isoform 1 LOC513635 __SEG__ Chr15 {Bos taurus} MGEENHTFVAEFIFLGLSQDSQIQILLFILFLIIFLLTVLGNLLIIVLIFMDSRLHTPMYFFLRNLSFADLCFSTSIVPQVLVHLLVKNKTISFMGCMTQVIVFLLVGCT
ECALLAVMSYDRYVAVCKPLHYSTIMTQQVCLQLATGSWASGAVVSLVDTTFTFQLPYQGQNIINHYFCEPPALLKLASADTYRTEMAIFAMGVVILLAPVSLILASYWN
IISTVIQMQAGEGRLKAFSTCGSHLIVVVLFYGSGIFTYMRPNSKTIKEQDKMISVFYTVVTPMLNPIIYSLRNKDVKGALRKLAGRKSFSQRR*
420 >lcl|XP_001790516.1|Plus13658084..3659013 NW_001494955 olfactory receptor, family 2, subfamily A, member 4-like LOC787719 __SEG__ Chr4 {Bos taurus} MESNQSWVTEFILVGFHLSAKMEKLLFWIFSLFYIFSLLANGMILGLICLDLRLHTPMYFFLSHLAIIDMSYASNNVPKMMANLANKNRTISFVPCILQTFLYLGFAATE
CLILMVMSYDRFVAICHPLQYTVIMNWRACRVLATTSWACGFILALAHAVLLLRLPFCGPWEVNHLFCEILSVLKLACVDTWINQVVLLAASIFVLVGPLCLMLVSYIHI
LCAVLKIQSKEGRRKAFSICSSHLCVVGLFFGIAMLVYMVPDSNQREEEEKILSLFHSLFNPFLNPLIYSLRNAQVKGALYRALQKRSV*
421 >lcl|XP_001790553.1|Plus1complement(497741..498667) NW_001494175 olfactory receptor, family 12, subfamily D, member 2-like LOC785639 __SEG__ Chr23 {Bos taurus} MLNQTSVTEFLLLGVTDVQVLQPVLFVIFLAIYIVNVAGNGVIMMVVISDSRLHSPMYFFLGNLSCLDICYSMVTLPKMLENFLSIHKTISFLGCISQLHFFHFLGSTEA
MLLAVMAFDRFVAICKPLLYTLIMNHQVCTQMAVTIWIIGFFHALLHSVMTSRLNFCDSNHIHHFFCDVKPLLELACGNTDLNEWLLHSVTGTIAMGPFSLTLLSYFYII
IYLFFKTHSCSMLHKALSTCASHFMVVVLFYAPVVFTYNRPALGSSMDQEWIIAIMYSVITPVLNPLIYTLRNKEVEGALRRVIRRRL*
422 >lcl|XP_001790578.1|Plus14853661..4854599 NW_001494824 olfactory receptor Olr1654-like LOC527414 __SEG__ Chr3 {Bos taurus} MQETNQSSVTEFILLGFSFSPKTTPLFFSAFLTTYLLIILGNGLIIILISLDSHLHTPMYFFIVTLSTLDLGYATTTMPQMLAHLASQKKTISFASCVAQMYIFLVLGVT
ESWLFAIMSIDRYVAICHPLRYKVIMSPWLCRVMVLFCGLWGVVSALVYTVFAMRLPYCGPNKINHFFCEVPAVLKLACADTSVNDQVDFILGFSVILVPLSLILVIYIN
IFIAILRIRSAQGRLKAFSTCASHITVVTVFCVPAMVMYMKPGSEASPEEDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKVMGWRRAPE*
423 >lcl|XP_001790587.1|Plus1complement(2242202..2243149) NW_001492801 olfactory receptor OR14-14-like LOC784706 __SEG__ Chr10 {Bos taurus} MAWNNQSVITEFILQGLSSSWELQMVYFLFFSVVYAATVLGNLLIVLTIVSERRLHSPMYFLLGNLSFIDMSLASFATPKMIADFFREPKVISFDGCITQIFFLHLLGGV
EIVLLISMSFDRYVAICKPLRYLTIMNRRVCLGLVTLPWIVGIFHAMSQLAFTVNLPFCGPNEVDSFFCDLPLVIKLACVDTYILGVFMISTSGMIALVCFILLVISYSV
ILVTVRQRSSGGSSKALSTCSAHFTVVTLFFGPCIFIYVWPFTNFPIDKVLSVFYTIFTPLLNPVIYTLRNKDVKDSMRKFSSRVLKSSKIDHSP*
424 >lcl|XP_001790600.1|Plus148002..49342 NW_001502400 neuropeptide Y receptor Y5-like NPY5R __SEG__ Chr6 {Bos taurus} MDSELKDYYNKTSAGENNTAALRNSDFPVWDDYKSSVDDLQYFLIGLYTLVSLLGFMGNLLILMALMRKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFG
RVMCHIMPFLQCVTVLVSTLILISIAIVRYHMIKHPVSNHLTANHGYFLIATVWTLGFAMCSPLPVFHSLVELQETFGSALLSNRYLCVESWPSDAYRIAFTISLLLVQY
ILPLVCLTVSHTSVCRSISCGLSNKENQLEEKEMINLTLHPSQKSGPQVKLPSSQKWSYSFIRKHRRRYSKKTACVLPAPARPPLENRPGRLPEHAGSRKSPLPSSSKFI
PGVPTCFEVKPEENSDVHEMRVNQSIMRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLRSLI
HCLHMS*
425 >lcl|XP_002684114.1|Plus1287260..289044 NW_001494731 leucine rich repeat and Ig domain containing 4 LINGO4 __SEG__ Chr3 {Bos taurus} MAVATAPKQAWPPWPPVFFLLLLPALGSSGNCPAVCDCTSQPQAVLCAHRRLEAVPGGLPLDTELLDLSGNRLWGLQQGMLSRLGQLRELDLSYNQLSTLEPGAFHGLRS
LLTLRLQGNRLRIMGPGVFAGLSALTLLDLRLNQIVLFLDGAFRELGSLQQLEVGDNHLVFVAPGAFAGLAKLSTLTLERCNLSTVPGPALARLPALGALKLRELDIGRL
PAGALRGLGQLRELEIHHWPALEALEPGSLGGLNLSSLAITHCNLSSVPFQALHHLSFLRALDLSRNPISAIPARRLSSLVRLQELRLSGACLTSIAAHAFHGLTAFHLL
DVADNALQTLEETAFPSPDKLVTLRLSGNPLTCDCRLLWLLRLRRRLDFGSTPPACAGPQHVQGKSLREFADILPPGHFTCRPALIRKSGPRWVMAEEGGHAVFSCSGDG
DPAPTVSWMRPQGVRLGRAGRVRVLQDGTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNSTSPGIPGPFFLDSRGIAMVLAVGFLPFLTSVTL
CFGLIALWSKGKGRVKHHVTFDFVAPRTSGDKNSGGNRVTAKLF*
426 >lcl|XP_002684425.1|Plus136158..37102 NW_001502065 olfactory receptor, family 51, subfamily E, member 2-like LOC785144 __SEG__ Chr15 {Bos taurus} MPPLNTSHPSPVTFSLMGIPGLEHLHVWIGIPFCSMYVVAVVGNVTILAVVRTERSLHKPMFLFLCMLSVTDLVLSTSTLPRMLCLFWLGAHDIAFDACLTQMFFIHSFT
AMESGFFLSMAIDRYVAICHPLRHTTILTHTRIAKMGASVVLRGVAFFSPHPVLLRQLPYCRTRIIAHTYCEFMAVVKLACVDTGPTKRYSLSMAFVIGSCDGLFIVVSY
VLILRAVFHLPSREASLKALGTCVSHVCVILVFYSTAVFTFLTHRFGHSVAPHIHIFIANIYLLVPPFLNPIVYGIRTKKIRDHVLSSLRVKVA*
427 >lcl|XP_002684432.1|Plus1686502..687461 NW_003101172 olfactory receptor Olfr591 (predicted)-like LOC100335206 __SEG__ Chr15 {Bos taurus} MLDYNRSNLQLTTFLLLGIPGLEDAHLWISIPFSLVYLLSLTGNVALLLIIKTDRKLHEPMYLFLCMLSVADLMLISSTLPKILSLFWFNDREVYFEACLTQMYFIHSLS
TMESGFILAMAFDRFVAICHPLRHSTILTPAVIVGLGLLIVFRGAVLLSPHPFLLRWLSYCKTNVISHTYCEFMALIKLVCSETKIRRAYSLIVAFLTGGLDFILIICSY
VLILFTVFNLPSKAARLKTLSTCVSHVWVILVFYTPAFFSFLTHRFGHHIAPPVHIFIANIYFLIPPMMNPIIYGVKTKRIRDGFLKFLTIKCVQLCTL*
428 >lcl|XP_002684438.1|Plus1916693..>917394 NW_003101172 olfactory receptor, family 51, subfamily G, member 1 (predicted)-like LOC788789 __SEG__ Chr15 {Bos taurus} MRILYNSSLQKATFFLTGFQGLEDLHGWISIPFCFIYLTVIVGNLSIIHVIRTDVTLHEPMYYFLAMLALTDLGLCLSTLPTVMGIFWFDAREIGIPACFTQLFFIHTLS
LVESSVLLSMSIDRYVAICNPLRYSTVLTPARIIRMGLSSVFRSALLILPLPFLLKRFQYCHSHVLAHAYCLHLEIMKLACSSIIVNHIYGLFVMACTVGVDSLLIFLSY
ALILRTVLSIASHH
429 >lcl|XP_002684455.1|Plus1complement(368153..369103) NW_003101172 olfactory receptor Olr122 (predicted)-like LOC507662 __SEG__ Chr15 {Bos taurus} MLQLNGTVFMPSVLTLIGIPGLESVQFWIGIPFCAMYIIALFGNFLILVIIKSERGLHEPMYLFLAMLGVTDIALSTCILPKLLGIFWFHSAEIYFDACLFQMWLIHTFQ
CTESGVLLAMALDRYVAICDPLRHAAIFTHKLLTQIGVGVTLRAGVLIALCLILIKCRLKHYRTTVVSHSFCEHMAIVKLAAEDTRINKIYGLFVAFIILGFDIIFITLS
YIRIFITVFKLPQKEARLKAFNTCIAHICVFLVFYLLGFFSSFTHRFGFHIPSYIHILLSNLYLLVPPFLNPIVYGVKTKQIRDRVSKIFHLKDAS*
430 >lcl|XP_002700592.1|Plus12001404..2002342 NW_001492801 olfactory receptor Olr1654-like LOC784100 __SEG__ Chr10 {Bos taurus} MHVLHNKSVTANFHEFILLGFLCSQEIEILLFVFFSIIYILTLLGNSAIICAVWWDQQLHTPMYILLANFSFLEICYINSNVPSMLFNFLSKTKTISYHGCILQFYIFLS
LCATELFFLALMAFDRYVAICRPLHYPTIMTRKVCGTLVSASWVGGFLWLVTPAALISQVPFCGSNVIDHYLCDLGAMLAISCVPVPKTALTCSTFSAVITFITLFYILV
SYTLVLRAVIQVPKGPSRRKAFSTCTSHLIVVFLFYGSVTVMYVSPGVASQPGLQKFLTMLYSIATPLLNPLIDSLRNKEMKVALKKIMCKL*
431 >lcl|XP_002700738.1|Plus1700758..702401 NW_001492891 hypothetical protein isoform 1 ITPRIPL1 __SEG__ Chr11 {Bos taurus} MAVISLLFLAVMYVVHHPLLVSDRMDLDTLARSRQLEKRMSEEMRQLELEFEERKRAAEEKQKAENFWRGDTSGDQLVLGKKDRGWPFQVDGQEGPLGWMLGNLWNAGLF
CIFLIFELLRQNMQHEPAFDSSSDDDEEEVRVVPITSYNWLTDFPSREALESFHKHHVQNVTRDLPCTCEFVESFVDDLIEACRVLSRREAHPQLEDCLGIGAAFEKWGT
LHETQKFDILVPIIPPQGTMFVLEMRDPALGRRCGCVLVESECVCKREKLLGDVLCLVHHHRDHSALVGKSNSSIKAALCTGSHLDVYKTVQWFRNMVGNAWALVAHKYD
FKLSLPLSTTCCKLRLDYRSGRFLSIRLVLGVQREDTLVYLVSQAPDQEQVTSVDWPESFAACEHLFLKLVGRFAPENTCHLKCLQIILSLRDLQSLPQGASRPILTSYH
FKTALMHLLLRLPLTDWQHDMLSQRLQDILWFLGRGLQQRSLHHFLIGNTFLPLTIPIPKTFRNAEPVNLFQHLVLNPMAHSQAVEEFHNLLAQVKALPCSSLAGAR*
432 >lcl|XP_002701010.1|Plus1954491..955561 NW_001493075 serine/threonine kinase 24 LOC100336086 __SEG__ Chr12 {Bos taurus} MAHSPVQLGLPGMQDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMA
PEVIKLSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPSTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKNTSYLTELIDRYKRWKAE
QSHEDSSSEDSDTETDTDGQASGGSNSGDWIFTIREKDPKSLENGALQPSDLERNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRRAIYLAEEACPG
ISDTMVAQLVQRLQRYSLSGGGTSSH*
433 >lcl|XP_002701154.1|Plus1complement(352909..353880) NW_001493156 melanocortin 3 receptor-like LOC505405 __SEG__ Chr13 {Bos taurus} MNASCCLHSAQPKLPNSSEHVAAPSFSNQSSSRFCEQVFIKPEVFLALGIISLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAVVNSDYLTLED
QFIQHMDNVFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALALIVAIWLGCGICGVVFIVYSESKMVIVCLVTMFLAMLLLMGTLYVHMFLFARLHVKR
IAALPPADGAAPQQHSCMKGAVTITILLGVFVFCWAPFFLHLVLIITCPTNPYCVCYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFKEILCSCNGMNLG*
434 >lcl|XP_002701489.1|Plus1188315..189244 NW_001493369 olfactory receptor 1264-like LOC615605 __SEG__ Chr15 {Bos taurus} MEPRNNVTYFILLGLTQNPKEQKVLFVIFLFFYVLTVVGNLLIVVTVAVSKTLNSPMYFFLASLSFIDLVYSSSASPRLISDLFFGENTISFESCMTQLFTEHFFGGSEI
SLLLVMAYDRYVAICKPLHYLIVMRKRVCVVLLLVSCVGGFLHSIVQVGTVYGLPFCGPNIIDHFMCDMFPLLKLVCTDTFVIGILEVANGGLMCTLLFLLLLVSYGVIL
HSLKNLSQEGRRKALQTCGSHITVVVCFFVPCIFMYARPAKTFPIDKSLSVFYTVISPMLNPLIYSLRSFEIMNAIKKLWTKKVRSSSK*
435 >lcl|XP_002701561.1|Plus14036630..4037034 NW_001493394 progestin and adipoQ receptor family member V-like LOC100296870 __SEG__ Chr16 {Bos taurus} MTLLAPIFYSAHLPQLLAPGCFDGICHSHQLFCVCGILAAHMQMEAIILDKTLRKEWLLAHSGPLLFSQIAGAILLCLVFNLNNVIYFSAALYLIPEPELHKKEHDSDHK
LFMPNVNIKLQHLNHPKPMAWYQF*
436 >lcl|XP_002701749.1|Plus11246586..1247677 NW_001493523 G protein-coupled receptor 109A LOC527744 __SEG__ Chr17 {Bos taurus} MNPSQLQNHFLKIGEKNCCVFRDDFIAKVLPPVVGLEFVFGLLGNGLALWIFCFHLKSWKASRVFLFNLAVADFLLIICLPFLADNYVRRWDWKFGEIPCRLMLFMLAMN
RQGSIIFLTVVAVDRYFRVVHPHHALNKISNRTAGIISCLLWGITIGLTVHLLHRTRLIENQGSKLCSSFSICDAFRWHDAMFLLEFFVPLGIILFCSVRIVWSLRQRQM
NKHAKIRRAINFIMVVAIVFIICFLPSVAVRIHIFWLLRKAGTENCDIYRSVDLAFYITLSFTYMNSMLDPLVYYFSSPSFPNFFSTLINRCLKRKGPDESDNNRSTSVE
LTGDLSTTKNVPEALMANPSEPQSPSYLNPVSS*
437 >lcl|XP_002701900.1|Plus1complement(198954..199295) NW_001493607 calmodulin 2-like LOC100297240 __SEG__ Chr18 {Bos taurus} MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFHVFDKDGNGYISAAALHRVMTNLGEKLTDEKVDEMIREADIDGDGQVNYEEFVHMM
TAK*
438 >lcl|XP_002701928.1|Plus1584068..584787 NW_001493613 mitogen-activated protein kinase kinase kinase 10-like LOC100335458 __SEG__ Chr18 {Bos taurus} MEEEEWGAAKEWGTTPAGPVWTAVFDYEAAGEEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVALGTPAAPAGLQLPQEIPFHELQLEEIIGVGGFG
KVYRALWRGEEVAVKAARLDPERDPAVTAEQVRQEARLFGALQHPNIIALRGACLSPPHLCLVMEYARGGALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIH
RDLKSINSKWCPPPKTCFH*
439 >lcl|XP_002702210.1|Plus1complement(3797366..3798505) NW_001493674 hypothetical protein LOC100296460 __SEG__ Chr19 {Bos taurus} METLCPAPRLAVPGSPRGSPCSPTPRKPRRGTQEFSPLCLRALAFCALAKPRASSLGLGPGELAPRAPVLLGPCAPLCTGGRAPDGLKHLAGQAGRSSDPNAPARQDADA
AVCRGRGEEEEGGGSFPHFSARSGVPPGHCPAPRRPRESPTSSVSAPPRPALALDSQPGPAASPHQEPGSRPPPPPAGLSSEPMGPGAAPEPPPPNQTAAVDGNPPKVAP
EAPASSPSTASEAPAAPGDLRQEHFNRLIRRSKLWCYAKGFALDTPSLRRGPERPPAKGPARGAAKKRRRPAPPQRSAQPRRPTPTLPTTSTFNLLDCFPCPPALVLGED
GDLGPASSLRLQGDAKPPPAHPLWRWQIGGPAVPEPPGLKFWGINLEQP*
440 >lcl|XP_002702544.1|Plus1complement(2195322..2197190) NW_001493933 leucine rich repeat containing 70 isoform 1 LRRC70 __SEG__ Chr20 {Bos taurus} MCGVRFSLPCLRLFLLVACCLVLFFHKEILGCSSVCQLCTGRQITCRNLGLSNIPKNFPESTVFLYLTGNNISRINESEFTGLHSLVALHLDNSSIVYIYPKAFVHLRHL
YFLYLNNNFIKRLDPGIFEGLSNLRNLYLQSNQLSFVPRGVFHDLVSVQYLNLQRNRLTVLGSGTFVGMIALRILDLSNNKILRISDSGFQHLGNLDCLYLEGNNLTKVP
SNTFEVLKSLKRLSLSHNHIETIQPFAFKGLINLEYLLLKNSRIKNVTRDGFSGISNLKHLILSHNDLENLNSDTFSLLKNLIYLRLDRNRIISIDNNTFENMGASLKIL
NLSFNNLTDLHPRVLKPLSSLIHLQADSNPWDCSCRLLGLRDWLASSAITLNIFCQNPPSMRGRALHYVKWTDFTNCVTSSANVSRTWAITSLHIYHKTTTLMMAWHKIT
TNGKHLENTESVTFGERIRTSPAGRLFQENTFGNPLQTTAMLPVQIQRSSPVNLNLEKNSALPIDAASVSGKTSPICTQEVEKLNEAFDILLAFFILACVLIVFLIYKVV
QFKQKLKASENSGENRLEYYSFYQSARYNVTASICNTSPNSVESPGLEQIQLHKQIVPESEAQVILFEHSAL*
441 >lcl|XP_002702835.1|Plus11227511..1227849 NW_001494127 cyclic AMP phosphoprotein, 19 kD-like LOC100294787 __SEG__ Chr22 {Bos taurus} MSAEVPEAASAEEQKEMEDKVTNPEKAKEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSWDYNTAKAKMKNKQLPTATLDKTEVTGDHIPTPQDLPQRKPSLVASKL
AG*
442 >lcl|XP_002702870.1|Plus1773412..774797 NW_001494145 zinc finger and BTB domain containing 9 ZBTB9 __SEG__ Chr23 {Bos taurus} MDTSTPLPPVAPSPACNPAPRTIQIEFPQHSSLLLEALNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPNVIEADAFEGLLQLIYSGHLRL
PLDALPAHLLVASGLQMWQVVDQCSEILRELENTGGGISSRGATPFHTLLSTTGGWCIRSSPFQTPAQSSPSTQSPIGGEGSELGDVLQLQVEEEEEEDEEDQGSAAPSQ
TPQPQRESGSFPRPPVSHPLPTSTTPCRLPEGESAPPEPPAPHTALPPKVFYIKQEPFESKEEIAGGGSQSVGAKEETKVFPAGNTEENGELGFLLPSGAGTTSGGGGPS
WKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGAPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHACPHCGRRFRVHAC
FLRHRDLCKGQGWATAHWTYK*
443 >lcl|XP_002702919.1|Plus1244757..246136 NW_001494172 zinc finger and BTB domain containing 12-like LOC100336034 __SEG__ Chr23 {Bos taurus} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGVSDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLGIGGSVGSHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGGRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
444 >lcl|XP_002702933.1|Plus161633..62556 NW_001494173 olfactory receptor, family 2, subfamily W, member 1-like LOC782554 __SEG__ Chr23 {Bos taurus} MGTSNGSSTTDFILLGFSDRPQLEHIISVVVFIFYIITLVGNTTIILVSYLDTQLHMPMYFFLSNLSFVDLCYTTSIIPQMLVNLWGPKKSITYGGCVLQFFFALDMGAT
ECLLLAVMAYDRYAAVCQPLHYTVIMHPELCQKMVLIAWLGGFGSALTVCSLTVKLPRCGHREVDNFFCEVPALIKMACVYSKVIEVVVFALGVVILLVPLSLILISYGV
ITQAVMRIKSAARWQKILNTCGSNLTVVSLFYGTLIYMYLKPQTSTLQDEGKFLTLFYTIVTPSLNPLIYTLRNKDVKSAIKRILWI*
445 >lcl|XP_002704074.1|Plus187599..88498 NW_001494843 G protein-coupled receptor 35-like GPR35 __SEG__ Chr3 {Bos taurus} MNSSNCSSWDANPVYYTYMGGLLALGLLLNGLALWVLCWRLPRWTETRIYMANLAVADLCLLCALPSFLYFQKQTSKDTPLCQISQAVYLLNRYMSISLVTAIAVDRYVA
VRHPLRARRLRSPGRAAAVCTALWAVVLGSLVLRWFLDVQDGGFCFAVRSGRSTYTGVFSLLGFYLPLAVLVFCSLQVVTALTQRPEANPGQAEATQKASRMVLANLAVF
VVCFLPFHMVLTMRVALGLQTCAIKVAMQITSRLSDANCCLDVICYYFMAKEFQEASVSTTSPRAKAHKSKDSVTMTLT*
446 >lcl|XP_002704852.1|Plus1complement(<21292..21495) NW_001495329 vav 1 guanine nucleotide exchange factor LOC100336349 __SEG__ Chr7 {Bos taurus} MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVNLRPQMSQ
447 >lcl|XP_002705624.1|Plus1437877..438824 NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC100299615 __SEG__ Chr7 {Bos taurus} MEPSNNTQISRFLLLGISKEAEIQSLIFGLFLSMYLITVFGNLLIILAVSLDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIRTQSQVITYEGCITQMYFYILFAEL
DDILLTVMAYDRYVAICHPLHYMVIMNLRLCGLLVLISWVLIALYSLLHSLMVLGLSFCPETQISHFFCELSQVVQLASSDNFLNNIVMYFAAVLMGVGPFAGILYSYSK
IVSCICKITSAQGKYKAFSTCASHLFVVSLFYFTALGVYLSSAATHTSHSSTVASVMYTVVTPLLNPFIYSLRNKDIKGVLKRFYFMPSLKDQIP*
448 >lcl|XP_002706052.1|Plus190311..91252 NW_001502164 cOR8V11 olfactory receptor family 8 subfamily V-like LOC100335609 __SEG__ Chr15 {Bos taurus} METHNGTVLNEFILMGITNCPELQAPLFGLFLIIYVISVVGNLGMIILTKMDSKLQTFMYFFLRHLAFTDLGYSTTVGPKMLVNFIEDQNIISYYFCAMQLAFFLVFIVS
EIFILSAMSYDRYVAICNPLLYPVIMSQRVCWVLVAIPCVYSTFVSLLVTVKLFNLSFCGYRVISHFYCDSLPLLSLLCSNTHEVEMIILILAGFDLILSLLIVLVSYLL
ILVSILRMSSAEGRHKAFSTCGSHLTVIIVFYGTLLFMYVQPESSHSFDTDKVASIFYTLIIPMLNPLIYSLRNKDVKCALHRVWKKSCNLFY*
449 >lcl|XP_002706154.1|Plus1complement(53537..54472) NW_001502331 olfactory receptor Olr428-like LOC786664 __SEG__ Chr11 {Bos taurus} MEIKNYSSSTADFILLGMSSNPQMQKPLFAVFLVMYLITLVGNGLIILAIHSDSRLHTPMYFFLSNLSFMDICFTTVIVPNMLVNLLSETKFISYVGCLVQMYFFMALGN
TDSYLLASMAIDRLVAICNHFHYDVVMSPRRCLLLLLGSCTISHLHSMLRVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTTTNQIVVMTETLAVIATPFLCILFSYL
RIIITVLKIPSAARKWKAFSTCGSHLTVVVFFYGSVIYVYFRPLSMYSVVKDRVATLMYTIVTPMLNPFIYSLRNKDMKRGLRKLKDQVYS*
450 >lcl|XP_002706155.1|Plus1complement(67906..68829) NW_001502331 olfactory receptor, family 1, subfamily F, member 1-like LOC786689 __SEG__ Chr11 {Bos taurus} MKNYSSSISGFILLGISSNPQMQKPLFTVFLVMYLVTLVGNGLIILAIHSDSRLHTPMYFFLSNLSFTDICFTTVIVPNMLVNLLSETKFISYVGCLVQIYFFMALGNTD
SYLLASMAIDRLVAICNPFHYDVVMSPRRCLLLLLGSCTISHLHSMMYVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTTTNQMVVMTESLAVIATPFLCILFSYLRI
IITVLKIPSAAGKWKAFSTCGSHLTVVVFFYGSVIYVYFRPLSMYSVVKDRVATVMYTIVTPMLNPFIYSLRNKDIKRGLRKLRSRI*
451 >lcl|XP_002706181.1|Plus170653..71564 NW_001502368 olfactory receptor Olr753-like LOC781758 __SEG__ Chr10 {Bos taurus} MEEAKQSVVSEFIFRGLCDSRELQKFLFLPFSALYLMTVLGNLFVAFLTITDSHLHSPIYFLLANLSFVDFCFSSVTTPKLTTDFLKDNKTISFGGCMSQILCVHFFGGG
EMVLLVTMAYDRCVAICKPLHYSSIMNRQKCIWLVLTSWIIGFVHAASQLAMILDLPFCGPRIVDSFFCDIPKVIKLACTDTHTQRILINADSGVLATTCFILLLISYTY
ILVTVRLSSKDGTSKALSTCTSHITVVVLFFGPCIFTYLWPPSITWVDKFLAVFYTVITPLLNPAIYTLRNKEIKNAIKRLIS*
452 >lcl|XP_002706183.1|Plus1138046..138981 NW_001502368 olfactory receptor Olfr1279-like LOC100300401 __SEG__ Chr10 {Bos taurus} MGGLNDSMVNEFVLLALSCSWEKRLFLILLCSLLYLGVILGNLFIFFLVIFDSHLHSPMYFLLANLSLIDVGLSCTTVPKIITDLLNEDKIISFQSCMTQICFIHTIGGV
EMVLLIAMAFDRCTAICKPLHYLKIMNPKICVSFVITGWIIGVIHAMSQFLFVIKLPFCGPNEVDSFYCDFPKIIKLACTDGAKLEFIVTANSGFMSMGTFFLLILSYSF
ILVTVWKRSSGDLSKAFVTLSAHITVVFLFFTPCMFLYVWPSPPPSLDKNLFIVDFAITPVLNPAIYTLRNKDIKVSIKRLLKKIFYSRFC*
453 >lcl|XP_580287.3|Plus1273361..275817 NW_001495372 protocadherin beta 1 PCDHB1 __SEG__ Chr7 {Bos taurus} MATACRKLLQSRQVETLLLFLCLSVGGAATIRYSVAEEMESGSFVANVAKDLGLEVGKLAARGARLVSEGNKLHFRLHRKTGDLFVKEKLDRESLCGKADPCVLHFEVVL
VEPLQSFRVEVRVFDINDNAPVFLNKEPLLRIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANEYFHLHTRFRSNGPKYAELVLDKPLDREEQPEVNMTITAVDGGSP
PKSGTAHIRVEVLDVNDHVPQFSRLVYRAQVPENSANGSLVATVTATDLDEGSNKEITYSLAQNPEVILQTFQIHSETGEVRLRGPLDFEAIETYDIDIQATDGGGLSAH
SKVLVEVVDVNDNPPEVTVSSVSSPLPEDSPLQTVVALFSIRDRDIRVGGKITCFLKEDLPFAVKPTFRNSYSLVTDRGLDREAVSGYNITLVAMDTGPPTLSSETVIEV
LISDINDNPPVFQEDSYILTVRENNSPAVFIGKVLAEDLDLGENAKVTYSLLPPKSGDLSVFAYISINSDNGKLYALRTMDYEAIQHFQFVVKATDGGFLSLSSQVTVRV
VVLDDNDNRPMILYPLQNGTLPCNDLVPRSAEAGYLVTKVVAVDGDSGQNSWLSYHLFKATDLGLFSVQQQNGEIRTLRQVSERDPTMQKLVILVQDHGQPALSTTASLN
ILLVDGFSEPYLQFRDTFKHPTRVNPSTKYLVISLAVLSFLFLLSVTVIFIIHICQKIKHREKFTIQEHFYDDCNFSNNLVQGGASGPILQPCPYEMCSATGTSNSEFRF
LKRFMPNFPFPHGNGEAKTEADSRLPPDSDRNRSRGSEGHAQVSDDYM*
454 >lcl|XP_580318.4|Plus13917312..3918244 NW_001494955 olfactory receptor, family 2, subfamily A, member 1-like LOC504233 __SEG__ Chr4 {Bos taurus} MEKNQTMVTEFILLGFCLGPRIHLFPFGLFSLFYVLTLLGNGVILGLTSLDPRLHTPMYFFLSHLAIADMAYACSMVPQMLVNLLSPAKPISFAGCITQTFLFLSFAHTE
CLLLVVMSYDWCVAICHPLRYSVIVSCRVGISLVGTSWACGSLLALVHVGLVLRLPYCGPHEINYFFCEILSVLKLACADTKLNQLVIFAASVFVFVGPLCLLLGSYAHI
LAAILRIQSAEGCRKAFSTCASHLCMVGLFFGSAIIMSMAPKSLHPEKQQKNLFLFYSLLNPMMNLLIYSLRNKEVKGALRRALFKESHF*
455 >lcl|XP_580440.3|Plus1complement(630672..632576) NW_001494145 zinc finger and BTB domain containing 22-like ZBTB22 __SEG__ Chr23 {Bos taurus} MEPSPLSPSGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASASATTVTTAAATSVTVPGAGVPSGSGGTVAPATVSSVRSHASSRASENQSPSSSNYFSPRESTDFSS
SSQEAFAASAVGSGERRTGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYTPPSIVPQKHWVYVKRGGNCPASAPLAPQDPDLEEEEEEEDLV
LTCEDDEDEELGGGSGVPARGGPEATLSISDVRTLSEPPDKGEEQVNFCESSNDFGPYEGGGPGAGLDDSGGPTPSSYAPAHPPRPLLPLDMQGNQILIFPSSSSSSSSS
QPPGNQAEHGAVTLGGTLAGALGGPGGTGGTPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECSVCAKKFMW
RDSFMRHRGHCERRHHLGGGGGGGPGPGGGPSGPALQPKRESPCGGGGSGDEASGATPPSSRCVWSPLSVHKVEMGFSGGGGAN*
456 >lcl|XP_580442.4|Plus1complement(72277..73251) NW_001501761 olfactory receptor, family 7, subfamily G, member 1-like LOC504337 __SEG__ Chr7 {Bos taurus} MIYFIFYFIFFIRFINNMELRNKTGVSGFLLMEVTEDPKLQSLVFSLFLSMYLVTVLGNLLIILAINYDPHLHTPMYFFLSNLSFTDICLSTTTIPKMLMHIHTQNQSIS
YAGCLTQVCFVLVFASLDSYILSAMAYDRYVAICHPLRYAVIMNSRLCCLLILLSLFTSIVDALLHSLMLLQLSFCTDLEIPLFFCEVVQVIKLACSDTLINNILIYFAS
SILGGIPVCGIIFSYIQIVSSVLRIASVSGKYKAFSTCVSHLSIVSLFYGTAFGVYVSSAFSNSSRNTAVLSMMYTVVPQTMNPFIYSLRNRDVKGALRKLVSI*
457 >lcl|XP_580450.4|Plus1complement(353561..354499) NW_001492804 odorant receptor MOR10-like LOC504344 __SEG__ Chr10 {Bos taurus} MGAANHSMVSEFVFLGLSSSWEIQLLLFLFFSVFYMASLMGNLLIVFSVSADASLHSPMYFLLANLSFLDVGVCSIAAPKMIYDLFRKHKAISFGGCLTQIFFIHAIGGT
EMVLLIAMAFDRYVAICKPLHYLTIMNPRMCVLILAAAWVLGLIHSVAQLAFVVDLPFCGPNVLDSFYCDLPQLIKLACAETYRLEFMVTANSGLISVGSFFILIISYIF
ILVTVWKHSSGSVSKALSTLSAHVTVVVLFFGPLIFFYTWPFPSSHLDKFLAIFDAVLTPFLNPVIYTFRNKEMKAAMKKLCHQLVSYSKMS*
458 >lcl|XP_580501.4|Plus1complement(14510..15466) NW_001492804 olfactory receptor 1307-like LOC504388 __SEG__ Chr10 {Bos taurus} MDGANQSVVSEFVLLGLTNSWEIQLLLFVFSSTFYVASMMGNSLIILTVTCDPHLHSPMYFLLANLSFIDLGVSSVTSPKMIYDLFRKHRVISFRGCIAQIFFIHIVGGV
EMMLLIAMAFDRYVAICKPLHYLTIMNPRMCISLLVAAWIIGFLHSMVQLPFVVNLPFCGPNVLDSFYCDLPRLIKLACVDTYQLEFMVMANSGFISIGSIFILIISYIV
IILTVQKHSSGSSSKALPTLSAHITAVALFFGPLIFIYTWPFPSTHLDKFLAIFYAVLTPFLNPVIYTFRNQEMKVAMRRVCRQLVSYRKISVVMPVL*
459 >lcl|XP_580626.4|Plus1complement(2489471..2490418) NW_001494522 olfactory receptor, family 6, subfamily M, member 1-like LOC504490 __SEG__ Chr29 {Bos taurus} MDVQNQTTVTKFILTAFPTVQKLQISLFVVLLFTYMLTLTGNGVIISLIWADYRLQTPMYFFLSNLSLLDISYTSSVTPKLLSFLLKDRKTISLAGCISQTYFFFFLGTV
EFILLVVMSFDRYVAICKPLRYTIIMNSRACLLLVLGCWVGAFLSVLCPVILLSRLPFCHKEINHFFCDIAPLLQVACIDTHFLEMISFLLSSLILLTSLVLTTVSYTYI
ISTILSIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLQFDKVTAVFTIMVTPLLNPFIYSLRNKTAKDVLRDAVNKIISSLHRKP*
460 >lcl|XP_580632.4|Plus1338676..339623 NW_001493322 olfactory receptor 715-like LOC504498 __SEG__ Chr15 {Bos taurus} MRQTNQTQVTEFLLLGLSDDQHTQKLLFTLFLGVYLVTVLGNLLLMFLIQVDSQLHTPMYFFLCNLSLADLCFSTNIVPQALVHLLSRKKVISFTRCAAQLLLFLIFGCT
QCALLAVMSCDRYVAICNPLHYPSTMTWRVCIQLAVGSWTSGILVSAVDTTFTLRLPYQGSNNVAHFFCEAPSILILASTDTHTSEMAIFLMGVVILLIPVSLILVSYGH
IIVTVVRMRSAEGKLKAFSTCGSHLVVVILFYGSGIITYMTPKSYKEQKKLVSVFYAMVTPMLNPLIYSLRNKDVKGALRKVVIRNFPCRFGVFH*
461 >lcl|XP_580635.3|Plus1complement(24486..25427) NW_001503807 olfactory receptor, family 1, subfamily J, member 4-like LOC504501 __SEG__ Chr11 {Bos taurus} MTKENQSSMSEFLLLGLSIRPEQQGVFFALFLGMYLTTVLGNLLILLLIRLDSHLHSPMYFFLSHLALTDVSFSSVTVPKMLINMHTRDQSIPYAGCVTQMYFFIFFTDL
DNFLLSSMAYDRYVAICHPLHYGTVMRQGLCTLLVTASWILSCASALCHTLLLTRLSFCADLSIPHFFCDLGSLLKLSCSDTSLNELAIFTAGVAVIVLPLICILISYGC
ISAAILKVPSTRGICKALSTCGSHLSVVSLYYGTIIGLYFFPSSNTSRDKSTIASVMYTVVTPLLNPFIYSLRNRDMKGALERLLHGAKVLSQ*
462 >lcl|XP_580711.4|Plus1complement(222066..223001) NW_001501816 olfactory receptor, family 1, subfamily F, member 1-like LOC504567 __SEG__ Chr5 {Bos taurus} MTLGNHTIVTQFLLLGLSTDPHIQALLFVLFLEIYLLTLMGNLMMLLVIRADSHLHMPMFFFLSHLSLLDLCLSSVTVPKMLKDLLSETKTISLRGCLAQGFFVLITAGT
ECFLLSAMAYDRYAAICHPLLYGQMMKKQLCVQLVWGSWGLASLNAFINTLLAANLDFCENHTISHYSCEVPSLFPLSCSDVSINLIVLLCSSLMHGFGTLLPIVFSYAH
IVSTILSISSTSGRSKTFSTCSSHLTAVSFFFGSGFLRYLMPTSGSPLELIFSVQYGVVTPMVNPLIYSLRNKEVKAAVRRTLGKYMRWSR*
463 >lcl|XP_580771.2|Plus1complement(74870..75799) NW_001494524 olfactory receptor Olr1214-like isoform 1 LOC504623 __SEG__ Chr29 {Bos taurus} MAPGNESSVTEFILLGLTQQPGLQLPLFFIFLAVYVVTVVGNVGLIILIGLNPHLHTPMYYFLFNLSFIDLCNSSVITPKMLMSFVSQNIISYAECMTQLCFFSFFVIDE
CFILTSMAYDRYVAICKPLLYKVSMSHQVCLMLTVGVYAMGLVGAMAHTGCMLRLSFCDGNIINHYMCDIPPLLQLSCTSTSINELEIFIVVGVNVIVPSVTVSVSYTLI
LLNILRIRSAEGRSKAFSTCSSHIIAVSLFFGSATFMYLKPFPARSLDEDKVSTIFYTIVGPMVNPFIYSLRNKDVHVALRKTIRKRVF*
464 >lcl|XP_580772.3|Plus12543084..2544028 NW_001494522 olfactory receptor Olr1339-like LOC504624 __SEG__ Chr29 {Bos taurus} MTTANHSQVTGFVLLGFSQVWELRLFFFIVFSVVYLMTVTGNLLIVAVVTSDPRLHTTMYFLLGNLSFLDFCYSSIMAPRMLADLLSRKPVISFGGCLTQLFFFHFIGGI
KIFLLTVMVYDRYVAISQPLRYMLIMNRTVCGLLVAASWVGGFIHSIAQVGLTAQLPFCGPDKLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTA
LLVMLRSHSREGRSKALSTCASHIAVVTLIFVPCLYIYARPFRTFPMDKVVSVLYTMVTPMLNPAIYTLRNKEVIIAMKKLWRRQKDLLDPLEH*
465 >lcl|XP_580850.1|Plus12244347..2245288 NW_001494714 olfactory receptor MOR267-3-like LOC504688 __SEG__ Chr3 {Bos taurus} MPKPNSTSVAEFLFEGFSSFGWQHRLGFFVVFLTLYLLTLSGNAVILTIIRLDHHLYTPMYFFLSMLSISETCYTVAIIPCMLSGLLSPHQTISLQGCATQLFFYLTFGI
NNCFLLTAMGYDRYMAICNPLRYSVIMGKEACIQLATGSLGIGLSMAIVQVTSVFGLPFCDAFVISHFFCDVRPLLKLACTDTTVNEIINVFVSICVLVVPMGLVFISYV
LIISTILKIASPEGRKKAFATCASHLIVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTVITPLLNPVVYSLRNQDVKDALCRAVGRKPLSS*
466 >lcl|XP_580981.1|Plus1complement(841929..843686) NW_001494667 frizzled 5 FZD5 __SEG__ Chr2 {Bos taurus} MARPDPSAPPSLLLLLLAQLAGRAAAASKAPACQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCE
RAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPVKPTLSGLPGSPASGNDCAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAV
PCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASS
IWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKT
DKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDSGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGA
TAAGDYAEASAALTGRTGPPGPAAAYHKQVSLSHV*
467 >lcl|XP_581039.4|Plus1complement(433658..434602) NW_001493327 olfactory receptor 78-like LOC504857 __SEG__ Chr15 {Bos taurus} MMTLNHTGVSHTVFRLLGIPGLEDQHIWISIPFFISYAIALFGNSLVICIIFTKRSLHEPMYLFLCMLAGADIVLSTCTVPQALAIFWFHAGEISLDRCITQFFITHSTF
MSESGILLVMAFDRYIAICFPLRYSTILTHTLIGKIGVTIFLRSYCTISPIVFLLKRLNFCQNNIIPHTFCEHIGLAKYACNDIRVNIWYGLFVLMSTVVLDALLIFISY
VLILHAVFHMSSQDARHKALNTCGSHVCIIILFYGPAIFTILTQRFGHHIPPHIHILLANVCVLAPPMLNPIIYGIKTKQIREQVAHIFFPKQK*
468 >lcl|XP_581070.2|Plus12288194..2289264 NW_001494714 olfactory receptor 1403-like LOC538552 __SEG__ Chr3 {Bos taurus} MKTENYTGVREFIFQGFTSFHEHKLTLFVVFLTLYLLTLSGNVIIVTIISIDRHLHTPMYFFLTALSTSETLYTLVIVPRMLSSLVGLSQPISLAGCATQMFFFITLAIN
NCFLLTAMGYDRYVAICNPLRYMIIMNKRVCAQLVWGACSIGLFVATIQISSVFRLPFCYRKVAHYFCDIRPVMKLSCANTTIHDIINFLISSLVIVVPMVLVFISYVLI
ISTILKIASAEGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENMRDQDQLISVTYTVSTPLLNPVVYTLRNKEVKDALCRAIGKNLLLRIFGSLIYSLSYSGYFCNHT
HTKLILSFFLYLDRVAQFGGKPKLKN*
469 >lcl|XP_581080.3|Plus1complement(101246..102175) NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC504888 __SEG__ Chr7 {Bos taurus} MEPQNDTRISEFFLLGFSDAPALQPLIFGLFLSMYLISVFGNLLIILAVNSDSHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTQSKVITYEGCITQMYFFVLFAVL
DDLLLTVMAYDRFVAICHPLHYTVIMNPWLCGVLVLVSWIMGVLNSLLQSLIVLDLTFCEDLEIPQFFCELNQVIQLACSDTFLNNMMIYFTSLLLAIGPLAGILYSYYK
IISSIYRIASTQEKYKAFSTCASHLLVVSLFYCTSLGVYLGSAGTHSSHSSATASVMYTVVTPMLNPFVYSLRNKDIKRALKAFIGQQL*
470 >lcl|XP_581184.3|Plus1complement(1062692..1064644) NW_001493664 reticulon 4 receptor-like GP1BA __SEG__ Chr19 {Bos taurus} MPLLLLLLLLPSPSHPVPICEVGNKDSQVEVNCENKGLKAPPPDLPADTAILHLGENPLGTFSMASVLNLSQLTELFLGKSQLTSLQADAKLPRLEVLNLAHNKLRSLPK
LGRALPVLSILDVSFNELTSLPSDTLHGLSRLQELYLRGNQLRTLPPELLVPTPHLKKLSLAENDLQELPPELLKGLEELDTLYLQKNRLRTIPTDFFGMLLLPYAFFHN
NSWSCDCGILYFSRWLQDNPSNVYVWEEDVDIKAMTPDVKSVRCVNMNGMYVYNFLGDSCNIPGDRDNLDYDEYEDKDEQEVPVVNTVSSLSSHTTHWDLLYLTSPTSPG
SQVSSLPPVKKLTTTPITIDSITSSKTLNPTTEPPTTPTTPESTTPTTPEPTIPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPTTPTTPEPITPTTPEPTTP
TTPEPTTPTTPEPTTPTTPEPTTPTTLEPTTPTTPEPISETLQPTIFLTSTESISLPTILESTITIISESDNPWKVQGLASSSNNPVLSSDSCCLFLGFYILGLLWLLVA
SVILILLLCWVQQVKPWALATATHTAHLELQRGRQVMVHRAWLLFFQGLLPTFRSSLFLWVRPNGRMGPLQAGRRPSALSLGRGGDLLGTVGVRYSGHSL*
471 >lcl|XP_581211.1|Plus1285077..286171 NW_001494657 growth differentiation factor 3 LOC504995 __SEG__ Chr2 {Bos taurus} MLPSLAALALCLLFTLAFGQTLQFHEHVFLRFLGLDKVPSPKKFQPVPSILKRIFQAQEEAASTGISKDLCYVKELGVRGNILRLLPDQGSFLYSESLSHASCLQKLLSF
NLSAIGDEEQLTMAQLGLDLGPNTYYNLGPELELSLSLVQTEPHVIDQATPKMGKMFTLQSVPWPQGVLHFNLLDVAKRNNDPHKNLGLFLEIVVKGGRALGENFQLEGT
CARLRRSLHTSLLVVTLHPEQCRSPSRKRRAAVSTSKASCKSLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHSVDPEVPQAVCI
PTKLSPISMLYQDNDDNVILRHYEDMIVDECGCG*
472 >lcl|XP_581219.1|Plus1247153..248178 NW_001495589 trace amine associated receptor 8 LOC505001 __SEG__ Chr9 {Bos taurus} MTSNLSQPDTVQFCYENVNRSCIKSSYSPASRVILYTVFGFGSLLAIFGNFLVMMSVLHFKQLHSPANFLIASLACADFLVGVTVMPFSMVRSVESCWYFGARFCALHSS
CDVAFCYSSLFHLCFISIDRYVAVTDPLVYPTKFTVSVSGVCISISWILPIVYSGAVFYTGVSDDGMEELVSALNCVGGCQIVINQGWVLISVLIFFIPSLIMVILYGKI
FIVAKQQALKIENTGSKAESQSYKSRVAKRERKAAKTLGVTVVAFMISWLPYTIDILIDAFMGFITPAYIYEICCWGAYYNSAMNPLIYALFYPWFRKAMKVILTGGLLN
GSSSNISLFLE*
473 >lcl|XP_581407.3|Plus13642865..3643797 NW_001494955 olfactory receptor Olr816-like isoform 1 LOC505161 __SEG__ Chr4 {Bos taurus} MGGNQTWITEVTLLGFQVDSALEFFLFGLFSLFYTLTLLGNGVILGLICLDSRLHTPMYFFLSHLAIIDISYASNNVPKMLANLVSQKRTISFVPCIMQTFLYLAFAHTE
CLILVVMSYDRYVAICHPLHYVITMSWRVCTVLAITSWVLSFLLALVHLVLFLRLPFCGPHEINHFFCEILSVLKLACADTWLNQVVIFLACVFILLGPLCLVLGSYVRI
LAAILRIQSPEGRRKAFSTCSSHLCVVGLFFGSAIIMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRSKEVKAAFRRVLWKDRLM*
474 >lcl|XP_581441.1|Plus1complement(2568636..2569586) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC505191 __SEG__ Chr19 {Bos taurus} MKMGNQTVFSDFLLLGLPIRPDQQDLFYTLFLAMYVTTVLGNLLILVLICLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQDMQSHIPSISYAGCLTQMYFFLLFADL
ESFLLVAMAYDRYVAICFPLHYTAIMSPRLCLSLLVLSWVLTICISLLHTVLMARLSFCADNVIPHFFCDMSALLKLACSDIQINEMVIFILGGLVIIVPFLLIFSSYAR
IVSSILKVRSARGIHKAFSTCGSHLSVVSLFYGTIIGLYLCPSSNNSTVKETVMAVMYTVVTPMLNPFIYSLRNQDIKGALRRVFSKWTISFFFNQ*
475 >lcl|XP_581462.4|Plus12821395..2822339 NW_001494714 Olfactory receptor 420-like LOC505209 __SEG__ Chr3 {Bos taurus} MENANQTTAHEFVFSAFPYSWRDSVICFVLLLFIYAFIVVGNVVIITVVQLNIHLHTPMYFFISALSFLEIWYTTATIPKMLSCLLCEKSISLNGCLLQMYFFHSTGISE
VCLLTAMAFDRYLAICSPLHYPTIMTPKLCAWLTLGCCVCGFATPLPEIAWISTLPFCGSNHLEHIFCDFLPVLRLACTDTQAILMIQVVDVVHAVEIITAVMLIFMSYI
GIVAVILRIRSTEGRRKAFSTCISHLTVFLLFFGSVALMYLRFSATYSLFWDTAITLAFAVVSPFFNPIIYSLRNKEIKEAIKKHMSQANIFFS*
476 >lcl|XP_581506.3|Plus1complement(203080..204018) NW_001501816 hCG2044662-like LOC505250 __SEG__ Chr5 {Bos taurus} MDLRNHSTVTEFILLGLSANPHTQALLFVLFLGIYLLTIMGNLMMLLVIKADSHLHTPMYFFLSHLSFVDICFSSVTVPKMLENLLSRRKTISVEGCLAQVFFVFVAAGT
EACLLSVMAYDRYAAICHPLLYGQIMSKKLYIQLVWGSWGLGFLDALINIFLAVNMIFCEAKIIPHYSCEMPSLLSLSCSDISRNLIALLCSTLLHGLGTFLLVSLSYAH
IITTILSISSTSGRSKAFSTCSSHLTAVTLYFGSGLLRHLMPNSGSPAELIFSVQYTVITPMLNPLIYSLKNKEVKVALKRTLEKYLQHIRC*
477 >lcl|XP_581738.4|Plus139734..40669 NW_001492989 olfactory receptor, family 1, subfamily E, member 2-like LOC505451 __SEG__ Chr11 {Bos taurus} MGRENQSSMSEFLLLGLPIQPEQKGVFFALFLGVYLATVLGNLLILLVIRLDPHLHTPMYFFLSHLAFIDITFSSVTTPKMLMNMQTQSQSISYAGCISQVYFFLMLGCL
DSFLLTSMAYDRYVAICHPLHYITIMSQSLCFLLVIVSWVLSSASAILHTLLLAHLSFCGDNLLPHFFCDLATLLKLSTSDTTVNELFILTVGVVVITLPFACILVSYGC
IGATILRVPSTKGLYKALSTCGSHLSVVALYYGTIIGLYFFPSSNNSNDKDVIVAILYTLITPMLNPFIYSLRNQDMKGALGNILSRGRFS*
478 >lcl|XP_581741.1|Plus13600770..3601702 NW_001494955 olfactory receptor, family 2, subfamily A, member 12-like LOC505454 __SEG__ Chr4 {Bos taurus} MGSNQTWISEVILLGFQIDPELEVFLFGLLLLFYSLTLLGNGVILGLICLDSRLHTPMYFFLSHLAIVDMAYASSTVPKMLANLILQKKTISFAPCILQTFLYLAFAVTE
CLSLVVMSYDRYVAICHPLYYSVIMSWRVCTVLAATCWIFSFLLALVHISLILRLPFCGAQKINHFFCQIISVFKLACANTRLNQIVLFVGSVFVLVGPLCLVLGSYARI
LAAILRIQSAEGRRKAFSTCSSHLCVVGLFFGTAIVMYLAPKSSHSQEQRKILSLFYSLFNPMLNPLIYSLRNAEVKGALRRFLEKKRSL*
479 >lcl|XP_581772.4|Plus1complement(268484..269428) NW_001493371 olfactory receptor, family 5, subfamily B, member 3-like LOC505481 __SEG__ Chr15 {Bos taurus} MENTTEVTQFILLGLTSTKNLQVPLFIIFILIYLVNVVGNVGIILLVLLDSHLHTPMYFFLSNLSLVDFGYSTAVIPTVLAGFLKGRGVISYNVCAAQMFFFAAFATMEN
FLLAAMAYDRYAAVCTPLRYTATMTTSVCAGLSTGPGVCGFLNASIHVGITFSLSFCGPNVIHHFFCDVPAVMVLSCSDSYVGEMVLVYVASFNIFFALLVILISYIFIF
ITILKMHSSAGYQKALSTCASHLTAVSIFYSTVITMYLQPSSSHSMDTDKIASVFYTMIIPMLNPLVYSLRNKEVKSAFKKMIEKARLSLRLSF*
480 >lcl|XP_581783.1|Plus1complement(1273231..1274181) NW_001495047 olfactory receptor, family 10, subfamily A, member 7-like LOC505491 __SEG__ Chr5 {Bos taurus} MICENHTQVTEFILHGFTNKPEMQHSLFVLFLVIYTVTLLGNFLIVTVTIVDPALQTPMYFFLRNLSLLEICFTLVMVPKMLVDLVSPRKSISFVGCGTQMYFFFFFGSS
ECFLLSMMAYDRFVAICNPLRYSVIMNRSLCLWMAVGSWLSGVPVSMLQTAWLMAHPFCGPSTIDHFFCDGPPVLKLVTEDTTIYEMQALASTLLFIMFPFSLILVSYTR
IIKTILMMPSATGRQKAFSTCSSHLIVVSLFYGTASLTYLRPKSKQSPESKKLVSLSYTVITPMLNPIIYSLRNNEVKGAVKRTFTRKVLQKLGVL*
481 >lcl|XP_582020.4|Plus1complement(224373..225341) NW_001493371 olfactory receptor 480-like LOC505692 __SEG__ Chr15 {Bos taurus} MENLSEVTEFLLVGLTDALEMQVPLFTIFALIYLTTLVGNLGMIVLILLDSRLHTPMYFFLGNLSLVDCVYASSVTPKVMAGILTGDKIISYDACATQMFFFAAFATVES
FLLASMAFDHQAAMCKPLHYTTTVTRAVCALLATSSYVCGLLQSSVHVALTFHLSFCHSNVVNHFFCDIPPLLALSCSDIYTNEIVLFTLAAFNTLFALLVILGSYLFIF
TAILRMRSSEGRQKAFSTCASHLTTVSIFYGAIIFMYLQPSSSHSMGTDKMASVFYAMVIPMLNPLVYSLRNKEVKSAFKRVVGKAVFSRLSLLIRNRMQTM*
482 >lcl|XP_582253.1|Plus11376294..1377427 NW_001494477 pancreatic polypeptide receptor 1-like PPYR1 __SEG__ Chr28 {Bos taurus} MNTSHFLALLFLGSPQGQNRSKSASLYAPYNFSDHCQDSVDPLVFIVTSYSIETIVGVLGNLCLICVTIRQKEKANVTNLLIANLAFSDFLMCLICQPLTAIYTIMDYWV
FGEVLCKISTFIQCMSVTVSILSLVLVALERHQLITNPTGWKPSVTQAYLGIVVIWLIACFLSLPFLANSILENVFHKNHSKAVEFLADKVVCTESWPLDHHRIIYTTFL
LLFQYCIPLAFILVCYVRIYQRLRNQRQVFHKGTCSSRAWQMKRINGILVAMVAAFAVLWLPLHVFNSLEDWYHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTN
FKKEIKALVLTCQQSVPVEESEHLPLSTVHTEVSKGSLRLSGRSNPI*
483 >lcl|XP_582381.2|Plus1214814..215890 NW_001493848 G protein-coupled receptor 15 GPR15 __SEG__ Chr1 {Bos taurus} MDPEATTVYLEYLFVTSHNPDIEETHSHVPYTSVFLPVFYTAVFLIGVSGNLILMSALHFKRGSRRLIDIFIINLAASDFIFVITLPLWVDKEASLGLWRTGSFLCKGSS
YVISVNMHCNVFLLTCMSVDRYLAIVCPAVSRKVRRRDCAYAVCASVWFVSCLLGLPTLLSRELTLIDGKPYCAEERATPVKLTWALVALIFTFFAPLVSIVSCYCCITR
KLCVHYQQSGKHNKKLRKSMKIIFIVVAAFVLSWLPFNTFKLLAIVSGLQQELYLSSAFLQRGMEVCGPLAFANSCVNPFIYYIFDGYIRRAIVRCLCPCLKNYDFGSST
ETSDLTKALSNFIHAEDFARKRKRSVSL*
484 >lcl|XP_582390.3|Plus1complement(583963..584895) NW_001501922 olfactory receptor 480-like LOC538744 __SEG__ Chr15 {Bos taurus} MKFGNHTSVTEFILLGLTEDPTLCGIFFVVFLGIYAVTLVGNISIIILIRICSQLHTPMYLFLSHLAFVDSGCTTSVTPMMLIGFLRQGVTITASGCEAQLCFVVMFGSA
ECFLLAAMAYDRYVAICLPLFYSTHMSPRVCALLIGVSYLGGCVNAWTFTSCLLTLSFCGPNHINDFFCDFSPLLKLSCSDVSIIEIIPSISSGSILAFTVSIIALSYIC
ILNTILKMRSTEGRHKAFSTCTSHLTAVTLYYGTITFIYVMPKSTYSTDQNKVLSVFYTVVIPMLNPLIYSLRNRDVKEALRKVSVRIYS*
485 >lcl|XP_582424.5|Plus1complement(1756404..1757339) NW_001495357 olfactory receptor, family 5, subfamily I, member 1-like LOC506034 __SEG__ Chr7 {Bos taurus} MEKWNQTSNDFILLGLFLPNQTGWLLLLLIILIFFLASVGNSAMIYLICLDPRLHTPMYFLLSQLSLMDLMYLSTTVPKMVFNFLSGQKGISYLGCGVQSFFFLTMACSE
GLLLASMAYDRYVAICHPLYYCICMSKRMCMKMIMGSWILGSLNSLAHTVYALHIPYCQSRAIDHFFCDVPAMLPLACMDTWVYEYMVFVSTSLFLLLPFLGITASYGRV
LFAVYHMRSKDGRKKAFTTCSTHLTVVTFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAMTRMFGKFSFTK*
486 >lcl|XP_582523.4|Plus1236333..237283 NW_001493367 olfactory receptor 1264-like LOC506121 __SEG__ Chr15 {Bos taurus} MARTDNVTELIVTGLSQDPEVQRGCFAVFLPMYLATVVGNGLIVLTVRVSKSLRSPMYFFLSHLSLVEISYSSTIVPKFITDLLVKIKTISLKGCLAQIFFSHFLGVTEI
FLLVVMAYDHYVAICKPLHYMNIMSHRLCHALVASSWLGGFFHSIIQILITIQLPFCGPNVIDHYFCDLHPLFKLACTDTSVEGVVVLANSGLISVFSFLLLVSSYIVIL
VNLRNHSADGRRKALSTCASHVTVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKLAMRRLWGKKKNSGMERKWESDL*
487 >lcl|XP_582650.2|Plus1complement(1311393..1312904) NW_001508693 G protein-coupled receptor 101 GPR101 __SEG__ ChrX {Bos taurus} MASTCTNSTRENNSSHACMPLSKMPISLAHGIIRSSVLLIFLTASFVGNIVLAFVLQRKPQLLQVTNRFIFNLLVTDLLQISLVAPWVVATSVPIFWPLNSHFCTALVSL
THLFAFASVNTIVVVSVDRYLSIIHPLSYPAKMTPRRGYLLLYGTWIVAILQSTPPLYGWGQAAFDERNALCSMIWGASPSYTIVSVVSFIVIPLIVMIACYSVVFGAAR
RQHALLYNVKSHSLEVRAKDRVENENEEGGKKDEFQSESEFHGQDEGEVKAKVDSEEAMEGSKKAKKGSVETGEGSMEATGSEEVRESNSLVAKGSTKIQSSRKADKGRL
EVTQCNIDLGEDDLEFGEDDLHFNEDDIEAVNIPESLPVSRRNSNGDPPLPRCYQCKAAKVIFLIIFSYVLSLGPYCFLAVLAVWVDVQTKVPQWVITIIIWLFFLQCCI
HPYVYGYMHKTIKKEIQDMLKKFFCKEKPPKENSHPDLPGTEAGTEGGTEGKIVPSHDSATSP*
488 >lcl|XP_582747.3|Plus1complement(2500076..2501023) NW_001494522 olfactory receptor, family 6, subfamily M, member 1-like LOC506317 __SEG__ Chr29 {Bos taurus} MDVQNQTTVTEFILTAFPALQKLQIFLFMILLFTYLLTLTGNGVIISLIWADNRLQTPMYFFLSNLAFLDILYTTSVTPKLLACLLENRKIISFAGCISQTYFFFFLGTV
EFILLVVMSFDRYVAICNPLHYTTIMNSRVCLLLVLGCWVGAFLSVLCPTIVVSRLPFCHKEINHFFCDIAPLLQVACIDTHFIEMINFLLSSLILLTSLVLTTMSYTYI
ISTILRIPSAQGRQKAFSTCTSHITVVSIAYGSNIFMYVRPSQSHSLQFDKVTAVLTTMMIPLLNPFIYSLRNEKVKEVLRDAINKIMSLLPRKA*
489 >lcl|XP_582900.4|Plus1complement(553566..554510) NW_001493327 olfactory receptor MOR31-4-like LOC506452 __SEG__ Chr15 {Bos taurus} MTVFNHTGVSHTVFYFVGIPGLEDQHVWISIPFFISYVIALLGNSLLIFIILTKRSLHEPMYLFLCMLSGADLVLSTCTIPQALAIFWFNAREISLDRCITQLFFIHSTF
ISESGILLVMAFDRYIAICYPLRYTTILTHTLIGKIGVTIFLRSYGTMFPIIFLLKRLTFCKSNIFPTTVCEHIAVAKFSCDDIRVNFWYGFFVLLSTVTLDVVLIFVSY
MLILCAVFRIPSPDARHKTLNTCGSHVCVIILFYGPGIFSAFTPRFARHILPHVHVLLANVCILAPTMLNPIIYGIKTKQIQDQVSQVLCQKKI*
490 >lcl|XP_582936.1|Plus1complement(291720..292673) NW_001494175 putative olfactory receptor-like protein-like LOC506486 __SEG__ Chr23 {Bos taurus} MVNHSFPVDFLLLGFSEHPGLERILFMVVSISYLLTLVGNTLIILLSMLDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPRKTISFLGCSVQLFIFLFLGTTEC
VLLTVMAFDRYVAVCQPLHYATIIHPRLCWQLAAMAWVIGLVESVVQTPPTLRLPFCHHRRVDDFVCEVPALIHLSCGDTTYSDIQMAVASVFILVVPLSLILVSYGAIA
QAVLRINSAVAWRKALGTCSSHLIVVTLFYSSGIAVYLQPKNPYAQKRGKFFGLFYAVGTPLLNPLIYTLRNKEVKSALRRLLGKAVDSRESQGNAA*
491 >lcl|XP_583109.4|Plus192121..93056 NW_001492989 olfactory receptor 414-like LOC506633 __SEG__ Chr11 {Bos taurus} MENQTSISEFFLRGIPGSPEQQQLFFGIFLCMYLVTLMGNVLIILAISSDPHLHTPKYFFLANLSYVDMGLTSSTVTKMLVNIQTQLHTISYVGCLTQMYFFLMFGDLDS
FFLAVMAYDRYVAICRPLHYCTVMSLRVCSLLLALCWILTHIVALTHTLLMARLSFCVVGEIAHFFCDIIPVLKLSCSDTRINELMVFALGGTVLMVPFICIVISYIHIV
SAVLRVRTPGGGSKAFSTCSSHLCVVCVFYGTLFSAYLCPPSIASEDKDIAAAAVYTLVTPMLNPFIYSLRNKDMKVALKRLLSHRRITAS*
492 >lcl|XP_583123.1|Plus1complement(394856..395767) NW_001494907 G protein-coupled receptor 141 GPR141 __SEG__ Chr4 {Bos taurus} MAAHNSSSCDDPILTPHLTRLYFVVLIGGLLGIISILFLLVKMNTRSVTTTAVINLVVVHSVFLLTVPFRLTYLIKHTWTFGLSFCKFVSAMLHIHMYLTFLFYMVILVI
RYLIFFKHKDKVEFYRKLHAVAASTAMWLLVIVIVVPLVVSQYGIHEGYDSHHCFKFHKELTHAYVQAINYLIVAVVIIIAVILLVLQITIIVLMARKLGHSLLSHQEFW
AQVKNLLFIGVILICFLPYQCFRIYYLYTVAHSRDCNYNVAFYNEIFLSVTAISCFDLLLFVFGGSHWFRQKIIDLWNCLLCR*
493 >lcl|XP_583133.4|Plus1complement(120444..121388) NW_001501889 olfactory receptor, family 5, subfamily B, member 12-like LOC506652 __SEG__ Chr15 {Bos taurus} MENTTEVTEFLLVGLSDDPQVQILLFITFSLIYLLTLVGNLGMTELILLDSRLHTPMYFFLSQLSLVDFGYSSAVTPKVMAGFLTGDKTISYEACVTQFFFFVAFITVES
FLLAAMAYDRYAAVCKPLHYTTAMTTKACARLLVGCYFCGFLNASVHNGNVFRLSFCRANVVNHFFCDAPPLLALSCSDNYVSEMVIFFVVGFNDFFSILVIFISYLFIF
ITILRMRSSEGRQKAFSTCASHLTAVSIFYGTGIFMYLQPSSSHSMSADKMASVFCAMVIPMLNPLVYSLRNKEVKSAFKTAVGKAKSSIGFVF*
494 >lcl|XP_583174.3|Plus1518129..519070 NW_001493368 olfactory receptor 480-like LOC538839 __SEG__ Chr15 {Bos taurus} MEQNNGTEVIEFILLGFAGQHKYWHVLFTAFLVIYVATLVGNIGMILLIKVDSSLHTPMYFFLQNLAFVDLCYKSAITPKMLRNLVGTEQSISFMGCVVQLLVYGAFITS
DCYILAAMAVDRYVAICHPLHYPTVMSRRVCIHLLVGSYFMGFLNASVNVGFTFSLNFCKSNKINHFFCDVPPILALSCSNIYFNVMVLAASVGSNLTLTVSVVIFSYMF
ILAAILKISSAAGRKKAFSTCASHLTAVTIFYGTLSYMYLHHHATESQEKEKMASVFYGVVIPMLNPLIYSLKNQDVKEALKGIRKKCFRFNP*
495 >lcl|XP_583364.4|Plus1complement(446188..447132) NW_001493369 olfactory receptor, family 5, subfamily I, member 1-like LOC538864 __SEG__ Chr15 {Bos taurus} MDFLDGNCTLVTEFILLGFPTRPELQIVLFLLFLTLYSLILMGNIGLMMLIRVDLHLQTPMYFFLSNLSFVDLCYSSVIVPKMLVNFLSQNKSISYYGCALQFYFFCTFA
DTESFILAAMAYDRYVAICNPLLYTAVMSRGICIWLIVLSYFGGNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTSLNEWLLSTYGSSVEIICFIVIIISY
FYILLSVLKIRSSSGRKKTFSTCVSHLTSVAIYQGTLLFVYSRPSYLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVKDAAKKVLKPKINSS*
496 >lcl|XP_583403.4|Plus1222916..223854 NW_001501890 olfactory receptor, family 9, subfamily G, member 4-like LOC506891 __SEG__ Chr15 {Bos taurus} MDVGNRTILTEFILLGLSTDPQWQLILFGVFLTVYLVTLSGNMTLVILIHIDSHLHTPMYFFIGNLSFLDFWYTSVYTPRILATCISEDKRFSLAECGAQLFFSCVVAYT
ECYLLAAMAYDRHMAICNPLLYSSSMSHSVCSRLVAGSYIGGFSNAIAHTANTFRLSFCGKNIIDHFFCDAPPLVKMSCTDTKVYEQVLLGLVGFTVLSSILVIIISYFH
ILLAILRIRTASGRHKAFSTCASHLVSVMLFYGSLLFMYSRPSSTYSLKRDKVAALFYTVVNPLLNPLIYSLRNKDVKEAFWKAAKTIRPQR*
497 >lcl|XP_583529.3|Plus1complement(95013..95945) NW_001501816 olfactory receptor 281-like LOC506992 __SEG__ Chr5 {Bos taurus} MALRNHSTITEFILTGLSDDPHIQALLFVLFLVIYLLTVMGNLTMLLVIRADSHLHTPMYFFLSNLSFLDLCFSCVTLLLKDLLSEKKTISIEGCLAQVFFVFITPGTEV
CLLSAMAYDRYAAVCHPLLYSQVMSNQLCVRLVLISWGLASLDAVIIVLLAVNLDFCEAQTIHHYTSELPSLFPLSCSDTSINISILICSILLHGFGTFLPIIFSYAHIV
STILSISSITGRSKAFSTCSSHLIAVILFFGSGMLRYLMPSSGSFLDLLSSLQYSVITPMLNPLIYSFKNKEVKGAVKRTLGKYLHYCTG*
498 >lcl|XP_583566.2|Plus1complement(691642..692613) NW_001493332 olfactory receptor 521-like LOC507022 __SEG__ Chr15 {Bos taurus} METIACNESEESWTIFYLMGIPSLPKSLFLPIFFIFLLLYLLILVGNALILVAVVIEPSLHKPMYFFLINLSALDILFTTTTVPKMLSLFLHGDRYLSFSACFLQMYLFH
SFSCSEAFILVVMAYDRYVAICRPLHYPVLMTPQTNAALAASAWLTALLLPIPAVVQTSHLAFDSTVYIYHCFCDHLAVVQASCSDASPQTLMGFCIAMVVSFLPLLLVL
LSYAHILASVLHIGSREGRSKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIVGNVVYAILTPVLNPLIYTLRNKDVKTAITKVTHLKTQAGIGALDL*
499 >lcl|XP_583573.3|Plus1complement(726379..727308) NW_001493314 olfactory receptor 78-like LOC507029 __SEG__ Chr15 {Bos taurus} MPSINDTQFHPPFFLLLGIPGLETVHIWIAFPFCVVYLIALVGNITVLYVIKTEHSLHQPMFYFLAMLSMIDLGLSTSTIPKMLGIFWFNLKEISFGGCLAQMFFIHMFT
GMETVLLVAMAYDRFVAICNPLQYTTILTSKTIGILASVVVGRNLLLVTPFVFLILRLPFCGHHIVPHTYCEHMGLARLACASIKINVIYGLMVISNIIVDVILIASSYV
LILQAVFHLPCQDARLKALNTCGSHVCVMLCFYTPAFFSFMTHRFGRNIPHYIHILLANLYVVVPPALNPVIYGVRTKQIRERVVKIFI*
500 >lcl|XP_583799.1|Plus1complement(2506824..2507768) NW_001494955 olfactory receptor 49-like LOC507229 __SEG__ Chr4 {Bos taurus} MMSNHSSVTEFYLLGFSGSQELHHVLFAVFFLFYSVTIIGNMVIIVIVCVDKRLQSPMYFFLGHLSALEIMITSLIVPAMLWGLLLPGMQTISLTACVSQLFLYLALGTT
EFALVGAMAVDRYMAVCNPLRYNTIMNSHTCISVVTGSWVFGFLSEIWPVYATFQFTFCKSNVLDHFFCDRGQLLKLSCDDTLFTEFVLFLMAVFIIIGSLAPTIVSYTY
IISTILKIPTASGRRKAFSTCASHFTFVVIGYGSCLFLYMKPKQTQAAEYNKIVSLLISVLTPLLNPFIFTLRNDKVKEALRDGVKRGCQLLKG*
501 >lcl|XP_583812.2|Plus160487..61431 NW_001502744 olfactory receptor, family 1, subfamily F, member 1-like LOC538941 __SEG__ Chr25 {Bos taurus} MVEANQSRVSEFLLLGLSRQPQQQQQLLFLLFLTMYLATVLGNLLILLAISMDSHLHIPMYFFLCNLSFVDTYFSSTTVPKVLANHVLRSHTISFSECLTQMYFVFMFMD
MDNFLLAVIAYDRFVAVCHPLHYSAKMTPQLCALLVTGSWVTASLDMLLHTLLMARLSFCADNAIPHFFCDVTPLLKLSCSDTHLNEVVILTEGALIMITPFVCILVSYV
LITCAVLRIPSTKGRWKAFSTCGSHLAVVFLFYGTIIFLYFNPLSSHAAETDVAAGVMFSVVTPMLNPFIYSLRNQDIKGALGKVIAMKFFSAQ*
502 >lcl|XP_583823.5|Plus1complement(489143..490108) NW_001494547 MAS proto-oncogene-like LOC507247 __SEG__ Chr29 {Bos taurus} MENTLNSSGSRSSSPGPTPAPPDTVREVLDALVVFTCVGGIVGNGLVVWLLGFQRRRGPLGIYLLHLAVADLLFLLCSAMLTVLSTSSWGIHMHRLGPRAVRSAGYLAYT
VSLSLLTAASAQSCLPGLFPTWYRGRWHRRLSAAVCAVFWLLAVLLIVPAWYFHDEAEHPHSWLGSKAETVLHFFTLVSFTPIMALSGMALCIQVQRSSPPWQRPLTRLY
VAVLLCVFVFFACALPLGISGFLLYWLDLPQSAKTLFGHFTCFSLSVSSSTKPMIYFLVGSGGRLSLREPLGAVLSRVLQEEPELEEREMPSTDPSDEVRV*
503 >lcl|XP_583839.1|Plus1complement(43960..44904) NW_001502331 olfactory receptor, family 1, subfamily F, member 1-like LOC538946 __SEG__ Chr11 {Bos taurus} MDNTTRTSVSHFVLLGISPHQEEQIPLCLLFLFMYTINISGNSVIIILIISAPRLQTPMYVFLSNLALADICFTSTTVPKMLQNIFSSTKAISYMGCLTQTYFFICFAAM
ENFLLAVMAYDRYIAICHPFHYCMILNRKLCSHLVVMCHILSHLHALLHTFLVSRLIFCADNRIPHFFCDLYPLMKISCSSTHLNTLMIHTEGVIVISGALAIIMASYAC
IISAVLQSPSAKGKWRAFSTCGSHLTVVAIFYGTLTWVYFRPLTSYSVPGGRILTVMYTVVTPMLNPFIYSLRNKDVKGAFRKWMNRIWTSSFR*
504 >lcl|XP_583841.3|Plus1complement(310645..311583) NW_001494175 putative olfactory receptor-like protein-like LOC538947 __SEG__ Chr23 {Bos taurus} MVNHSFPVDFLLLGFSEHPGLERILFMVVSISYLLTLVGNTLIILLSMLDPRLHSPMYFFLSNLSFLDLCFTTSCVPQMLVHLWGPRKTISFLGCSVQLFIFLFLGTTEC
VLLTVMAFDRYVAVCQPLHYATIIHPRLCWQLAAVAWVMGLVQSVVQTPPTLRLPFCPHRQIDDFACEVPSLIQLSCGDTTYNEIQLAVSSFIFLVMPLTLILISYGSIA
WAVLRINSAIAWRKALGTCSSHLIVITLFYSLVIAVYLQPKNPYAQKRGKFFGLFYAVGTPLLNPLIYSLRNKEVKGALRRLLGKDKDSREN*
505 >lcl|XP_583849.4|Plus1complement(704839..705780) NW_001494525 hypothetical protein LOC507269 __SEG__ Chr29 {Bos taurus} MAAENSSVTEFILAGLTDQPGLQILLFLLFLGFYVVTVVGNLGLIMLIGLNSRLHTPMYFFLFNLSLIDFCYSTTITPKMLVSFVSKKNSILHAGCLTQLFFFCFFVISE
SLVLSAMAYDRYVAICKPLVYTVTMSPRVCLLLSLGVYVMGFSGAMAHTGNIASLIFCADNLINHFLCDIPPLLELACNSSSVHELVVFIVVTTVIGMVTVTISISYALI
LSSILRIHSTEGRSKAFSTCSSHIIVVFLFFGSAAFVYLKPPSVLHLDQGKVLSLFYTIVVPMLNPLIYSLRNKDVKAALRKTLGKTNFLRKE*
506 >lcl|XP_583868.3|Plus1407737..408705 NW_001493314 olfactory receptor, family 52, subfamily B, member 2-like LOC507282 __SEG__ Chr15 {Bos taurus} MTHTNFTIFHPSVFVLLGIPGLEAYHVWLSIPFCLMYITAVLGNSILIAVIITERNLHEPMYFFLSMLAITDILLSTTTVPKALAIFWLHAHDIAFDACVTQVFFVHMMF
VGESAILLAMAFDRFVAICIPLHYKTMLTWPVVGRIAVAIVTRSFCIIFPVIFLLNRLPFCWTNVIPHSYCEHIGVARLACADITINIWYGFSVPIVMVILDVILIAVSY
SLILRAVFRLPSQDARHKALSTCGSHLCVILMFYVPSFFTLLTHRFGHNIPRHVHILLANLYVVVPPMLNPIVYGVKTKQIQDGVVHRFFGIMAWCSASSLG*
507 >lcl|XP_583895.2|Plus1complement(297257..298426) NW_001495541 5-hydroxytryptamine (serotonin) receptor 1B HTR1B __SEG__ Chr9 {Bos taurus} MEAVAAQCPQPPSASSQTGLSQANLSAGPSHNCSAAEEYIYQDFIALPWKVVVVLLLALFTLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMY
TVTGRWTLGQVVCDLWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSICISLPPFFWRQAKAEAMSNCVVNTDHVLYTVYSTVGAFYFP
TLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRAPEVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPF
FIISLAIPICTSCWFHQAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIGFKCTN*
508 >lcl|XP_583967.3|Plus12534289..2535236 NW_001493662 olfactory receptor 139-like LOC538966 __SEG__ Chr19 {Bos taurus} MEPGAWGNKTVVTEFILLGLTENIELQSILFAIFLFAYVITVGGNLSILAAIFVEPKLHTPMYYFLGNLSLLDIGCITVTIPPMLACLLTHQCRVPYAACISQLFFFHLL
AGVDCHLLTAMAYDRYLAICQPLTYSIRMSRDVQGALVAVCCSISFINALTHTVAVSVLDFCGPNVVNHFYCDLPPLFQLSCSSIHLNGQLLFVGATFMGVVPMVFISVS
YAHVAAAVLRIRSAEGRKKAFSTCGSHLTVVCIFYGTGFFSYMRLGSVSASDKDKGIGILNTVISPMLNPLIYSLRNPDVQGALKRLLTGKRPPE*
509 >lcl|XP_583983.4|Plus1complement(176224..177180) NW_001501816 olfactory receptor 157-like LOC507383 __SEG__ Chr5 {Bos taurus} MATGNHSSIKEFILLGLSADTHIQALLFVLFLMIYLLTLLGNLLIILVTHTDSTLHTPMYFFLSHLSMQDLCYSSVTVPKKRENLLSQRKVISVEGCMAQVFFVFATTGI
EACLLSVMAYDRYAAICHPLLYRQVMRKQLCVRLVWGSWVVAFLDALINILLALDLDFCEVQTIHHYSCELPSLFPLSCSDVSTNAAMLLSSALLHAIGTCLLIFFSYTR
IVSTILSISSTTGRSKAFSTCSSHLTAVILFYGSAILRYLMPTSGSPLELILSIQYSVITPLVNPLIYSLKNKEVKAALRRTILKYLQCLRQHGRDRP*
510 >lcl|XP_584021.3|Plus13895511..3896449 NW_001494955 olfactory receptor, family 2, subfamily A, member 4-like LOC507423 __SEG__ Chr4 {Bos taurus} MGDNMSSVTEFILLGFPLNTRTQMLLFGLFSLFYVLTLLGNGVILGLISLDPRLHTPMYFFLSHLAIADMAYACSTVPQMLANLLSPAKPISFAGCITQTFLFLTFAITE
CLLLMVMSYDRYVAICHPLRYSVIMSWRVCVMLVVTSWTIGVLLSLVHLVLLMPLPFCMAQKIDHFFCEIMAVLKLACADTHINELMVLAGAVSVLVGPFSSVIISYVCI
FRAILRLQSGEGQSKAFSTCSSHLCVVGLFYGTAIIMYVEPRHGNPKEQKKYLLLFHSLFNPMLNPLIYTLKNSEVKNAMKRVLGIESFMKR*
511 >lcl|XP_584026.3|Plus1complement(61663..62628) NW_001502739 Olfactory receptor, family 52, subfamily N, member 2-like LOC507428 __SEG__ Chr15 {Bos taurus} MFGANSSSLTPKFFILNGVPGLETAHIWISLPFCFMYIIAVAGNCGLIYLIGHEEALHHPMYYFLALLSFTDVTLCTTTVPNMLCIFWFNLKEIDFNGCLAQMFFVHMLT
GMESGVLMLMALDRYVAICYPLRYATILTSAVIAKAGLATLLRGVMLIFPFTFLTKRLPYCRGNFIPHTYCDHMSVAKVSCGNFRVNAIYGLMVALLIGVFDMCCIAMSY
TMILRAVVSLSSTDARHKAFSTCTSHICAIVITYVPAFFTFFTHRFGGHSVPHHIHIIVANLYLLLPPTMNPIVYGIKTKLIREGVIKFLLGEKVVFTQDT*
512 >lcl|XP_584158.2|Plus1complement(177440..178552) NW_001494127 chemokine (C-C motif) receptor 2-like CCR2 __SEG__ Chr22 {Bos taurus} MDGNDTFSHNVLPTSHSLFTTNVKGNDEEPTTSYDYDYSEPCRKTSVGQIEAQLLPPLYSLVFIFGFVGNLLVVLILINCKKLKSMTDIYLLNLAISDLLFLLTMPFWAH
YAADQWVFGNVMCKFFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSGVTWVVAVFASLPGIIFIKSLEEHSGYACAPYFPLGWKNFHTIMRSILG
LVLPLLVMIICYSGIIKTLLRCRNEKKKHKAVRLIFVIMIVYFLFWAPYNIVLLLSTFQEFFGLSNCKSSSQLDQAMQVTETLGLTHCCINPIIYAFVGEKFRRYLSTFF
RKHIAKHLCKQCPVFYGETGDRVSSTYTHSTGEQEVSAAL*
513 >lcl|XP_584199.3|Plus1243446..244390 NW_001501922 olfactory receptor Olr1654-like LOC507563 __SEG__ Chr15 {Bos taurus} MKSGNESFVVDFILLGFSNFPQLQGQLFWVFLADYLVTLLGNAIIIVVISLEQSLHVPMYLFLLNLSVVEVSFSAVIMPEMLVVLSSEKTTITFAGCFAQMYFILLFGGT
ECFLLGAMAYDRFAAICHPLSYPVTMNKRVFTKLVMFSWVSWIMVATVQTTWVFSFPFCGPNEINHLFCETPPVLELACADTFLFEIYAFTGTILIVMVPFVLIVLSYIR
ILFAILKMPSTTGRQKAFSTCASHLTSVTLFYGTANMTYLQPKSGYSPETKKLMSLAYTLLTPLLNPLIYSLRNSEMKRALMKLWRRKVDLHTF*
514 >lcl|XP_584434.4|Plus1543498..544454 NW_001492801 olfactory receptor MOR223-6-like LOC507759 __SEG__ Chr10 {Bos taurus} MGKTSNTSLDTVVTDFILLGLSHPPRLRILLFLLFFIIYILTQLGNLLILLTVWADPKLHTRPMYILLGVLSFLDMWLSSVIVPRLILDFTPVSKRIPFGGCVAQLYFFH
FLGSTQCFLYTLMAYDRYLAICQPLRYPTLMNGRLCTILVAGAWVAGSVHGSIQATLTFRLPYCGPNQVDYFICDIPAVLRLACADTTVNELVTFVDIGVVAASCFMLIL
LSYANIVHAILQIHTADGRRRAFSTCGSHLTVVTVYYVPCIFIYLRAGSKSPLDGAVAVFYTVVTPLLNPLIYTLRNQEVKSALKRLASGKGAGSENK*
515 >lcl|XP_584568.4|Plus1complement(390984..391919) NW_001501922 rCG40001-like LOC539064 __SEG__ Chr15 {Bos taurus} MARGNHTTVTEFVLMGFTDCPELQLPLFVVFLVIYLITMVGNLGMILLIRMDSRLHTPMYYFLSHLAFIDLCYSSSIGPKMLQNLLIKKKTISFSGCFAQLYFSSAFATT
ECFLLATMAYDRYMAICNPLIYTAIMTQRVCKELAIGVYTYGFLNSVIQTVLTFQLSFCDSNIIHHFYCADPPLLALSCSDTHSKEKQLLIFSAVNLTGSLLTVLISYIC
ILFSIIKIQSSEGKCKAFSTCASHLTVVIIFYGTLFFMYLRQPKAGNSWKYNKVVSVFYSLIIPMLNPLIYSLRNTEVKNTLKKMLEGKES*
516 >lcl|XP_584676.4|Plus1complement(2209034..2210005) NW_001495357 olfactory receptor, family 2, subfamily T, member 3-like LOC507971 __SEG__ Chr7 {Bos taurus} MYSGSQTSQNQTSSDFILVGLFGETKHALLLYTATFIFFLMALAGNALLIILVHMEPRLHTPMYFFISQLSLMDLMYISVTVPKMLLGQVTGDHTISPSGCGIQMFFYLT
LAGAETFLLSAMAYDRYAAICRPLHYPLLMNQRVCECLVSGCWFLGMVDGLLLTPIAMSFPFCHSRKILSFFCEAPALLKLSCYDISLYKMLMYLCCILMLLIPIVVISS
SYALILHLIHRINSAKGHRKAFATCSSHMTVVLLFFGATIYTYMLPDSYHTAEQDMMVSAFYTIITPVLNPIIYSFHNKDVTGALRSRMQLGLSLEKVVKGKV*
517 >lcl|XP_584828.4|Plus13873901..3874830 NW_001494955 olfactory receptor, family 2, subfamily A, member 4-like LOC508101 __SEG__ Chr4 {Bos taurus} MEGNQSWIAEFILVGFQLSEDMELVLFGIFSLLYTFNLLANGMILGLICLDPRLHTPMYYFLSHLAITDISYASSNLPNLLANLVKHTKNISFVLCTLQMIFNLTFASIE
CLILVVMSYDRFVAICHPLQYTVIMNWRVCMFLAIACWACGFSLAIVQVSLFLRLPFCGPQKVNHFFCEIQSVLKVTCGDIWINEMFLFAEGVFILVGPLSLMLVSYVHI
LWAILKIQSKEGRKKAFSTCSSHLCVVGFYFGIAMMVYLAPESSHREEQKKILFLFYTLFNPLLNPLVYSVRNAQVKAAFHRVLQKRTV*
518 >lcl|XP_584893.1|Plus1complement(1917202..1919244) NW_001493016 kelch repeat and BTB (POZ) domain containing 7 KBTBD7 __SEG__ Chr12 {Bos taurus} MQSREEAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTGHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLA
QLLAVLRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDRGYLEELLTKPIVKKYCLDLVEGALQMRYGDMLSKSLVPKPESSSSSSVVSIAENP
PQRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTVTSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRD
PITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDS
ETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSD
DEVWVQVAPQRNAQDQQGSL*
519 >lcl|XP_584924.2|Plus1172303..173229 NW_001502164 olfactory receptor MOR185-2-like LOC508180 __SEG__ Chr15 {Bos taurus} MANRNFTQVTEFILIGVSERPDLQIPLFFVFLVIYGLTVTGNLSIITLTSVDSRLQTPMYFFLRHLAIINLGNSTVIVPKMLISILVKKHTTSFYECATQLGGFLVFIVA
EIFMLAVMAYDRYEAICNPLLYMVVVSRQACFLLVSLTYFYSFSTAVVVSCSVFSVSYCSSNVINHFYCDTVPLLALSCSDASFPETVVFISASTNLMFSITVVVASYFN
IILSILRIHSSEGRKRAFSTCASHMTAVSIFYGTLLFMYLQPRNNHSLDTDKLTSVFYTLVIPMLNPMIYSLRNKEVKAALRKFLTNY*
520 >lcl|XP_585190.1|Plus1220304..221251 NW_001495357 olfactory receptor Olr1654-like LOC508420 __SEG__ Chr7 {Bos taurus} MEIWLNQSSSDDFVLLGIFSHSPTDLVLFSAVMMVFIVALCGNVLLIRLIYMDSRLHTPMYFFLSQLSLMDLMLVCTNVPKMAVNFLSGRKSISFVGCGIQMGLFVSLVG
SEGLLLGLMAYDRYVAISHPLHYPILMSQRACLKIVGSSWAFGIIDGLIQMVVVMTFPFCGLREVDHFFCEMLSLMKLACADTSIFENFAFACCIIMLFLPFSIIVASYA
RILRTVLHMCSTQAGKKALATCSSHLTAVFLFYGAAMFIYLRPRSYRAPSHDKVVSIFYTVLTPMLNPLIYSLRNQEVMGALKKGLDHCRIGNQT*
521 >lcl|XP_585247.1|Plus1complement(1193215..1194150) NW_001493648 olfactory receptor 462-like LOC508468 __SEG__ Chr19 {Bos taurus} MASRNHTCMTEFVFLGLSQTQEIQLVLFLVFLFVYTTTVMGNLLIVVTVTSDSRLHTPMYFLLRNLAILDLCFSSVTAPKMLVDLRAEKKTISYQGCMTQVFFFHFLGGA
MVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVTAWMVGFVHSISQLVLMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLMICNSGMLDVIWFLLLLVSYSV
ILVMLRSHSGQARRKAASTCTTHIIVVSMVFIPSIYLYARPFTSFSMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAVKRLGKRWVLCKKE*
522 >lcl|XP_585392.1|Plus1complement(19789..20730) NW_001502241 olfactory receptor, family 51, subfamily G, member 2-like LOC508595 __SEG__ Chr15 {Bos taurus} MPLRSLENSSSMSSTFLLSGIPGLEHMHTWISIPLCFIYIVSILGNCTIILIIKTEPSLHEPMYLFLSMLALTDLGLSLCTLPTVLGIFWVGARDIGHDACFAQLFFIHC
LSFLESSVLLSMAFDRFVAICRPLHYASILTNTVIGRIGLASLGRSVALIIPLPFMLKRFPYCGSPVLSHSYCLHQEVMKLACADIRANSIYGMFVIVSTVGIDSLLILF
SYALILRTVLSIASRAERLKALNTCVSHICAVLLFYTPMIGLSVIHRFGKQTPHLFQVILGFVYLLFPPLMNPIIYSVKTKQIRDRVTHAFCS*
523 >lcl|XP_585400.3|Plus1complement(2811..3752) NW_001503807 olfactory receptor, family 1, subfamily J, member 4-like LOC508604 __SEG__ Chr11 {Bos taurus} MKRENQSSMSEFLLLGLPIWPEQQGVFFALFLGVYLTTVLGNLLILLLIRLDPRLHTPMYFFLSHLALTDISFSSVTVPKMLINMQTQGQSIPYAGCVTQMYFFLFFTGL
DDFLLTSMAYDRYMAICHPLHYTIVMGQGLCTLLVTVSWILSCANALYHTLLLTQLSFCADLSIPHFFCDLGALLKLSCSDTSLNELAIFTAGVAVIILPLVCILISYGR
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFFPSSSTSRDKSTIASVMYTVVTPLLNPFIYSLRNRDMKEALERLLHKAKVLSQ*
524 >lcl|XP_585401.3|Plus1complement(10667..11608) NW_001503807 olfactory receptor, family 1, subfamily J, member 4-like LOC539172 __SEG__ Chr11 {Bos taurus} MKREKNSSVSEFLLLGLPIRPEQQGMFFALFLGVYLTTVLGNLLILLLIRLDTRLHTPMYFFLSHLALTDVSFSSVTVPKMLINMHTRDQSIPYAGCVTQMYFFLFFTDL
DDFLLTSMAYDRYVAICHPLHYSTVMRQGLCTLLVTVSWILSCANALCHTLLLTRLSFCADHSIPHFFCDLDALMKLSCSDTSLNELAIFTAGVVVIILPLICILTSYGR
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFFPSSNTSRDKSTIASVMYTVVTPLLNPFIYSLRNRDMKGALERLLHRAKILSQ*
525 >lcl|XP_585489.5|Plus1complement(605700..606647) NW_001494525 hypothetical protein isoform 1 LOC539185 __SEG__ Chr29 {Bos taurus} MPEMRMVAENSSGTEFILAGLTSQPELQIPFFFLFLGFYMVTVVGNLGLITLIGLNSHLHTPMYFFLYNLSFIDFCYSTVITPKMLMSFVSKKNIISYAGCMTQLFFFLF
FVISESFILSAMACDRYVAICKPLVYMATMSPQICLLLLLGVYVMGFVGAMAHTACMVRLTFCANNLVDHYMCDILPLLELSCTSTYVNELVVFIVVGIDIGVPTVTIFI
SYALILSSILHIHSTEGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKSALKKTLSKILFS*
526 >lcl|XP_585591.4|Plus1complement(1300998..1301936) NW_001495357 Olfactory receptor, family 2, subfamily L, member 8-like LOC508760 __SEG__ Chr7 {Bos taurus} METYNRTSDDFILIGLFSPSRIGLFLFMFIVLIFLMALFGNLSMILLIFLDTHLHTPMYFLLSQLSFIDLNYISTIVPKMASNFLFGNKSISFIGCGIQSFFFLTLAVAE
ALLLTSMAYDRYVAICFPLHYPIRISKRVCVLMITGSWIMGALNSCAHTTYALHIPYCRSRAINHFFCDVPAMLTLACIDTWVYEYTVFVSTTLFLVLPFIVIACSYGRV
LFAVYHMNSAEGKKKAYSTCSTHLTVVTFYYAPFVYTYLHPRSFRSPTEDKALAVFYTILTPMLNPLIYSLRNKEVMEALRRVTQRLCSVKM*
527 >lcl|XP_585617.3|Plus129801..30733 NW_001492991 olfactory receptor 355-like LOC508785 __SEG__ Chr11 {Bos taurus} MERVNQTSSVSEFILLGLSSRPEDQKPLFALFFIMYVVTIVGNVLIILAIRSDTQLQTPMYFFLSILSFIDVCYTTTIVPKMLVNFLSKKKSISYAECMTQMYFFLAFAN
TESYLLAAMAIDRYVAICDPFHYVTTMNRHRCVLLVTFSCSISHLHSLLLVLLINRLLFCDSNIIHHFLCDINPLLKLSCSSTLVNEIVINTEGLVTLVSPFICVIISYL
RILIVVLKIPSAAGKHKAFSTCGSHVTMVTLFYGSIIYVYFRPLSTYTIKDRVATVIYTILSSMLNPFLYSLRSKDMKRDLRKLMSRRMS*
528 >lcl|XP_585637.3|Plus1complement(234365..235306) NW_001494720 putative olfactory receptor 10K2-like LOC508806 __SEG__ Chr3 {Bos taurus} MEWANETLVTEFVFLGFSSLAGLQRLLFVVFLLVYLFMLGTNVIIVSTIVLDRALHTPMYFFLGVLSCSETCYTFVIVPKMLVDLLAQKKTISFLGCAIQMFFFLFLICS
HSFLLAAMGYDRYVAICNPLRYTVLMGFGVCVGLVAAACACGFIISLATTSMIFHLPFHSSNQLHHFFCDVSPVLKLASHQSYLNQLVIFVLGVFVLVIPLLLILVSYVL
IISAIVKIPSSVGRYKAFSTCASHLIVVTVHYGCASFIYLRPKSNYSSSQDTLISVSYTILTPLFNPMIYSLRNKEFKSALQRAMTHTSYSIN*
529 >lcl|XP_585738.1|Plus1complement(456537..457616) NW_001493476 mab-21-like 2 (C. elegans) isoform 1 MAB21L2 __SEG__ Chr17 {Bos taurus} MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSM
SLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTG
KQSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGK
PHSALESAAKQTWRLAREILTNPKSLDKL*
530 >lcl|XP_585830.3|Plus1complement(269144..270082) NW_001501761 olfactory receptor, family 7, subfamily D, member 2-like LOC539237 __SEG__ Chr7 {Bos taurus} MEAGNRTGVSEFILLGFSEDPELQPLIFGLFLSMYLVTVLGNLLIILAIIFDSHLHTPMYFFLSNLSLVDICFSTSIVPKMLLSIHTENKAISYMDCLTQVYFSMLFPIL
DTLLLTSMAYDRFVAICHPLHYTVIMNPHLCGWLVFITWLIGVLTSLLHICLMKHLTFCRDLEIPHFFCELTHILELACSDTFLNWTLIYFMTGVLGVFPLVGILFSYSR
IASSIRKMSSSGGKQKAFSTCGSHLSVVSLFYGTGVGVHFTSAVTHSPQKVSVASVMYSVVTPMLNPFIYSLRNKDVKGAFRRLLNRTTSCL*
531 >lcl|XP_585854.4|Plus12010620..2011549 NW_001494714 olfactory receptor 16-like LOC508986 __SEG__ Chr3 {Bos taurus} MQRKNFTEVAEFIFLGFSIFGNHQITLFVVFLTTYIFTLTGNIIVITVICIDRHLHTPMYFFLSMLSSSETVYTLVIIPRMLSGLIFYNQPISLGSCATQMFFFAMLAIN
NCFLFTVMGYDRYVAICKPLRYTVLMNKGVCARLVCGSFGTGLVMAVLHVMAMFTLPFCGTMVDHFFCDIYPVMKLSCIDTTINEIINYGVSSFVIIVPVVLVFISYILI
ISSILKISSVEGRKKTFATCASHLTVVVVHYGCAAIAYLKPKSENAIEKDLLLSVTYTIITPLLSPVVYSLRNKEVKDALCRAVGRISS*
532 >lcl|XP_585959.4|Plus1197347..198294 NW_001495357 olfactory receptor Olr1654-like LOC509071 __SEG__ Chr7 {Bos taurus} MEIWLNQSSSDDFVLLGIFSHSSTDLVLFSAVMMVFIVALCGNVLLIFLIFMDPQLHTPMYFFLSQLSFMDLMLVCTNVPKMAANFLSGRKSISFVGCGMQIGLFVCLVG
SEGLLLGLMAYDRYVAISHPLHYPILMSQRVCLQIVGSSWVFGITDGLIQMVVVMTFPYCGLREVDHFFCEMLSLLKLACIDTSIFENVIFACCVFMLFLPFSIIVASYA
RILRTVLHMHSAQAVRKALATCSSHLTAVFLFYGAAMFIYLRPKRYRAPSHDKVVSVFYTVLTPMLNPLIYSLRNREVMGALRKGLDHCRIVNQH*
533 >lcl|XP_585961.4|Plus1185652..186608 NW_001492991 olfactory receptor 355-like LOC509073 __SEG__ Chr11 {Bos taurus} MERLNQNNSVSEFILLGLSSRPEDQKPLFILFLIIYLVTITGNLLIILAICCDPQLHTPMYFFLSFLSFIDICFSTTIVPRMLVNFLSEKKTISYAGCLAQMYFTYALGN
TDSYLLAAMAYDRYVAICDPFHYITIMSRRPCVLLVAFSCSLPHFHSLLHILLLNQLTFCDSNVVHHFFCDINPLLKLSCSSIFVNDLTIKTEGLVFWVTPFLCIVFSYV
RILIAVLRIPSAAGKRKAFSTCGSHFTVVILFYGSIFYVYLQPLSSYTVQDRVATIVYTVLTSMLNPFIYSLRNKDMKRGLGKLLGRRKSYLEGGNPS*
534 >lcl|XP_586018.4|Plus1complement(58352..59290) NW_001493368 olfactory receptor, family 5, subfamily I, member 1-like LOC509124 __SEG__ Chr15 {Bos taurus} MEVGNRTLLNEFILLGLSTDPRWKLTLFGIFLIFYLITLSGNMSLVILIHIDSCLHTPMYFFIGNLSFLDFWYTSVYTPKILATCVSEDKHMSLAGCGAQFFFSCAVTYT
ECYLLAAMAYDRHMAICNPLLYSSSMSPSLCTRLVAGSYIGGFLNAIAHTANTFRLSFCGKNIIDHYFCDVPPLVTMSCTDTKVYEQVLLGLVGFTVLSNILVIIISYFH
ILLAILRIRTASGRRKAFSTCASHLVSVMLFYGSLLFTYSRPSSTYSLGKDKVASLFYTVVNPLLNPLIYSLRNKDVKAAFWKATQTIRPQR*
535 >lcl|XP_586022.4|Plus1complement(2131458..2132444) NW_001492801 olfactory receptor, family 11, subfamily A, member 1-like LOC509128 __SEG__ Chr10 {Bos taurus} MCLLMLQVTDPVNMNISEPDSHFVFVREFILLGFSYEWKIQSLLFSLFLTIYALTITGNGAIICALWCDQRLHIPMYVFLGNFSFLEIWYVSSTFPEMLVNFLSHKKTIS
FVGCFLQFYFFSSLGATECLHLTVMAFDRYLAICRPLHYPNIMTGHLCTKLVLICWFCGFLWFLVPIVLISQMPFCGPNIIDHVVCDPGPLFALACVSAPKTQLLCYSLS
SIVIFGNFLFILGSYTLVLTAVLPMPSATGRQKAFSTCGSHLAVVSLFYGSLMVMYVSPGLGHSARMQKVTTLFYAMVTPFFNPLIYSLRNKEIKTALRKVLGSFNIM*
536 >lcl|XP_586072.3|Plus13540531..3541463 NW_001494955 olfactory receptor 2-like LOC509170 __SEG__ Chr4 {Bos taurus} MEVENQTRVTRFILVGFPGSWGMRAAVFLIFLMAYILTVAENVTIILLVQQNRPLHKPMYFFLANLSFLETWYISVTVPKLLFSFWSVSKSISFAHCMIQLYFFIALMCT
ECVLLATMAYDRYVAICRPLHYPTIMSHGLCFRLALGSWTIGFGISLAKTYFISRLSFCGPNVINHFFCDISPVLNLSCTDMSTAELVDFVLALVIFLLPLTVTILSYGC
ILATVLRMPTGKQKAFSTCASHLVVVTIFYSATIFMYARPRAIHAFNMNKVISIFYAIVTPALNPFIYCLRNREVKEAVKKLAYCQARSD*
537 >lcl|XP_586118.4|Plus11018301..1019245 NW_001494955 olfactory receptor 49-like LOC509207 __SEG__ Chr4 {Bos taurus} MLGNHSSATEFYLLGFSGSRELRHILFATFFFFYLVTLMGNTVIIVIVCLDKHLQSPMYFFLGHLSALELLVTTIIVPMMLWGLLLPGMQTISLAACVTQLFLYLALGTT
EFTLLGAMAVDRYVAVCNPLRYNVIMNSRTCNFVVIVSWLFGFLFEIWPVYATFQLSYCKSNVVDNFFCDRGQLLKLSCDNTLFMEFILFLMAIFVLFGSLIPTIVSYTY
IISTILKIPSASGRRKAFSTCASHFTCVVIGYGSCLFLYVKPKQTQATDYNRVVSLMVYVVTPFLNPFIFTLQNDKVIEALRDRVKQCCHLFRN*
538 >lcl|XP_586131.5|Plus11788037..1788966 NW_001495357 olfactory receptor Olr1654-like LOC509217 __SEG__ Chr7 {Bos taurus} MEKRNTTSDFVLLGIFKHTRSHLFLFMMVLTMAIASLMANALMLLLILLDPRLHRPMYFLLSQLSLMDLMLVSSIVPKMAADYLTWNKSISPAGCGLQIFVSLTLGGAES
FLLAAMSYDRYVAVCHPLRYPVLLNWRLCIQMTLGSWFLGAADGLMQAATTLSFPFCSAHEIDHFFCEAPMLVRLACADTSVFENAMYVCCVLMLLIPFSFILTSYSLIL
SAVLHLRSQEALRKAFATCSSHLAVVALFYGPAIFIYMRPKSYRSANHDKVVSAFYTIFTPVLNPLIYSWRNSEVREALKRWLGKCADF*
539 >lcl|XP_586189.2|Plus1complement(2114237..2115172) NW_001494714 olfactory receptor 16-like LOC509261 __SEG__ Chr3 {Bos taurus} MPRPNFTAVAEFTFEGFSIFGWQPRLILFVVFLVLYLLTLASNAIILTVICLNHQLHTPMYFFLSVLSISETCYTVAIIPRMLFSLLSPQHAISIPDCATQLFFYLTFGV
NNCFLLTAMGYDRYVAICNPLRYSVIMGKKTCIQLAGGSWSIGLSTATIQVSSVFSLPFCDASVISHFFCDIRPLMKLACADITIKELTTLLISLCVLVLPMVLIFISYV
LIVCTILKMASAEGRKKAFATCASHLTVVIVHYGCTSFIYLKPKSQNSLQDRLISVTYTVITPLLNPVVYSLRNKEVKDALLRALGRKSLS*
540 >lcl|XP_586246.4|Plus12182843..2183802 NW_001492801 olfactory receptor, family 4, subfamily M, member 1-like LOC509309 __SEG__ Chr10 {Bos taurus} MKKSEEMETANYTRVTEFVLTGLSQAREVQLVLFVIFLSFYLFIIPVNILIICTIRLDPHLTSPMYFLLANLAFLDIWYSSITAPKMLVDFFVERKVISFGGCIAQLFFL
HFVGASEMFLLTVMAFDRYAAICRPLHYATIMNRRLCCILVAFSWMGGFIHSTIQVALIVRLPFCGPNELDSYFCDITQVVRIACANTFPEELVMIFSSGLISVVCFIAL
LTSYAFLLVMLKKHSGSGESTSRAMSTCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKMAMRKLVNRYILCKEK*
541 >lcl|XP_586260.4|Plus1450176..451114 NW_001494524 hypothetical protein LOC509323 __SEG__ Chr29 {Bos taurus} MDPGNHSLVTEFILAGLTEQPQLQLLFFFLFLGIYVVTVVGNLGMITLIGLSSHLHTPMYYFLINLSFIDFCHSTVITPKMLVSFVTEKNIISYTECMTQLYFFIIFIIA
EGYLLAVMAFDRYVAICNPLLYNVIMSYHICFRLTVGVYILGFIGSTIHTGFMLRVFFCKNKMVNHYFCDLFPLLELSCSSTYINKLLVLVLSAFNIVIPSLTILASYIF
ILSSILQIHSIEGRSKAFSTCSSHISAVAVFSGSATFTYLQPSSVSSMDQGKVSSVFYTCIVPMLNPLIYSLRNKDVKLALKKFWRLKNVYE*
542 >lcl|XP_586310.2|Plus1complement(39811..40824) NW_001495590 trace amine associated receptor 8-like TAAR5 __SEG__ Chr9 {Bos taurus} MSVVLNQDAEERPETFCYQVNGSCPRTIHPLGIQLAIYLSCAAGVLITVLGNLFVVFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIHSVESCWFFGDSLCRLH
TYLDTLFCLISIFHLCFISIDRHCAICEPLLYPSKFTVRVALRYILAGWGLPAAYTAFLLYTDMAERGLHLWLEEMPCVGSCQLLFNKFWGWLNFPVFFFPCFIMISLYV
KIFVVATRQAQQINNLSKSLAGAAKRERKAAKTLGIAVGVYLLCWLPFTVDTMIDSLLNFITPPLVFDTFIWLAYFNSACNPIIYVFPYRWFRKALKLLLSREIFSPRTP
TIDLYQD*
543 >lcl|XP_586311.4|Plus1complement(17844..18788) NW_001501889 hypothetical protein LOC509369 __SEG__ Chr15 {Bos taurus} MENNTERADFILLGLTDDPQLQVPLFIAFTFIYLLTLIGNLGMTTLILLDSRLHIPMYFFLSNLSLVDFCYSSTITPKVMAGLLIGDKTMSYRACAAQMFFFVAFATVEN
YLLASMAYDRYAAVCKPLHYTTTMTTSVCARLAIGSHIFGLLTAAIDAGDTFCLSFCTSNVIHHFFCDIPAVMSLTCSDKGINELILFLISSFNIFFALLVILISYLLIF
ITILKLQSGEGYQKALSTCASHLVAVSIFYGTVIFMYLQPSSSHSMDRDKIASVFYTILIPMLNPVVYSLRNREVKNAFKKVIEKAKCSLGLTF*
544 >lcl|XP_586409.1|Plus1complement(1884540..1885553) NW_001493080 purinergic receptor P2Y, G-protein coupled 1-like OXGR1 __SEG__ Chr12 {Bos taurus} MNEPLDDFANASDFPDYAAALENCTSENIPLKTHYLPVIYSIIFLVGFPGNVIAISTYIFKMRPWRSSTIIMLNLACTDLLYLTSLPFLIHYYAGGDHWVFGDFMCKFIR
FGFHFNLYSSILFLTCFSIFRYFVIIHPTSCFSVHKKRWAMVACVVVWIVSLVAVIPMTFLITATTSTNRSTCLDLTSSDDLTTIKWYNLILTTTTFCLPLVIVTLCYTM
IIYTLTQGPQTHSCLKQKARRLTILLLLVFYICFLPFHILRVIRIESRLLSISCSTEHQIHEAYIVSRPLAALNTFGNLLLYVVVSSNFQQAVCSMVRCRAGGDLEQGKK
VSQKNNP*
545 >lcl|XP_586437.2|Plus1complement(88567..89628) NW_001492858 transmembrane protein 30B TMEM30B __SEG__ Chr10 {Bos taurus} MTWSATARGAHQPDNTAFTQQRLPAWHPLLSASITLPLFFCAGLAFIGLGLGLYYSSNGIKELAYDYTGDSGTGNCSVCAMAGQGRAPPPPCSCAWYFSLPELFQGPVYL
YYELTNFYQNNRRYGVSRDDSQLSGLPSSLRHPVNECAPYQYSAAGLPIAPCGAIANSLFNDSFSLWHQRQPNGPYVEVPLDRTGIAWWTDYHVKFRNPPLVNGSLALAF
QGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFNGHKSLIFSSISWMGGKNPFLGIAYLLVGSLCIL
VGFVMLVVYIRYQDQNDDEEDDE*
546 >lcl|XP_586484.4|Plus1complement(141452..142375) NW_001501816 olfactory receptor Olr1107-like isoform 1 LOC509508 __SEG__ Chr5 {Bos taurus} MALRNRSTITEFILTGLSDDPYIQALLFVLFLVIYLLTVMGNLTMLLVIRADSHLHTPMYFFLSNLSFLDLCFSCVTLPKLLKDLLSEKKTISVESCLTQVFFVFFSSGT
EACLLSVMAYDRYAAICHPLHYGQVMSNQFCVRLVLISWGLASLNAFVIVLLAISLDFCEAQTIHHYTCELPALFPLSCSDISIVTNILLCSSLLHGLGTFIPIFFSYAR
IISTILSISSTKGRSKAFSTCSSHLIAVILFFGSGFLCYLMPPSGSSLDLLLSVQYSAVTPMLNPLIYSLKNKEVKAAVKRTLGKYL*
547 >lcl|XP_586494.2|Plus11248959..1249894 NW_001493648 odorant receptor MOR10-like LOC509517 __SEG__ Chr19 {Bos taurus} MDSGNLTWVSEFVFLGFSQNQELQFSLFLVFLFVYTTTVIGNLLIMVTVISDSRLHTPMYFLLRNLAIIDLCFSSVTAPKMLVDFLAEKKTISYQGCMAQIFFFHLLGGG
TVFFLSVMAYDRYIAISQPLHYVTIMNTRVCVGLVVAAWVGGFVHSIVQLVLMLPLPFCGPNILDNFYCDVPQMLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTV
ILVMLRSHSGQARRKAASTCTTHIIVVSMIFIPCICIYARPFTSFPMDKAVSISYTVLTPMLNPIIYTLRNREMQAARKRLGKRLVISSRE*
548 >lcl|XP_586557.1|Plus1complement(666185..667132) NW_001493314 olfactory receptor, family 51, subfamily E, member 2-like LOC509567 __SEG__ Chr15 {Bos taurus} MTAHQNGSTTTEISDFLLNCFVRSPSWQHWLSLPLSLLFVLAMGANTTLLITIRLEASLHEPMYYLLSFLSLLDMVLCLTVIPKVLAIFWFDLRSISFFTCFLQMYIMNC
FLAMESCTFMVMAYDRYVAVCQPLRYTSIITDQFVAKATIFILARNVLFTVPIPILSVRLHYCGRNVIENCICANMSVSRLSCDDVTINRVYQFAGGWTLLGSDLILIFL
SYTLILRAVLRLKAEGAVAKALSTCSSHFILILFFSTILLVFVLTHVAKKKVSPDVPVLLNVLHHVIPAALNPIVYGVRTQEIKQGIQRLLKKGW*
549 >lcl|XP_586650.3|Plus1complement(59066..59989) NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC509641 __SEG__ Chr7 {Bos taurus} MEPENETHISEFLLLGLSNEPELQPLIFGLFLTMYLITVFGNLLIFLAVSSDSHLHTPMYFFLSNLSFVDICFISTTIPKMMWNIQMQSKVITYEGCINQIYFLLLFAGL
DDFLLTVMAYDRFVAICHPLHYTVIMNSRLCGLLVLVSWMMSALNSLIQILMMLRLSFCRVPEIPNFFCELNQVVRSACSGTFLNDVMVYIAAGLLSGGPFIGILYSYSK
IVSSIRGISSAQGKYRAFSTCASHLSVVSLFYCTTLGVYLNPADAHNSHSSAIASVMYTVVTPMLNPFIYSLRNKDIKEALKRFIEQ*
550 >lcl|XP_586728.1|Plus1complement(288437..289504) NW_001494673 G protein-coupled receptor 1-like GPR1 __SEG__ Chr2 {Bos taurus} MEDLEETLFEDFENYSYALEYYSPETDSEEKAPLGAIHWVSLVLCCLAFVLGIPGNATVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLC
KANSFIAQLNMFASVFFLMVISLDRYIYLIHPVLSHRYRTLRNSLIVIIVVWLLASLMGGPALYFRDTLELNNHTLCYNNFHEHDVDLRLLRHHVLTWVKVIVGYLLPLL
TMSICYLCLIFKVKKRSILISSKHFWTILAVVMAFLICWTPYHLFSIWELTIHHNSYFHQVLQASIPLSTGLAFLNSCLNPILYVLISKKFQARFRASVAEILKYTLWEV
SCSGTLSEQLRNSETKNLSLLETAQ*
551 >lcl|XP_586731.4|Plus1184547..185500 NW_001501889 hypothetical protein LOC509710 __SEG__ Chr15 {Bos taurus} MIPKENSTVVTEFILAGITDDPQLQIPLFLVFTLIYLLTLVGNLGVITLILLDSRLHTPMYVFLSHLSLMDFGYSTAVTPKVMAGFLTGDKVISYKACAAQLYFFAVFLI
VETFLLASMAYDRHAAVCKPLHYTNIMTPRVCAWMVVGCYVFGFLEASVHTWNAFSLSFCRSNVIDHFFCDATPLLALSCSDSIRSEMVFFILAGFNIIFTIMVILISYL
FIFVTILRMHSSEGHQKAFSTCASHLTSVSIFYATGAFMYLQPGPRHSMSTDKMASVSYAIVIPMLNPLIYSLRNKDVKRALKKAVGKAKSLLRYIF*
552 >lcl|XP_586863.4|Plus1345250..346167 NW_001501816 olfactory receptor 283-like LOC509817 __SEG__ Chr5 {Bos taurus} MRNHSVVSEFILLGLSADPQIQALLFVLFFVIYTLTLMGNLMLLLVIRVDSQLHIPMYFFLGQLSFLDVCHSSVTVPKLLENLLSEKKTISVEGCMAQVFFVFATGGTES
CLLAVMAYDRYVAITSPLLYGQVMNRQLCMGLVGGSWGLAFLDALINILVALNLDFCEAQNIHHFSCELPSLYPLSCSGVSASFTALLCSSLLHFFGNFLLIFFSYVRIL
FTILSISSTKGRSKAFSTCSSHLTAVIFFYGSGLLRYLMPNSGSIQELIFSLQYSVVTPMLNPLIYSLKNKEVKAAVRRMLRRCF*
553 >lcl|XP_586897.1|Plus1243320..244186 NW_001508725 sprouty 2-like SPRY3 __SEG__ ChrX {Bos taurus} MDAAVTDDFQQILPIEQLRSTHASNDYVDRPPVPCKQALSSPSLIVQTHKSDWSLATMPTALPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQ
SIIRTQPGTGAHPKADGALKGEAEHSAMHPSEHLFICEECGRCKCVLCTAARPLPACWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPGSCFV
RWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV*
554 >lcl|XP_586943.4|Plus1314313..315242 NW_001493367 olfactory receptor 1264-like LOC509884 __SEG__ Chr15 {Bos taurus} MAKTHNVTEFIFLGLSSNPEVQKVCFVMFLLLYTAIVLGNLLIVLTVMSSRSLGSPMYFFLSYLSFVEICYASTTVPKLISDLLAERKAIPLWGCMSQFFFIHLFGGTEA
FLLTVMAYDRYVAICKPLSYTTIMSRQACAFLVGAAWVGAFVHSLVDSLLVFCLPFCGPNVIDHYFCDVLPLLKLACSDTVLIGLLIVANGGTLSVISFVVLLASYVVIL
LHLRTRSSAGRHKALSTCGSHVTVVTLFFGPCIFIYLRPSTTLSVDKTVAVFYTVITPLLNPVIYSLRNAEVKKAMKRLWVRAMKLEER*
555 >lcl|XP_586949.4|Plus1364912..365856 NW_001493371 olfactory receptor, family 5, subfamily B, member 12-like LOC509890 __SEG__ Chr15 {Bos taurus} MENATEVTEFLLVGLSDDPQVQILLFITFSLIYLLTLVGNLGMTELILLDSRLHTPMYFFLSQLSLVDFGYSSAVTPKVMAGFLTGDKTISYEACVTQFFFFVAFITVES
FLLAAMAYDRYAAVCKPLHYTTAMTTKACARLLVGCYFCGFLNASVHNGNVFRLSFCRANVVNHFFCDAPPLLALSCSDNYVSEMVIFFVVGFNDFFSILVIFISYLFIF
ITILRMRSSEGRQKAFSTCASHLTAVSIFYGTGIFMYLQPSSSHSMSADKMASVFCAMVIPMLNPLVYSLRNKEVKSAFKTAVGKAKSSIGFIL*
556 >lcl|XP_586950.3|Plus1complement(111121..112062) NW_001492989 olfactory receptor, family 1, subfamily J, member 4-like LOC509891 __SEG__ Chr11 {Bos taurus} MKRENQSSMSEFLLLGLPIRPEQQGMFFALFLGVYLTTVLGNLLILLLIRLDARLYTPMYFFLSHLALTDISFSSVTVPKMLINMQTQGQSIPYAGCITQMYFFIFFTGL
DDFLLTSMAYDRYMAICHPLHYTTVMGQGLCTLLVTVSWILSCANALCHTLLLTRLSFCADHSIPHFFCDLGALLKLSCSDTSLNELAIFTAGVADIILPLVCILISYGH
IGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYFFPSSSTSRDKSTIASVMYTVVTPLLNPFIYSLRNRDMKRALERLLHRAKVLSQ*
557 >lcl|XP_586981.2|Plus1complement(65360..66319) NW_001495460 olfactory receptor 155-like LOC509916 __SEG__ Chr8 {Bos taurus} MEKPNQTSPLVGFILLGLSAHPKLEKTFFVLILLMYLVILLGNGVLILVTILDSRLHMPMYFFLENLSFLDICYTTSSVPLVLDSFLTPQKTISFSACAMQMFLSFSMAG
TECVLLSMMAFDRYVAICNPLRYSVVMSKAVYVPMAAGSWAIGGVASLVHTSLVIQLPFCGANIINHFTCEILAVLKLACADISISVISMEVTNVIFLGVPVLFISVSYV
FIIATILRIPSAEGKKKAFSTCSAHLTVVIIFYGTLFFMYGKPKSKDSQGADKEDLADKLIPLFYGVVIPMLNPIIYSLRNNDVKAAVRNLVSQKCFRR*
558 >lcl|XP_586987.5|Plus12231138..2232109 NW_001495357 hCG2044579-like LOC509922 __SEG__ Chr7 {Bos taurus} MYSGSQNSQNQTSSDFILVGLFGETKYALLLYTATFIFFLMALAGNALLIILVHMEPRLHTPMYFFISQLSLMDLMYISVTVPKMLLGQVTGDHTISPSGCGIQMFFYLT
LAGAEFLLLSVMAYDRYAAICRPLHYPLLMNQKVCVCLVSGCWFLGMVDGFVVTPIAMNFPFCHSRKILSFFCEAPAVLKLSCSDISLYKMIMYLCCVLMVLIPIVVISS
SYALILHLIHRMSSSESRRKAFATCSSHMIVVLLFFGATIYTYMLPDSYHTAEQDMMVSAFYTIITPVLNPLIYSLRNKDVTGALRSRMQSGLNLRKVVKRKS*
559 >lcl|XP_586997.3|Plus1809803..811374 NW_001508846 retinoic acid induced 2-like RAI2 __SEG__ ChrX {Bos taurus} MDDLQSQNLAMDMSDSSPTLTNNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGVALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNQSGNA
TYVMTAQGPVQLPVVLEQHVFQHLNSPLVLPPEAPGSSSTIHNNLFQGARDPEAQPQLLDLRIPSQPQEPPLPFEAVLHNLFPAQGALGPPPCQPPPGYTPVPPQPFNSP
LSPLVPPATLLVPYPVIVPLPVPLPIPIPIPVPQSSEAKFSPTCPKPPSAFGLHPFKGPQSPLQKEEVKPFDLFQPREYFQLGRHTVIKMGSENEALDLSMKSVPWLKAG
EVSPAMDQEDTALDLSLSAHRKPEPPPETLYDSSGSVDSPGHPVLEKLPSGMEVPFAPTTTQEAASVMESHGGGSDATEPPSQPSGEVKAENLVSESQAAKVIVSVEDTV
PTIFCGKIKGLSGVSTKNFSFRREDSVFQGSDANSPGEEALGNMEALRKPTKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK*
560 >lcl|XP_587002.1|Plus11487972..1489105 NW_001494701 5-hydroxytryptamine (serotonin) receptor 1D HTR1D __SEG__ Chr2 {Bos taurus} MSLPNQSAEGLLQGAPNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANCLIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLL
CDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTVGHAAAMITVVWAISVCISIPPLFWRQAKTHEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRI
YMAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSLHEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIVCWLPFFVASLVLPICRDS
CWIHPALFDFFTWLGYLNSLINPIIYTMFNEEFRQAFQKVVRFRKTS*
561 >lcl|XP_587133.2|Plus1complement(117565..118491) NW_001501883 olfactory receptor, family 6, subfamily C, member 4-like LOC510046 __SEG__ Chr5 {Bos taurus} MKNRTFTEFILLGLTNQPEVQALIFIFLFLTYMLSVLGNLTIIILTLVDSHLQTPMYFFLRNFSFLEVSFTSIFIPRFLTSMTTGNKAISFAGCLIQYFFAIFLGATEFY
LLASMSYDRYVAICKPLHYLTIMNSRVCIQLVFCSWLGGFLAIFPPIILMSQVDFCASNVLNHYYCDYGPLLELACSDTSLLELMVISLAVVTLVVTLVLVTLSYTYIIR
TILRIPSAQQRAKAFFTCSSHRIVISLSYGSCMFMYINPSAKEEGAFNKGIAVLITSITPLLNPFIYTLRNQQVKQAFKDTIKKIVKF*
562 >lcl|XP_587200.3|Plus1complement(474391..475344) NW_001493322 olfactory receptor, family 10, subfamily A, member 5-like LOC510100 __SEG__ Chr15 {Bos taurus} MAEGNWTRVSEFILISFSSLPTEIQSLLFLTFLFIYLVTLLGNSLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLVIVPKMLGTLIAQDTTISFLGCATQMYFLFFFGV
SECFLLATMAYDRYVAICSPLHYPVIMNPRTRAKLAAVSWFPGIPMATVQTTWLFSFPFCGINKVNHFFCDSPPVLSLVCADTALFEIYAIIGTILVVMIPCLLILCSYT
RITAAILKIPSAKGKHKAFSTCSSHLLVVSLFYVSSSLTYFRPKSNNSPESKKVLSLSYTVITPMLNPIIYSLRNNEVKNALGRTFHKAMGVRNCFL*
563 >lcl|XP_587398.1|Plus1complement(1484957..1486579) NW_001492936 G protein-coupled receptor 75 GPR75 __SEG__ Chr11 {Bos taurus} MNSTGHLQDVPNTTLLHVPHAQGGNSTSIQEGLQEPVHTATLVTCTFLLAVIFCLGSYGNFIVFLSFFDPAFRKFRTNFDFMILNLSFCDLFICGVTAPMFTFVLFFSSA
SGIPDTFCFTFHLTSSGFIIMSLKTVAVIALHRLRMVLGKQPNRTASFPCTLLLTLLLWTTSFTLATLATLKTSKSHLCLPMSSLIAGEGKAILSLYVVDFTFCVAVVFV
SYVMIAQTLRKNAQVRKCPAVITVDASRPQPFMGAPVKGGGEPIQCTMPALYRNQNYNKLQHVQTHGYTKSPNQLPTPAASRLQLVSAVNLSTAQDSRAVVTCVIIVLSV
LVCCLPLGISLVQVVLSSNGSFILYQFELLGFTLIFLKSGLNPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKK
FVDQACGPSHSKESVVSPKMSAGHQHYGQSSSTPINTRIEPYYSIYNSSPSQEESIPHNLQPVNSFGFANSYIAMHYHTTNDLMQEYDSTSAKQIPVPSV*
564 >lcl|XP_587420.3|Plus12603802..2604764 NW_001494522 odorant receptor MOR10-like LOC510293 __SEG__ Chr29 {Bos taurus} MTNMSLVTTFVLTGLPHAPELDTFLFGIFLVIYVLTVVGNFLILLVIIVNPHLHTPMYYFLTNLSFIDMWYSTVTVPKMLMTLVSPEGSPISFHSCVAQFYSFDFLGSTE
CFLYTVMSYDRFLAISYPLRYASMMSGRTCAILAITTWLSGSVHSAVQTTPTFRLPFCGPNQIQHYICDAPSVLKLACADTSTVEMVIFVNIGVVALGCFFLIVLSYVSI
VHSILKIRTSEGRWRAFQTCASHCIVVLCFYVPLVFIYLRPGSKEAVDRIVAVFYTVMTPLLNPVVYTLRNKDVKKALLKLKDKVMYSQRKWSLQCRLAH*
565 >lcl|XP_587471.2|Plus11310477..1311583 NW_001494275 somatostatin receptor subtype 5-like SSTR5 __SEG__ Chr25 {Bos taurus} MEPLFPASPLTTWNTSSVVPSGSGDENGTLAGLGPSPGARAVVVPVLYLLVCAVGLGGNTLVIYVVLRHAKMKTVTNIYILNLAVADVLLMLGLPFVATQNAISYWPFGP
VLCRLVMTLDGINQFTSIFCLTVMSVDRYLAVVHPIRSARWRRPRVAKLASAAVWAFSLVMSLPLVVFADIQEGWNTCNLSWPEPVGLWGAVFIIYTSVLGFFGPLLVIC
LCYLLIVVKLKASGVRVGSTRRRSERKVTRMVVVVVLVFAGCWLPFFIVNIVNLAFALPEEPASAGAYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKVLCLRKGYGAG
AEDADATEPQPGPSSRLQEAMMPVRSCKANGLMQTSKL*
566 >lcl|XP_587592.2|Plus1294039..294989 NW_001493367 olfactory receptor 1264-like LOC510451 __SEG__ Chr15 {Bos taurus} MGAKNNLTEFVLLGLFRSQEMQRACFLVFSLFHVLTVLGNLLVIVTINASKTLHAPMYFFLCHLSFADMCYPSASTPKMIADTLVERKTISFKGCMTQLFSAHFFGGTEI
FLLTAMAYDRYVAICRPLHYETIMGRRKCGLLAGASWVAGFLHSILQTLLTVQLPFCGPNEIDSFFCDVHPLLKLACADTYVVGLIVVANSGMISLVSFIILIISYVVIL
LNLRSRSSESQRKALSTCGSHIIAVLLVLVPPMFMYIRPSTTLAADKLVILFNIVMPPLLNPLIYTLRNSEVKNAMRKIFRVKGSSRREVKLQGFS*
567 >lcl|XP_587725.3|Plus161415..62356 NW_001492989 olfactory receptor, family 1, subfamily E, member 2-like LOC510571 __SEG__ Chr11 {Bos taurus} MRRENQSSASEFLLLGLPIRPEQQGMFFALFLGMYLTTVLGNLLILLLIRLDPRLHTPMYFFLSHLALTDVSFSSVTVPNMLMSMQTQDQSMPYAGCIAQMYFFIFFTDL
DSFLITSMAYDRYVAVCRPLHYTTIMKQELCAFLVAGSWILSGASSLSHTLLLTQLSFCADNTIPHFFCDLGTLLKLSCSDIFLNELVMFTVGVVVITLPFTCILVSYGY
IGATILRVPSTKGICKALSTCGAHLSVVTLYYGSIFGQYLFPTLSDFIDKDIIVALMYTVVTPMLNPFIYSLRNKDIKGALGKLCSRAMFFLQ*
568 >lcl|XP_587727.4|Plus1125247..126191 NW_001493371 olfactory receptor Olr1654-like LOC510573 __SEG__ Chr15 {Bos taurus} MPGRNATVVTEFLLTVFADHPHWGLPLFAVFLGFYLLTLLGNCGMILLIRQDRRLHTPMYFFLGHLALVDICYSSTVVPQVLGVLLERGVVLSRARCATQFFLFTFFASM
DCYLLAIMAYDRCVAVCRPLLYVAIVTEKARWVLVVGAYAAGFSSALIRTVTAFTLSFCGNNQIDFIFCDLPPLLKLSCGDSYTQEVVIIVFAVLVMPTCILIILVSYAF
IVLAIVQMRSSGGRAKTFSTCASHLAAVALFFGTLIFMYLRDNSGQSSEADRVVSVLYTVVSPMLNPLIYSLRNKEVKGAVLKSLSRPKVSGRS*
569 >lcl|XP_587765.4|Plus12085204..2086139 NW_001495357 olfactory receptor 155-like LOC510603 __SEG__ Chr7 {Bos taurus} MSTKNRTASSDFILLGLLVNSKATGIVFAVILAIFVVAVTANLVMIFLIHMDSHLHTPMYFLLSQLSIMDTLFICTTVPKLLVDMVSIQKTISFVACGIQIFLYLTMIGS
EFFLLGLMAYDRYVAVCNPLRYPVLMNRRVCLLLAAGAWFGGSLDGFLLTPITMNVPYCGSCIIDHFFCEIPAVLKLACADTSLYETLMYICCVLMLLIPISIISTSYSL
ILLTVHRMRSAEGRKKAFTTCSSHLTVVSIFYGAAFYTYVLPKSFHTPEQDKVVSAFYTIVTPMLNPLIYSLRNKDVSGAFKKIFAQCLST*
570 >lcl|XP_587825.2|Plus12415225..2416346 NW_001492903 G protein-coupled receptor 45 GPR45 __SEG__ Chr11 {Bos taurus} MACNQSSIETYEYLLPNGSHEGDSRVPPPPATLRMSLAVLMMLMVVVGFLGNAVVCIIVYQRPTMRSAINLLLATLAFSDIMLCLCCMPFTAVTLVTVHWHFGDSFCRLS
AALYWFFVLEGVSILLIVSVDRFLIIAQRQDRLNPRRAKVIIAASWALSFCVSAPALAGWTLVEVPARAPQCVLGYTELPAGRAYVLTLVGAAFFIPFAVMLGAHLGVLH
AVRKNAVRVHNQSERLDLRRLPRACLRRLRRQQQQASLDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSVFSRRFYCGPSFYATSSCVLGLSYLKSVFNPIVYCWRIK
KFREACLELLPPTFQILPKVPERIRRRIQPSTVYACTENQSAV*
571 >lcl|XP_587848.3|Plus12195883..2196809 NW_001492801 olfactory receptor, family 4, subfamily N, member 2-like LOC510676 __SEG__ Chr10 {Bos taurus} MKIENSTAVTEFILLGLTQSQNIQLLVFVLILIFYLIILPGNFLIILTIRSDPGLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EGLLLVVMAFDRYIAICRPLHYSTVMNPRTCYALLLVLWLGGFVHSIIQVALILRLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLASYAI
ILCRISGSASEGKSKALSTCTTHVIIILLMFGPAIFIYTRPFTALSADKVVSFFHTVIFPLMNPVIYTLRNQEVKASMRRILSRHVFF*
572 >lcl|XP_587911.3|Plus1268447..269388 NW_001492991 olfactory receptor Olfr335-like LOC510731 __SEG__ Chr11 {Bos taurus} MRRENQSSVSEFLLLGLPIQPEHQSVFFALFLGMYLITVLGNLLILLLIRLDSRLHTLMYFFLSHLAFSDVSFSSVTVPKMLVNMQTQDQSIPYAGCIAQMYFFLLFVCL
DNFLLAVMAYDRYVAICQPLHYTTIMRGGLCVLLVAGSWFFSCVHALLHTLLLSRLSFCADNNIPHFFCEPAALLKLACSDISLNELVIFTEGGVFAFLALSAILGSYIH
IGATILRVPSIKRICKALSTCGSHLFVVFLYYGTVAMIYFFPSTNNSKVKDTIASLMHTVVTPMLNPFIYSLRNRDMKSALGILYKKGIIFAK*
573 >lcl|XP_587940.1|Plus1complement(2423180..2424337) NW_001495330 sphingosine-1-phosphate receptor 4 S1PR4 __SEG__ Chr7 {Bos taurus} MNATGTPTGDPESCQLLAAGGHSRLIVLHYNHSGRLAGRAGAEEVGLGVLRGLFVAVSCLVVLENMLVLVAIASRMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGAH
TFRLAPSQWFLREGLLFMALAASTFSLLFTAGERFATMVRPVAESGATKRGRVCSFIGLCWLLAALLGLLPLLGWNCVCAFQRCSSLLPLYSKDYILFCVVVFACILATI
MVLYGAIFRVVRANGQKAPSIPARRKAQRLLKTVLMILVAFVVCWGPLFGLLLADIFGSNVWAQEYLRGMDWILALAVLNSAVNPIIYSFQSREVCRAVVGFLCGACLRL
GLRGPGDCLAQAVEAHSAASNTDSSLRPRDSFRGSRSHSFRMREPLTSVSSVRSV*
574 >lcl|XP_587968.4|Plus112179..14575 NW_001495372 protocadherin alpha 4 PCDHA4 __SEG__ Chr7 {Bos taurus} MEFSWGTGQEYRRLLLSLLFLAAWKAGSGQLRYSVLEEAKHGTFVGRIAQDLGLELAELVPRLFRVSSKGRGDLLEVNLQNGILFVNSRIDREELCGQSAECSIHLEVIV
DRPLQVFHVEVEVKDINDNPPVFPGTQKILFMAESRPLDSRFPLEGASDADIGANALLTYRLSPNEYFSLEKPSDEERVKRLGLVLRRPLDREEAPEIFLVLTASDGGKP
ELTGTVQLLVRVLDANDNAPTFDRTLYEVKLLENVPNGTLVIKLNASDLDEGLNGNIIYSFSADILPIVKSKFYMDPITGEIMVKGYIDFEETKSYEILVEGIDKGQPPL
SGHCTVMVEVEDTNDNAPVMEFKFLSLPIREDAPLGTVIALISLSDLDSSVNGQVTCRLSPHVPFRLVSTFKNYYSLVLDSTLDREKVSVYKLVVTAQDGGSPSLSTTAS
VSVEVADVNDNAPAFTQPEYTVFVKENNPPGCHIFTVSARDADAQENALVSYSLVERRVGERELSSYLSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVT
LQVFVLDENDNAPALLPPGPSGGSSAVSQVVARSVGAGHVVAKVRAVDADSGYNAWLSYELQPAGDGARSLFRVGLYTGEISTTRALDEADAPRQRLLVLVKDHGEPALT
ATATVLLSLEDSGQAPKASSRALSGAAEAEAVLVDVNVYLIIAICAVSSLLVLTLLLYTALRCSAPPSEGACGPVKPRLVCSSAVGSWSYSQERRQRVCSEEGPPKTDLM
AFSPSVPDSGDREDQQPATVDSLSKVSL*
575 >lcl|XP_588061.2|Plus1594139..596616 NW_001495372 protocadherin gamma subfamily A, 10 isoform 2 PCDHGA10 __SEG__ Chr7 {Bos taurus} MAAQRNRSYLSALIQLCLLYMSWETEARQIRYSVPEELEKGSFVGNISKDLGLEPRELAERGVRIVSRGRTQLFALNPRSGSLVTAGRIDREELCAQSARCLVSFNILVE
DRVKLFGVEIEVTDINDNAPKFQAENLDVKINENVAPGMRFPLPEAVDPDVGVNSLQSYQLSSNKHFSLAVQSRVNGVKSPELVLEHALDREEEAMHRLVLTAVDGGDPL
RSGTVLISVTVFDTNDNAPVFSLPEYRVSVSENLPVGSRLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKNTGEIKLSENLDYEETGFYEIEIQAEDGGAYLATA
KVLITIEDVNDNSPEVTITSLFSPLMEDSPLGTVIALLNVHDLDSGQNGQVTCSILGNLPFKLEKSIDSYYRLVTHKVLDREQVSSYNITLKATDGGSPPLSTETHFILQ
VADINDNPPTFSHISYFTYIPENNPRGASIFSVTALDPDSKENAQVIYSLAEDTIQGAPLSSYVSINSDTGVLYALRSFDYEQFRNLKMQVTATDSGDPPLSSNVSLSIF
VLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSLVVVVQDHGQPPLSATVTLT
VAVADSIPDVLADLGSLEVPPASDASDLTLYLVVAVAAVSCVFLAFVIVLVALKLRGWHTSRLLQASGGGLGVPASHFVGVDGVRTFLQTYSHEVSLTADSRRSHVIFPQ
PNYADTLISQESCEKKDPLSLLDDSKFPVEDTPLVPVSSIFAPFLTFKNYDQFYS*
576 >lcl|XP_588102.1|Plus11892002..1892940 NW_001495357 olfactory receptor, family 2, subfamily B, member 2-like LOC510877 __SEG__ Chr7 {Bos taurus} MAWENHTLNSNFILLGIFDHSPTHIFLFSLVLGIFTVAFMGNTIMVLLIYLDTQLHTPMYLLLSQLSLMDLMLICTTVPKMTFNYLSGKKSISLAGCGTQIFLYVSLLGA
ECFLLAAMAYDRYVAICHPLRYSILMSQKICCLMAVSSWVVGSFDGIIVIAVALSFPYCGSREIPHFFCDVPALLTLSCTKTLLFERLMFICCVIMLLFPVAVIIASYVH
VIMAIICMGSGEGRRKAFATCSSHLMVVGMYYGAAMFIYMRPVSDRSPTQDKMVSAFYTILTPMLNPLIYSLRNKEVARAFMKVLGKDKSGE*
577 >lcl|XP_588128.4|Plus1351267..352196 NW_001493367 olfactory receptor 1264-like LOC510901 __SEG__ Chr15 {Bos taurus} MAETHNVTEFIFLGLSSNPEVQKVCFVMFLLLYTAIVLGNLLIVLTVMSSRSLGSPMYFFLSYLSFVEICYASTTVPRLISDLLAERKAISLWGCMTQLSFLHFFAGTEI
FLLTVMAYDRYVAICKPLSYTTIMNRRVCAFLVGAAWVWGLVHSLAQILLIFRLPFCGPNVIDHYFCDVLPLLKLACSDTVLIGLLIVANGGTLSVISFVVLLASYVVIL
LHLRTRSSAGRRKALSTCGSHITVVTLFFGPCIFIYLRPSTTLSVDKTVAVFYTVITPLLNPVIYSLRNAEVKKAMKRLWVRAMKLEER*
578 >lcl|XP_588129.2|Plus1345060..345989 NW_001493367 olfactory receptor 1270-like LOC510902 __SEG__ Chr15 {Bos taurus} MARTNNVTELIISGLFQDPEVQRACFAVFLPMYLATVVGNGLIVLTVRVSKSLRSPMYFFLSHLSLVEISYSSTVVPKFITDLLSRIKTISLEGCVAQIFFFHLFGVAEI
FLLTVMAYDRYVAICKPLHYTIIMSRPVCHRLAAASWLGGIIHSMVQILVTVQLPFCGPNVIDHYFCDLHPLFKLACTDTFVEGIIVLTNSGLISVFSFLLLVSSYIVIL
VNLRNHSAEGRRKALSTCASHVTVVVLFFGPAIFLYMRPPSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKIALKRLWGRKVNSGVE*
579 >lcl|XP_588225.5|Plus1complement(627902..628834) NW_001494524 olfactory receptor Olr1242-like LOC510984 __SEG__ Chr29 {Bos taurus} MAPGNGSFVTKFILLGLTNQPDLQLPLFFLFLGMYMVTVLGNLGLIMLIALNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINFLSKKNIISYMGCMTQLYFFCFFVIS
ECYVLTSMSYDRYVAICNPLLYNAAMSPKVCSSLMLGSYLMAFSGAMAHTGCMLRLTFCDVNTINHYFCDILPLLELSCASIYVSELEVFIIGGINIIVPSLTIFVSYGL
ILTNILHISSTKGRSKAFSTCSSHIIAVSLFFGSGAFMYLKPPSAVSLDEGKISSIFYTNMIPMMNPLIYSLRNKDVKLALRKTLSRRQF*
580 >lcl|XP_588373.4|Plus1complement(195358..196269) NW_001494174 Olfactory receptor 2J3-like LOC511103 __SEG__ Chr23 {Bos taurus} MNATSEAYFVLLGFSNWPHLEVVLFVVVLVFYLMTLTGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSFIPQLLVNLWGPGKTISYTGCMIQLYFVLALGCTECV
LLMVMSYDRYAAVCRPLHYSILMHPRFCHLLAVASWVSGFTNSALHSFFTFWVPLCGHRQVDHFFCEVPALLRLSCIDTRANELTLMVTSSIFVLIPLILILSSYGAIAR
AVLRMQSTTGLQKVFGTCGAHLMVVSLFFIPVMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVKSLVG*
581 >lcl|XP_588414.2|Plus1complement(325497..326429) NW_001494174 olfactory receptor-like LOC539623 __SEG__ Chr23 {Bos taurus} MKEKNASSGYFVLLGFSNWPHLELVLFVVVLMFYLMTLIGNLFIIFLSYLDSHLHTPMYFFLLNLSFLDLCYTTSSIPQLLFNLQGPEKTISYAGCMIQLYFVLALGTAE
CVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTASALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHANELTLMVMSFIFVIIPLILILSSYGAI
AQTVLRMQSTTGLQKVFGTCGAHLMVVSLFFIPIMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVKGAVKRLMGWGREM*
582 >lcl|XP_588419.1|Plus12004852..2005811 NW_001495357 hypothetical protein LOC511141 __SEG__ Chr7 {Bos taurus} MNGNNKTFSSDFTLAGLFTNNKASGFLFSIICAIFFMAIIVNGVVIFLIYIDPHLHTPMYFLLSHLSFIDIMYISTIVPKMLADYLEGERTISFIACTAQYFLYMGFVGA
EFFLLGLMAYDRYVAICNPLRYPVLMSHRVCWMILASSWFGGALDSFLLTPITMTLPFCASHKINHFFCEAPTMLRLACGDKAAYEMVMYICCVMMLLIPFSVVIASYAG
VLITVHQMKSAEGKKKAFATCSSHMMVVILFYGAALYTYMLPQSYHTPTKDKVFSVFYTIITPLLNPLIYSLRNRDVAEAFKRVLARCLGTHFMTRGEF*
583 >lcl|XP_588566.3|Plus1847443..848372 NW_001495357 olfactory receptor, family 2, subfamily G, member 6-like LOC511266 __SEG__ Chr7 {Bos taurus} MQWTNGSRLLGFILVGFSDRPQLELILFGVILFLYFMTLLGNSTIILVSLLDSKLHNPMYFFLSHLSFLDLCCSSSITPQLLVNLGSSNKSITYGGCVVQLYVSLALGST
ECVLLAVMSYDRYVAVCRPLHYAFVMHPRFCNILASMAWLSGVTTTLIQSTLTLQLPFCGNRKVDHFFCEVPVLIKLACVDTTFNQAELFVASVLFLVVPLSLILLSYGN
IAQAVLKIKSAIGRRKAFRTCSSHLMVVIIFYGTIIFMYLQPAKSRSKDQGKFVSLFYTVVTPMLNPLIYTLRNKEVKAALKKFMGKTL*
584 >lcl|XP_588576.1|Plus1548551..550995 NW_001495372 protocadherin gamma subfamily A, 5 PCDHGA5 __SEG__ Chr7 {Bos taurus} MADPLRGWGCSEPFLLFILLGTLWEAGAGHIRYSVPEELDKGSFVGNIAKDLGLEPRELEERGVRIVSRGRTQLFALNPRSGSLVTADRIDREELCAQSARCLVSFNILV
ENKMKMYGVEVEITDINDNFPRFRDEEVKVKVNENAAVGTPLVLPFARDADVGVNSLQRYQLSSNIHFSLDEKSGGDGQKYPELVLEQPLDREKVPVHDLLLTALDGGDP
ILSGTTHIHVMVLDANDNAPLFTQPEYRVSVPENIAVGTRLLTVTATDPDEGINGKLTYSFRNEEEKISETFQLESNLGEISTVQPLDYEESRFYNMEVVAQDGGALLAS
AKVLITVQDVNDNAPEVLLTSLSSTVSEDCLPGTIIALFSVHDGDSGENGEIVCSIPRNLPFKLEKSVDNYYHLLTTRALDREEISDYNITVTVTDCGNPPLSTENHIFL
KVADINDNPPIFLHTSYYTYIPENNPRGISIFSVNAHDPDSGNNAQVTYALAEDKFQGTPLSSYVSINSDTGALYALRSFDYEQVRELQLWVTASDNGDPPLSSNVSLSL
FILDQNDNAPEILYPALPIDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFTVGLHTGEVRTARALLDRDAIKQNLVVVVQDHGQPPLSATVTL
TVAVADSIPDVLADLGSLEPSTDPDDSGLTLYLVVAVASVSCVFLAFVIALLTLRLRRWYTSRTLQASGSGLAGLPASHFVGVDGVRAFLQTYSHEVSLTADSRGSHVVF
PQPNYADTLISQESCEKSEPLLIPEKISAKERELEVLQVSFLFQ*
585 >lcl|XP_588627.2|Plus1complement(560287..562413) NW_001494903 leucine-rich repeat neuronal protein 3-like LRRN3 __SEG__ Chr4 {Bos taurus} MKDLPLQIHVLLGLAITTLVQAVDKKADCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGLSNFPARLPADTQILLLQTNNIAKIEYSIDFPVNLTGLDLSQNNLSSVTNI
NVKKMPQLLSVYLEENKLTELPEKCLSGLSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFEALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIA
GINLTEIPDNALVGLENLESISFYDNRLIKVPNVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISIDSLAVDNLPDLRKIEATNNPRLSYIHPNAF
FRLPKLESLMLNSNALSALYQGTVESLPNLKEISIHSNPIRCDCVIRWINMNKTNIRFMEPESLFCVDPPEFQGQNVRQVHFREMMEICLPLIAPESFPSNLDLEAGSYV
SLHCRATAEPQPEIYWITPSGKKLLPNTLTNKFYVHSEGTLDISGITPAEGGLYTCIATNLVGADLKSVMIKVDGSLPQDNNGSLNIKIKDVQANSVLVSWKASSKILKS
SIKWTAFVKAENSHAAQSARIPSDVKVYNLTHLNPATEYKICIDIPTIYQTSRKQCVNVTTKGLDPDQKEYEKNNTTTFMACLGGSLGIIGVICLFSFLSQEVNCDGGHN
YVRNYLQKPTFAFSELYPPLINLWETGKEKGTALEVKATVIGVPTNMS*
586 >lcl|XP_588730.4|Plus13796377..3797309 NW_001494955 olfactory receptor OR7-15-like LOC511400 __SEG__ Chr4 {Bos taurus} MEGNQSQITEFILVGFQLSKNMELLLFGIFSLLYVCNLLANGMILGLICFDPRLHSPMYFFLSHLAIIDISFPSSNLPTFLENLVKHTKSISFDPCTVQMLFNLTFGSIE
CLILLAMSYDRYVAICHPLQYTVIMNWRVCSILAIACWVCGFALALVQVILLLRLPFCGPQKVNHFLCDIRSVLKLACGDIWMNEMFLFADGVLILVGPLALVLVSYMHI
LWAILKIQSKEGRKKAFSTCSSHLCVVGFYFGLAMIVYMVPDNSQQEEHLKILFLFYTLFNPLLNPLVYSVRNAQVKAAFHRVLQKKRTM*
587 >lcl|XP_588731.4|Plus13737531..3738463 NW_001494955 olfactory receptor OR7-15-like LOC511401 __SEG__ Chr4 {Bos taurus} MEGNQSQITEFILVGFQLSEDLKLLLFGIFSLLYTFNLLANGMILGLIWFDPRLHSPMYFFLSHLGLIDIFYASSNLPNLLANLAKHKKTISFVPCNLQMLLILSFGSVE
CLILLAMSYDRYVAICHPLQYTVIMNWRVCSILAIACWVCGFALALVQVILLLRLPFCGPQKVNHFFCEIRSVLKLACGDIWMNEMFLFADAALILVGPLSLILVSYMRI
LWAILKIQSKEGCKKAFSTCSSHLCVVGFYFGLVMIVYMVPDNSQREEHLKILFLFYTLFNPLLNPLVYSVRNAQVKAAFHRVLQKKRTV*
588 >lcl|XP_588857.3|Plus1complement(2606645..2607595) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC511509 __SEG__ Chr19 {Bos taurus} MTGRNQNVVSEFLLLGLPIESEHQNLFFVLFLAMYVTTILGNLLIIVLICLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQDMQSQDPSISYASCLTQMYFFLFFADL
EDFLLVAMAYDRYVAICFPLHYTTIMSPRLCSFLVVLSWVLTMVPAMLYTLLMARLCFCEDNVITHFFCDMSALLKLSCSDTRVNELVIFVVGGLIIVLPFLVIIMSYAR
IIFSILKVPSVKGICKAFSTCGSHLTVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKGALGRVFCKKKFHFFLSW*
589 >lcl|XP_588870.1|Plus1238075..239061 NW_001493330 pyrimidinergic receptor P2Y6 P2RY6 __SEG__ Chr15 {Bos taurus} MAWDNGTGQALDAPPTNCVYRENFKHLLLPPVYSAVLAVGLPLNACVIAQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDLTCRLVRFLFYANL
HGSIFFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCGAVWLAVTTQCLPTALFASTGIQRNRTVCYDLSPPALATRYMPYGMTLTVIGFLLPFVALLACYCCLARRLC
RQDGPAGPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVSCPVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRQRPHKLLQKLTAKWQRQGR*
590 >lcl|XP_588888.3|Plus12212070..2212891 NW_001495310 testis-specific serine kinase 6-like TSSK6 __SEG__ Chr7 {Bos taurus} MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGG
QARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGL
PRRQKRGVLYPDGLELSERCKALIAELLQFSPSARPSAGQVARNGWLRAGDSG*
591 >lcl|XP_588929.2|Plus1complement(628715..629662) NW_001493314 olfactory receptor 78-like LOC511569 __SEG__ Chr15 {Bos taurus} MTAHQNGSISTEFSDFLLNCFVRSPSWQHWLSLPLSFLLLLALGANMTLLITIWLETSLHEPMYYLLSLLSSLDTVVCLTVIPKVLAIFWFDLRSISFFACFFQMFIMNS
FFAMESCTFMVMAYDRYVAICHPLRYPSIITNQFITKAAIFILSRSVFLTLPIPILSGRLHYCGRNVIENCICANMSVSRLSCNDITINRLYQFAGGWTLLGSDLLLIFL
SYTFILRAVLRLKAQGAVAKALSTCGSHFILILFFSTILLVFVFTLLVEKKMSSDVPVLLNVLHHVIPAALNPIVYGVRTQEIKQVIQKLLKKGW*
592 >lcl|XP_588930.1|Plus1complement(614131..615078) NW_001493314 olfactory receptor, family 51, subfamily E, member 2-like LOC511570 __SEG__ Chr15 {Bos taurus} MTAHQNGSTSTEFSDFYLNCFVRSPSWQHWLSLPLSLLFLLAMGANTILLITIRLEASLHEPMYYLLSLLSLLDMALCLTVIPKVLAIFWFDLRSISFFACFLQMFTMNS
IFAMESCTFMVMAYDRYVAICHPLRYLSIITDQFVVKAAIFILARSIFLTVPIPILSGCLHYCLENVIENCLCANMSVSKLSCGDIIINRLYQFACGWTLLGFDLILIFL
SYTLILRAVLKLKSEGAVAKALSTCGSHFILILFFSTVLLVFVFTLVVEKKVSSDVPVLLNILHHVIPPALNPIVYGVRTQEIKQGIQRLLKKGW*
593 >lcl|XP_588950.2|Plus1complement(100602..101549) NW_001495357 olfactory receptor MOR276-1-like LOC511586 __SEG__ Chr7 {Bos taurus} MGIWLNQSSIDGFILLGIFSHSQADFALFSVVMVVFTVALCGNVLLVCLIYMDPRLRTPMYFFLSQLSLMDLLLVCDIVPKMAFNFLSGRKFISFVGCAIQIGFFVSLVG
SEGLLLGLMAYDRYVAISHPLHYPILMSQKVCLQIAGSSWTFGIIDGMIQMVGAISLPYCGPRNVDHFFCEVPALLKLACVDTSIFDSLLFACCIFMLLLPFSIIVASYA
RILGAVLHMHSAHARKKALATCSSHLTAVSLFYGAAMFIYLRPRHYRAPSHDKVVSLFYTVLTPMLNPLIYSLRNREVMGALKKGLDHCRVGNWH*
594 >lcl|XP_589001.5|Plus1complement(246838..247761) NW_001494174 Olfactory receptor 2J3-like LOC511626 __SEG__ Chr23 {Bos taurus} MMERINASSEDNFVLLGFSNWPQLELVLFVVILMFYLMTLIGNLFIIILSHLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLINLWGPVKTISYNGCMIQLYFFLALGS
TECVLLMVMSYDRYAAVCRPLHYTVLMHPRFCQLLAVACWVSGFSNSALHFLFAFWVPLCGHRQVDHFFCEVPALLRLSCVDTHANELTLMVTSSIFVLIPLILILSSYG
AIAWAVLRMQSTTGLQKVFGTCGAHLMVVSLFFIPVMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKDVRGAVKRLVG*
595 >lcl|XP_589020.3|Plus1complement(385349..386278) NW_001501761 olfactory receptor, family 7, subfamily A, member 17-like LOC511642 __SEG__ Chr7 {Bos taurus} MKPQNLTDVSEFLLLGLSDDPDMQPLLFGLFLSMYLVTVLGNLLIILAVSSNSHLHTPMYFFLSNLSLTDVSFSTTTIPKMLVNLQTHSKSITYAGCLTQLTFFSLFAFL
ESLLLTVMAYDRLVAICHPLHYLVIMNPRFCGLLVLVSFSISLLTSLLHCLMVSQLTFCEDVEVPHFFCELSQLLNLSCSDTFINNILIYFIGAILGGVPLSGIIYSYTQ
ITSSILRVSSSYGKYKAFSTCGSHLSVVCLFYGTGLGVYLSSTVSSSHRKSAVVSVMYTVVTPMLNPFIYSLRNKDIKSTLWRIIIKKA*
596 >lcl|XP_589039.4|Plus1complement(522639..523583) NW_001494525 Olfactory receptor 8B3-like LOC511657 __SEG__ Chr29 {Bos taurus} MLARNDSLVTEFILAGLTDRPELQQPLFHLFLVIFVVTMVGNLGLIILIGLNSHLHTPMYYFLFNLSFIDLCYSSVFTPKMLMNFVFSENTISYVGCMTQLFFFLFFVIS
ECYMLTSMAYDRYVAICNPLLYKVSMSHHVCLVLSLAAYVIGFAGASVHTGCMLRLTFCNVNVINHYLCDILPLLQLSCTSTYVNEVVVLIVVGINITVPSFTILISYIF
ILTSILHIKSSQGRSKAFSTCSSHMIALSLLFGSAAFMYLKYSSPGSMEQGKISSVFYTNVVPMLNPLIYSLRNKDVKVALRRSVFKIQRINMF*
597 >lcl|XP_589063.4|Plus1complement(59469..60407) NW_001501761 olfactory receptor, family 7, subfamily G, member 1-like LOC511678 __SEG__ Chr7 {Bos taurus} MGPRNKTGILEFLLMEVTEDPELQPLHFILFLFIYLVTILGNLLIIMAVISDSHLHTPMYFFLYNLSFTDICLSTTTIPKMLVNIQTQNQSITYTGCLTQLCFILVFVGL
ENSLLAVMAYDRYVAICHPLRYMAIMNFPLCGQLILFSLFISIVDALLHSLMVLQLTFCTDLEIPLFFCEVVQVIKLACSDTLINNILIYLATSIFGGIPVCGIIFSYIQ
IVSSVLRMPSASGKYKAFSTCGSHLSVVSLFYGTGFGVYISSALTNSSRNTAVLSMMYTVVPQMMNPFIYSLRNRDMKRALRKLIVRTSSFL*
598 >lcl|XP_589097.3|Plus1complement(1298504..1299229) NW_001492832 myeloid cell leukemia sequence 1-like LOC511709 __SEG__ Chr10 {Bos taurus} MESLISDAIMSPEEEPDGCKPDPLGKRPAVRPLPLLVREASNNSPGSDGLLPSTPPPAEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDG
VQHNHETAFQGVLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLEGGIR
NVLLAFAGVAGVGAGLAYLIR*
599 >lcl|XP_589134.3|Plus1complement(2460..3404) NW_001505431 olfactory receptor, family 1, subfamily F, member 1-like LOC511741 __SEG__ Chr11 {Bos taurus} MERLNQTSSVSEFILLGLSSQPEDQKPLFILFLIMYLVTITGNLLIILAIRSDPQLHTPMYFFLSVLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFIYALGNT
DSCLLAVMAYDRYVAICDPFHYVTIMSHRRCVLLVAFSCSLPHFHSLLHTLLLNQLTFCDSNIIHNFLCDLSPLIKLSCSPTFVNEIVILIEGSFILVTPFLCITFSYIQ
ILIAVLKIPSASGKRKAFSTCGSHLTVVTLFYGSIFYVYLQPVSTYTVRDHMATIVYTVLSSMLNPFIYSLRNKDLKQGLRKLVGRRKPQAAPS*
600 >lcl|XP_589238.3|Plus1complement(137598..138533) NW_001502065 olfactory receptor, family 52, subfamily E, member 2 (predicted)-like LOC511823 __SEG__ Chr15 {Bos taurus} MSLPNDTQFHPSFFLLLGVPGLETLHIWIGFPFCAVYLTALIGNFTILFVIQAESRLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFSLKEILFEACLTQMFFIHNFT
GMESAVLLAMAYDRYVAICNPLRYSTILTNRVISMIGVGVLVRSFISVIPFIFLILWLPFCENQVIPHTYCEHMGLARLSCASIKINIIYGLGAMSILVFDIIAIALSYV
QILRAVFRLPSHEARLKSLSTCGSHVCVILAFYTPALFSFMTHRFGQNVPRYIHILLANLYVTVPPMLNPVIYGVRTKQIYGRVKKMLLQK*
601 >lcl|XP_589282.2|Plus1complement(268804..269880) NW_001494127 chemokine (C-C motif) receptor 3 isoform 1 CCR3 __SEG__ Chr22 {Bos taurus} MATSADGIETVGEVAGTTPYDYEAALPCEKSNVKELAAQFLPPLYSLVFVTGLLGNVVVVVILTKYKRLRIMTNIYLLNLAISDVLFLFTLPFWIHYVRWNEWVFGHRMC
KLLSGLYYMGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIVTSIFTWVLAGLAALPEFFFHETQEEAGQTFCSPLYPEDNENAWKRFHALRMNILGLALPLLVMA
ICYSGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYNLVVLLFAFQMHLKADCEQSRQLDLAMLVTEVIAYTHCCVNPVIYAFVGERFRKHLRHFFHRYMATYLGKF
MPFLPSEKLERTSSVSPSTGEQELSAVF*
602 >lcl|XP_589284.4|Plus1complement(417930..418859) NW_001493369 olfactory receptor 480-like LOC511865 __SEG__ Chr15 {Bos taurus} MDTGNCSSLTEFIFLGITDNTKTKVILFTMFLLVYLITLLANLGMITLIRMDPQLHTPMYFFLSHLSFCDLSISTAVGPKMLVDLLAKNKSIPFYGCALQLLVLYTFIDC
ECLLLAVMAYDRYKAISSPLLYAVSMSSGVCSLLMAGVYLVSIAETLIHMTLAFRLCFCGSNEINHFFCDVAPLLLLSCSDTQVNELLIFTAFGFIELSTISGVLVSYCY
IILSVLKIHSAKAGFKAFSTCISHLTSVAIFQGTMLFMYFRSSSSYSLDEDKMTSLFYTLVIPMLNPLIYSLRNKDVKQTLKKLKDKWF*
603 >lcl|XP_589285.2|Plus1879060..880145 NW_001494701 cannabinoid receptor 2 (macrophage) CNR2 __SEG__ Chr2 {Bos taurus} MEICLKIEAANGSSDGLNFNPMKEYMILSGPQKIAIAVLCTLLGLLSALENLVVLYLIGSSHRLRKKPSYLFIGSLAGADFLASVVFASSFVHFHVFDGVDSKAVFLLKI
GSVTLTFTASLGSLLLTAIDRYLCLRYPPTYKALLTRRRALVTLGIMWVLAALVSYLPLMGWTCCPRPCSELFPLIPNDYLLGWLLFIAALFAGIIYTYAHVLWKAHQHV
ASLAEHRDRHLSGIARMRLDVRLAKTLGMLLAVLFIFWFPVLALMVYSLGARLSDQVKKVFAFCSLLCLVNSMVNPIIYALRSGEIRSSAHHRLARWKKCVRGLGPEGKG
EIPRSSVTETEADVKTTPGLDSRELSWPDEL*
604 >lcl|XP_589404.2|Plus1complement(1599015..1599545) NW_001495428 low density lipoprotein receptor-related protein associated protein 1-like LOC511975 __SEG__ Chr8 {Bos taurus} MKEESVEKGRVGKALEESHENAIRPVDLSGVQTEALASRHAELKDRLRSIGQGFDWLRRVSHQGYGAETEFTEPRVLDPWDMAKSANFTEKELESFREELKHFEVKIEKH
NHYQKQLEISHRKLKHVESFGDQEHVTRNKERYAMLEEKTKELGYKVKKHMQDLSSRISRARHNEL*
605 >lcl|XP_589475.4|Plus1complement(2527937..2528872) NW_001494522 olfactory receptor, family 8, subfamily D, member 4-like LOC512037 __SEG__ Chr29 {Bos taurus} MGVRNQSTVTEFLFAGLTDQPELQLPLFCLFFGIYVVTAVGNLSMILIIRLSSQLHKPMYYFLSSLSFIDFCYSSVITPKMLAGFLCRDKAISYSGCMTQLFFFCIFIIS
ECYMLAAMAYDRYVAICSPLFYNVIMSPRVCSLLVAAVFSVGFTDAMMHGGFMLRLTFCKSNIIKHYFCDIVPLIKLSCSSTYIDELLIFVIGGFNMVATSMTIITSYAF
ILSSIFRIHSKEGRSKAFSTCSSHLTAVLVFYGSLMSMYLKPASSSSLTQEKVSSVFYTNVIPMLNPLIYSLRNKEVKNSLMKLLRRKISS*
606 >lcl|XP_589528.4|Plus1182949..183887 NW_001492804 olfactory receptor 1307-like LOC512085 __SEG__ Chr10 {Bos taurus} MDGANQSVVSEFLFLGLTNSWEIQLLLFVFSSTFFMASMMGNSLIILTVTCDPHLHSPMYFLLANLSFIDMGVSSVTSPKMIYDLFRKRKVISFSGCITQIFFIHVIGGV
EVVLLIAMAFDRYVAICKPLHYLTIMSPRLCISFLVAAWMVGLIHSTVQLVFVVNLPFCGPNMLDSFYCDLPRLIKLACIDINQLESMVTANSGFISIGSFFILIISYIV
IILTVQKHSSTGSSKALSTLSAHITVVVLFFGPLIFVYTWPSPSIHLDKFLAIFDAVLTPFLNPVIYTLRNQEMKVAMRRVCRQLVSYRKIS*
607 >lcl|XP_589585.2|Plus1complement(675968..676942) NW_001495357 olfactory receptor 222-like LOC512138 __SEG__ Chr7 {Bos taurus} MRSDNQSIWGDPLKDFILLGVSDRPWLELPLFVVLLVSYVLAMLGNISIILVSRLDPQLHSPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSSKTISYSGCTVQYAIFHW
LGCTECIILAAMALDRYVAICEPLRYTIIMHRPLCQQLVAVAWLSGFGNSLVQVVLTVQLPFCGRQVLNNFFCEVPAMIKLSCTDTAVNDTTLAVLVAFFVLVPLALILL
SYGFIVRAVFRIQSSKGRHKAFGTCSSHVVVVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFIYTLRNKDVKGALRRLLARIWRFCIRYRPEMW*
608 >lcl|XP_589690.2|Plus1328695..329624 NW_001493367 olfactory receptor 1264-like isoform 1 LOC512220 __SEG__ Chr15 {Bos taurus} MAKTHNVTEFIFLGLSSNPEVQKVCFVMFLLLYTATVLGNFLIVLTVRSSRTLGSPMYFFLSYLSFVEICYASTTVPRLISDLLAERKAIPLWGCMSQVFFIHFFGGIEM
FLLTVMAYDRYVAICKPLSYTTIMSRQACALLVGAAWVGGFVHSLAQILLIFHLPFCGPNVIDHYFCDVLPLLKLACSDTVLIGLLVVANGGTLSVISFVVLLASYVVIL
LHLRTRSSTGRCKALSTCGAHVTVVTLFFGPCIFIYLRPSTTLSVDKTVAIFYTVITPLLNPVIYSLRNAEVKKAVRRLWVRAIKLEER*
609 >lcl|XP_589764.4|Plus1complement(1606511..>1607506) NW_001495047 olfactory receptor, family 5, subfamily I, member 1-like LOC512280 __SEG__ Chr5 {Bos taurus} QPRVRLLILLCTSLQVSAMGDRGTSNYSDMTDFILVGFRVRPELHILLFLLFLLVYAMILLGNVGMMVIIITDPQLNTPMYFFLGNLSFIDLVYSSVIAPKAMSNFWSER
KSISYEGCVTQLFLFALFIVTEGFLLAVMAYDRFIAICNPLLYTVQMSTRLCAQLVAGSYFFGCISSILQTSMTFTLSFCASRAIDHFYCDTRPLQRLSCSDLFILRMVS
FTLSGLITLPTIIVIVISYLYIVSTVLKIPSTEGRKKAFSTCSSHLGVVSVLYGAVFFMYLTPDTFPELSKVASLCYTLLTPMLNPLIYSLRNKDVKEALNKLLEKKSTI
L*
610 >lcl|XP_590090.1|Plus1complement(2571507..2572475) NW_001494522 odorant receptor MOR10-like LOC512551 __SEG__ Chr29 {Bos taurus} MIRETEDPNQTVVDFFFLEGLMYTAEHPSLFFLLFLLIYSITVTGNLLILITVGSDPHLCSPMYHFLAHLSFLDACLSTVTVPKVMAGLLTPDGKVISFEGCAIQLYCFH
FLASTECFLYTVMAYDRYLAICRPLHYPVAMNRRMCAGLAGITWTMGAVHSALHTCLTFHLLYCGPRHIAYFFCDIPPVLKLACADTTVNELVMLANIGIVAAGCLILIV
ISYVFIAAAVLRIRTAEGRKRTFSTCTSHLTVVLLYYMPPVCIYLQPRSSGAGVGAPTVFYTIVTPMLNPFIYTLRNTEVKQALRRLLGQGSRDSPAGSLLR*
611 >lcl|XP_590118.3|Plus1564498..565454 NW_001494175 olfactory receptor, family 12, subfamily D, member 3-like LOC512579 __SEG__ Chr23 {Bos taurus} MENVTTVNEFLLLELTSTQELRPVLFVTLLIIYMIDLFGNGSILVAVISEPRLYSPMYFFLGNLSCLDICYSSVTLPILMANLLSAHKAVSFLGCITQLHFFHFLGCTES
ILLAIMGFDRFVAICYPLRYTLIMNLKACILLATVAWITSFFYALMHSVMTARLNFCHSLKLNHFFCDVKPLLELACGDIRLNQWLIFIVTGSLAMIPCFFTFLSYLYII
SFLLFKNHTCRVLHKALSTCASHLMVVSLFYGTVGLTYIAPTSATSVIQEWYVTVIHTTVTSLLNPLIYTLRNKEVKLALSRVFGRKLKLPKENHWQH*
612 >lcl|XP_590171.4|Plus1complement(83655..>84635) NW_001501761 olfactory receptor, family 7, subfamily A, member 17-like LOC512624 __SEG__ Chr7 {Bos taurus} LSCYHILFIRFISIMEPRNQTAVSEFLLMRLTENEKLKTILFNLFLSMYLVTVLGNLLIILAVIFDSHLHTPMYFFLSHLSFTDIGLSTTIIPKILVNMQAQSQRITYTG
CLTQICFVLILVCWESFLLGAMAYDRYVAICHPLRYTVIVNPHLCVMLTLLSLFISIGNALLHTLMVLPLSFCKELEISLFFCEVVQVIKLACSDTLINNALLYFAISLL
GGIPVFGIIFSYTKIISSILRQSSVGGKYKTFSTCGSHLSVVSLFYGTGFGVYICSAIPDSPRKTAVASLMYTMVTPTMNPFIYSLRNKDMKGALRKLFSRVPTIL*
613 >lcl|XP_590174.2|Plus1complement(729786..730751) NW_001493332 olfactory receptor 521-like LOC512627 __SEG__ Chr15 {Bos taurus} MYATACNGSKDSSPIFYLVGIPSLQDVFFLPVFFIFLSFYLLILVGNALILVAVVIEPRLHKPMYFFLINLSALDILFTTTTVPKMLSLLLPGDHYLSFSACFLQIYLFQ
SFSCSEAFILVVMAYDRYVAICRPLHYPVLMTPQTNAALAASAWLTALLLPIPAVVQTSHMAFDSTVYIYNCFCDHLAVVQASCSDTSPQTLMGFCIAMVMSFLPLLLVL
LSYAHILASVLRIGSREGRSKAFSTCSSHLLAVGTYYSSIAIAYVAYRADLPLDFHIVGNVVFAILTPVLNPLIYTLRNKDVKAAITKISCPQDLGPSEDL*
614 >lcl|XP_590306.2|Plus1131546..132481 NW_001502241 olfactory receptor, family 52, subfamily J, member 3-like LOC512736 __SEG__ Chr15 {Bos taurus} MFYHNRSIFHPTTFFLIGIPGLEEVHAWISLPFCSVYLVALLGNVTILLVIKTEKSLQEPMFYFLAILSTIDLALSTTSVPRMLGIFWFDAHEISFGACVAQMFLIHAFT
GMEAEVLLAMAFDRYVAICAPLHYTTILTSRVLMGISMCIVIRPLLLTLPMIYLIYRLPFCQTYIIPHSYCEHMGIAKLSCGNIRINGIYGLFVVSFFVLNLVLIGISYV
YILWAVFCLPSQDARLKALSTCGSHIGVICVFYIPSVFSFLTHRFGHKIPRYIHILVANLYLIIPPSLNPIIYGIKTKQIWEPVLRAFIKK*
615 >lcl|XP_590571.1|Plus1384593..386413 NW_001495416 leucine rich repeat protein 1, neuronal-like isoform 1 LINGO2 __SEG__ Chr8 {Bos taurus} MLHTALSCWQPFLGLAVVLIFMGSTIGCPARCECSAQNKSVSCHRRRLIAIPEGIPIETKILDLSKNRLKSINPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL
RLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYA
FKRLFHLKHLEIDYWPLLDMMPANSLYGLNLTSLSITNTNLSTIPFLAFKHLVYLTHLNLSYNPISTIEAGMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQ
NLLETLEENVFSSPRALEVLSINNNPLTCDCRLLWILQRHPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQHLLVDEGQTVQLECNADGDPQP
VISWVTPRRRFITTKSNGRATVLGDGTLEIRFAQDQDSGMYVCIASNAAGNDTFTASLTVKGFASDRFLYANRTPMYMTDSNDTISNGTNANTFSLDLKTILVSTAMGCF
TFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNGAVVEGEVAGPRRFNMKMI*
616 >lcl|XP_590751.2|Plus1154121..155080 NW_001502164 olfactory receptor, family 8, subfamily K, member 1-like LOC513114 __SEG__ Chr15 {Bos taurus} MDPMEKHNHTAMHKVTEFVLTGITDSPELQAPLFGIFLVIYLVTVTGNLGMVILTHLDSKLHTPMYFFLRHLSITDLGYSTVIGPKMMVNFVVHKNTISYNWCATQLAFF
ETFIITELFILSAMAYDRYVAICKPLLYVVIMAQKVCWALVLTPYLYSTFVSLFLTLKLFKLSFCGSNVISYFYCDCVPLISLLCSDTHELELIILIFSGCNLLCSLLIV
LVSYMFILVTILRMNSSKGRYKAFSTCSSHLTAVVVFYGTLLFMYLQPKSSHTFAVDKMASVFYTLVIPMLNPLIYGLRNKEVKDALRRTLINRCKIPN*
617 >lcl|XP_590795.3|Plus1complement(28431..29360) NW_001493369 olfactory receptor 1259-like LOC513151 __SEG__ Chr15 {Bos taurus} MANERNVTVFILVGLTQNPQMQKIVFVVFLVLYMVTLSGNLLIVVTITTSQALNSPMYFFLTHLSLIDTIYSSSSAPKLIVDSLQEIKTISFNGCMAQVYAEHIFGATEI
ILLTEMAYDHYVAICKPLHYTAIMSHRLCVLLLGVAWTGGFVHATIQVLFTVRLPFCGPDVIDHFMCDLYPLLKLVCVDTHILGLFVAANSGFICLLNFLLLLVSYVVIL
SSLKSYSLEGRRRALSTCVSHITVVVLFFVPCIFVYLRPVTTLPIDKAVAVFYTMVAPMLNPLIYTLRNTEVKCAMKKLWKKKVRSDNS*
618 >lcl|XP_590820.4|Plus1complement(1629637..1630578) NW_001495321 olfactory receptor 414-like LOC513175 __SEG__ Chr7 {Bos taurus} METDNQTSSSEFILLGLSEKPEQETLLFALFLCMYVVTVVGNLLIILAISTDSHLHTPMYFFLANLSLVDFCLASDTVPKMLVSIQIKSKSISYSCCLTQMYFFHFFGIM
DSVLIAVMAYDRFVAICHPLHYTSIMSPRLCVLLVGGPWVFSGFISLTHILLMARLVFCGNIELPHYFCDLTPLLRLSCTDTSVNKTFVLIVAGMIIATPFICILASYAH
IIVAIVKVPSAGGRKKTFSTCSSHLSVVVLFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALMKLVNRKITSSS*
619 >lcl|XP_590874.2|Plus1complement(3086485..3087507) NW_001493202 v-mos Moloney murine sarcoma viral oncogene homolog MOS __SEG__ Chr14 {Bos taurus} MPSPLPRRPHLPGDLSPSSGDSRPCSSPCELLGRIPPRARRLRRRLAWCSIDWEQVCLLRRLGAGGFGSVYEATYHGVRVAVKQVSRCSKNPRASRRSFWAELNAARLCH
ANIVRVLAASTHPPPGFDSLGTVIMEFGGNITLHQVIYGPTGCPGDSGMQLGLERCLKYSLDVVSGLLFLHAQSIVHLDLKPANILISEQDVCKIGDFGCSARLDDLRSP
RTPHHLGGTYTHRAPELLKGEPVTPKADIYSFAITLWQMSTREAPFSGERQHVLYAVVAYHLRPALRAPIFTDSVPRKTLAGIVQRCWAALAPERPSAELLLGDLHALKE
ELGGLETGSR*
620 >lcl|XP_590908.3|Plus121675..22640 NW_001502739 olfactory receptor 669-like LOC513250 __SEG__ Chr15 {Bos taurus} MLVSNNSCVPPKYFILNGVPGLERVHVWISLPFCTMYIISLLGNLGLVYLIHHEESLHHPMYFFLAMLSLVDLFTCTTTLPNALCIFWFNLKEINFNACLVQMFFVHGFT
GVESGVLMLMALDRYVAICYPLRYATILTNPIIAKAGLVTFLRGALLMIPFPFLVKRLPFCQSNIISHTYCDHMSVVKLSCASIKVNVIYGLVVALLIGVFDISCISVSY
TMILRAVVSLSSADAQQKAFSTCTAHISAIIVTYVPALFTLFTHRFGGHSIPSSLHIIVANLYLLLPPTLNPIVYGIKTKQIRDNVIKLLQGEKGASTQDK*
621 >lcl|XP_590964.3|Plus1113907..116363 NW_001495372 protocadherin alpha subfamily C, 1 PCDHAC1 __SEG__ Chr7 {Bos taurus} MVGWRVAVLCLWVSCGSVAGQLEYSVSEETERGVAVGSVAQDLRLSAASLSLRNFRFLSSRGETYFGVDLASGNLVVRQPADRERLCGAKAACVLIYELVLEDPLELHKV
HVHVLDINDNSPHFPAGDVQFRIPEFLMPGARFTLPNAEDADEGSNGLLSYSLSPSRHFRLDMGSRVDGSEFPELVLEKALDREQRATHRLVLTARDGGLPARSGEVQVT
IVVVDTNDNAPVFERSVYRTEVPETAPNGTVLFRVQASDPDEGSNGEIRYSLSNSTQAKLRHHFHVHPRNGEVRVAASLGPPETLLEAYIEARDEGAFSLASTAKLLVEV
TDVNDHAPEVNLLTLSSPVSEDAATGTVIALLNVRDEDLGPNGKVTCSMYSGGPFKLKASFGNYYSLVTDGPLDREQVGEYQVLITASDGGSPPLSTRRTLTVSVADVND
NTPSFPKSKQELFVAENNAPGASLGHVFAQDPDLGKNGLVFYELLDIISEGQSASSLVEVDSSSGAITAKISFDFEWLRGFHFQVEARDGGFPPRSATVTVNLFVVDRND
NAPVILFPLPKNGSVPVEIVPRSARTGHLITKVVAEDADSGSNAWLSYYIFKASDSSLFRISANMGELRTARLVLPTDAVKQKVVVVVQDHGDPSLSASVTLGVLLSSSA
PQVLPDFEDGWETGGHLSAQNLYLTIALACISFLFLGCLLFFVCSKFSQSAGCCTQSCCHSPEELRYGSKVASNPCMSSATIDVTTVERLSHTYLYWASLGLGYDNNSLL
LHGEYSAAVLRNLASGVELNVPISCLQIRNRKGDHANVNAMVSIFYGI*
622 >lcl|XP_590999.4|Plus1complement(732784..733725) NW_001494525 hypothetical protein LOC513334 __SEG__ Chr29 {Bos taurus} MAAENTSMTEFILAGLTDQPGLQIPLFLLFLGFYMVTVVGNLGLIMLIGLNSRLHTPMYFFLFNLSLIDFCYSTTITPKMLMSFVSRKNSILHAECLTQLFFFCFFVISE
SFVLSAMAYDRYVAICKPLVYTVTMSPKVCLLLLLGVYVMGFSGAMAHTGNIASLIFCADNLINHFMCDIPPLLELSCTSSYVHELVVFIFVAIDIGMPTVTISISYALI
LSSILRIHSTEGRSKAFSTCSSHIIVVFLFFGSGAFMYLKPPSVLPLDQEKVSSLFYTIVVPMLNPLIYSLRNKDVKAALRKTLGKINFLRKE*
623 >lcl|XP_591108.4|Plus1complement(500210..501151) NW_001492801 odorant receptor MOR83-like LOC513435 __SEG__ Chr10 {Bos taurus} MDALNQTRVTQFVFLGLTDNWVLEILFFMAFSVMYVLTLLGNILIMVTIVFTPRLHIPMYFFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCIAQLFFLHLFACA
EIFLLTVMAYDRYVAICVPLHYPNVMDMRVCVQLVFALWLGGTIHSLVQTFLTIRLPYCGPNVIDSYFCDVPPVIKLACTDTYLTGMLIVSNSGTISLFCFLALVTSYMV
ILVSLRKQSAEGRRKALSTCSAHFMVVALFFGPCIFLYTHPDTNFSSDKVVSVFYTMVTPVLNPLIYTLRNEEVKNAMKRLRQRQVFSMKSCT*
624 >lcl|XP_591180.2|Plus12079290..2080222 NW_001495328 olfactory receptor Olr1654-like LOC513491 __SEG__ Chr7 {Bos taurus} MNQSVASDFILVGLFSRSGSPQLLFFLVAVMFIMGLLGNTTLLFLICVDSRLHTPMYFLLSQLSLFDVGFPLVTIPKMASDFLQGEGSISFGGCAAQIFFLTLMGVAEGI
LLALMSYDRYVAVCHPLQYSLLMRRQMCLLMVISSWLAGVLNACIQTSITLHFPYCASHTVDHFFCEVPALLKLSCADTSTYELVLSTSGVLILVLPLSLIATSYGHVLG
AVLRMRSEEAHHKAFTTCSSHITAVGLFYGAAVFMYMVPGAYHSPHQDNMVSLFYSLITPTLNPLIYSLRNREVWMALVKVLRRPGLRAK*
625 >lcl|XP_591226.3|Plus1complement(700907..>701857) NW_001493314 olfactory receptor Olr186 (predicted)-like LOC513532 __SEG__ Chr15 {Bos taurus} QTDMLHPNKTQFHPSSFLLMGIPGLEDMHIWIGFPFLAVYLIALLGNITILFVIQTERSLHQPMFYFLAMLAFTDLGLSTATIPKMLGIFWFNLREIVFGACITQMYTIH
ICTGLESVVLTVMAIDRYIAICNPLRYSMILTSKVIAILGIVIIFRTLVFVTPFIFLILRLPFCEVRIIPHTYCEHMGLAKLSCGSIRVNVIYGLIAFSVGYIDLSVIGF
SYVQILRAVFHLPSWDARLKALSTCGSHVCVMLAFYLPALFSFMTHRFGHNVPHCIHILLANLYVVVPPAPNPIIYGVRTKQIRQRVLRMLNPKSY*
626 >lcl|XP_591282.4|Plus1complement(2421649..2422587) NW_001492801 olfactory receptor, family 4, subfamily K, member 13-like LOC513582 __SEG__ Chr10 {Bos taurus} MEKTNHSVVSEFILLGLSKSQNLQILFFLGFSVVYGGIVLGNLLILVTVIFDSCLHTPMYFLLIILSCIDMILASFATPKMITDFLRDRKTISWWGCYSQMFFMHLLGGS
EMMLLVAMAIDRYVAICKPLYYMTIMSPRVLIGLLLFSYAVGFVHSSSQMAFMLNLPFCGPNVVDSFFCDLPLVIKLACGDTYVLQLLVVADSGLLSLVCFLLLLVSYTV
IIYSVRHHTASGSSKAFSTLSAHITVVTLFFAPCVFIYVWPFNRYSIDKILSVFYTIFTPLLNPIIYTLRNQEVKAAIRKIRTQHTNSKHAL*
627 >lcl|XP_591375.2|Plus1complement(2372282..2373220) NW_001493662 olfactory receptor, family 1, subfamily A, member 1-like LOC540082 __SEG__ Chr19 {Bos taurus} MREDNQSSTFNFILLGVTGQQKQEDFFFLLFLFIYPTTLIGNLLIILAICSDIRLHNPMYFLLANLSFVDIFFSSVTIPKMLANHLLGSKAISFGGCLTQMYFMIALGNT
DSYILAAMAYDRAVAITRPLHYTTIMSPWTCVLLVIGSWVVGNGNALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFNVKMMYLGVGVFSVPLLCIIISYVRV
FSTVLRVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYNLKDAVITVMYIAVTPMLNPFIYSLRNRDMKAALGKLFSRRIFSQPM*
628 >lcl|XP_591408.1|Plus1312002..312955 NW_001493327 olfactory receptor Olr48-like LOC513681 __SEG__ Chr15 {Bos taurus} MLTFHNVCLAPSSFQLTGIPGLESLHIWLSIPFSSMYLVAVVGNATILAVVRVEHSLHQPMYFFLCMLAIIDLVLSTSTMPKLLGIFWFGAGDIGLDACLAQMFLIHCFA
TVESGIFLAMAFDRYVAICNPLHHTTVLTHTMVGRLGMAALCRGVLYIGPLPLMIRLRLPLYKTRVISHSYCEHMAVVTLTCGDSRINNIYGLSIGFLVLILDSMAITAS
YVMIFRTVIGLSTPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRERLLQILKTETKIK*
629 >lcl|XP_591409.1|Plus1295520..296464 NW_001493327 olfactory receptor 78-like LOC513682 __SEG__ Chr15 {Bos taurus} MAASNITSTHPAAFLLVGIPGLEHLHVWISIPFCFAYTLALLGNCTLLFIIRGDAALHEPMYLFLAMLAIIDLVLSSTTLPKMLAIFWFRDREINFYACLVQMFFLHSFS
IMESAVLLAMAFDRYVAICKPLHYSTILTGPLITKIGLAAVTRAVTLMTPLPFLLRRFHYCRGPVIAHCYCEHMAVVRLACGDTRFNNIYGLAVAMFIVVLDLLFVILSY
IFILQAVLQLASQEARYKAFGTCVSHIGAILSTYTPVVISSVMHRVARRAAPHVHILLAIFYLLFPPMVNPIIYGVKTKQIRDHVLSLFWRKNV*
630 >lcl|XP_591428.3|Plus1467740..468669 NW_001493368 olfactory receptor 480-like LOC513698 __SEG__ Chr15 {Bos taurus} MEENNGTTVTEFLLLGFAGQHKSWPVLFTILLMIYMVTLVGNIGVILLIKVDSSLHTPMYFFLQNLAFVDLCYTSAVTPKMLQNLVGTERSISFMGCVVQLLVDGAFITS
DCYILAAMAVDHYVAICNPLHSPTVMTRRVCIHLLVGSYFMGFLNASVNVGFIFSLSFCKSNKINHFFCDAPPILALSCSNIYFSVMMLTVFVGFNLTLTVSVVIFSYMF
ILAAILKISSAAGRKKAFSTCTSHLTAVTIFYGTLSYMYLHHRATESQEQEKMASVFYGVVIPMLNPLIYSLRNQDVREALKGVGKKCF*
631 >lcl|XP_591514.4|Plus1complement(2471080..2472027) NW_001494522 olfactory receptor, family 6, subfamily M, member 1-like LOC513770 __SEG__ Chr29 {Bos taurus} MDVQNQTTVTEFILTAFPALQKLQIFLFVVLLFTYMLTLTGNGVIISLIWADNRLQTPMYFFLSNLSFLDILFTSSVTPKLLSFLLKDRKTISLAGCISQTYFFFFLGTV
EFILLVVMSFDRYVAICKPLRYTIIMNSRACLLLVLGCWVGAFLSVLCPVILLSRLPFCHKEINHFFCDIAPLLQVACIDTHFLEMMSFLLSSLILLTSLLITTVSYTYI
ISTILSIPSAQGRQKAFSTCASHITVVSIAYGSNIFMYVRPSQSHSLQFDKVTAVLTIMVTPLLNPFIYSLRNEKVKEVLRDAVNKIVSLLHRKP*
632 >lcl|XP_591589.3|Plus1complement(200667..203201) NW_001508708 slit homolog 1 protein-like SLITRK2 __SEG__ ChrX {Bos taurus} MLSGVWFLSVLTVAGILETESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLK
TLKRLHLNNNKLEVLREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKLMPFAGVLEHIGGIMEIQLEENPWNC
TCDLLPLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSTGDSAQRGGHTDTHIPRLSPTLNPALNPTRAPKASRPPKMRNRPTPRVTVSKDRQSFGPIMVY
QTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPTSPKKLYLTGNYLQMVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLFP
AMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGLKDWTEHANSP
VIINEVTCESPAKHAGEILKFLGREAICPDGPNLSDGTVLSMNHNTDTPRSLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKRVPSVPRSANNL
DVSSFQLQYGSYNTETQDKADGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYSNLEEKKEEPATLAYTISATELLEKQAPREPELLYQNIAERVKELPSAGL
VHYNFCTLPKRQFTPSYESRRQNQDRINKTVLYGTPRKCFVGQSKADHPLLQAKPQSEPDYLEVLEKQTAISQL*
633 >lcl|XP_591624.4|Plus1complement(43543..44472) NW_001493369 olfactory receptor 1264-like LOC513867 __SEG__ Chr15 {Bos taurus} MENRNNVTEFVLLGLTQNPKMQKIVFAVFFAIYITTVVGNVLIIVTITASPSLGSPMYFFLAYLSFIDACYSSVCAPKMIVDSLCEKKTILFHGCMTQIFGEHFFGGAEV
ILLTVMAYDRYVAICKPLHYTSIMNWQVCGLLVGVSWVGGFLHGFIQILFIFRLPFCGPNVIDHFMCDLNPLLGLACTDTHTLGLFIAANSGFICLLNFLLLLVSYMVIL
RSLRAYSLEARRKALSTCISHITVVILYFVPCIFVYMRPAATLAVDKAVAVFYTVITPMLNPLIYTLRNAQMENAIRKLCSRKVTSGVL*
634 >lcl|XP_591674.4|Plus1complement(662120..663055) NW_001494525 hypothetical protein LOC513914 __SEG__ Chr29 {Bos taurus} MAEENTSSVTEFILTGLTDQPELQIPLFFLFLCFYMVTVVGNLGLITLIGLNSHLHIPMYFFLFNLSFIDFSFSTAIVPKMLTSFISEKNFISYAGCMTQLFFFCFFVFS
ESFILSAMAYDRYVAICKPLVYMVTMSPQVCLLLLLGVYGMGVFGAMAHTGNIVFLTFCGDNLVNHYMCDIIPLLELSCNSSYVNLLVVFIVVTIGIGVPIVTIFISYGF
ILSSIFHISSTEGRSKAFSTCSSHILAVSLFFGSGAFMYLKPPSILPLDQGKVSSLFYTIVVPMFNPLIYSLRNKDVKFALKKTLDRIMLS*
635 >lcl|XP_591675.4|Plus11645243..1646160 NW_001495321 olfactory receptor 853-like LOC513915 __SEG__ Chr7 {Bos taurus} METKNQTDIAEFLLLGLSEDPEEQPLLFGLFLTIYLVTALGNLLIMLAIGSDSHLHTPMYFFLSHLSFTDLCFSTTTVPKMLVNIERRSKSISYTGCLTQVCFVLLFAGL
ENFLLAAMAYDRYVAICHPLRYVVIMNPCLCGLLILLSLVISSADALLHTLMVFRLSFCTELEIPHFFCELDQVIKVACSDTLINNIVVYLVTSILGGVPLLGIIFSYTQ
IVSSILRMPSAGGKYKAFSTCGSHLSVVSLFYGTAFGVYISSALTHSSKETAIASLMYTVVPPMLNPFIYSLRNRDMKQALRKLI*
636 >lcl|XP_591676.4|Plus1complement(1653573..1654538) NW_001495321 olfactory receptor, family 7, subfamily G, member 1-like LOC513916 __SEG__ Chr7 {Bos taurus} FVHNMGPRNKTGVSEFLLMEVTKDLELQPLHFILFLSIYLVTTLGNLLIVMAVISDSHLHTPMYFFLYNLSFTDICLSTTTIPKMLVNIQTQNQSVTYTGCLTQLCFVLV
FASLESFLLAIMAYDRYVAICHPLRYMAIMNFRLCGWLILFSLFISIVDALLHSLMVLQLTFCTDLEIPLFFCEVVQVIKLACSDTLINNILIYLATSIFGGVSVCGIIF
SYTQIVSSVLRMPSVGGKYKAFSTCVSHLSVVSLFYGTGLGVYISSALVNSSRQTAVASVIYTVVPQMMNPFIYSLRNRDMKEALRKLISKIPLPFQDCVI*
637 >lcl|XP_591714.4|Plus1complement(78978..79916) NW_001501889 olfactory receptor, family 5, subfamily B, member 2-like LOC513948 __SEG__ Chr15 {Bos taurus} MENGTEVTDFILVGLTNAPELQIPLFIVFTLIYLISVLGNLGMITLILLDSCLHTPMYFFIINLSLVDFGYSSAVTPKVMAGFLRADKVISYNACATQIFFFAAFASVEN
FLLAAMAYDRHAAVCEPLHYTITMKKSVCAHLAIGSYVCGFVNASIHVGGTFSLSLCESKLVHHFFCDIPAVMALSCSDKHVREVVLILISGFNVFFALLVIFISYLLIF
ITVLKMHSAKGYQKALSTCASHLSAVSIFYGTIIFMYLQPSSNHSMDTDKVASVFYAMVIPMLNPIVYSLRNKEVKSAFKKVWGKAKFSLGF*
638 >lcl|XP_591782.2|Plus1149055..149972 NW_001495323 olfactory receptor 18-like LOC514002 __SEG__ Chr7 {Bos taurus} MLTLVSEFLLMDLSDDPELQPLLFSLFLSMYLITVLGNLIIILAFISDSHLHTPMYFFLSSLSMTDIGCTSTTVPKMIVDIQTHSRLISYMSCVTQMSIFILFGCLDNLL
LIAMAYDWFVSIHHPLHCTVLMNPRLYSLLVLVSFFISLLSFLLHSLMVLELTFFLDMEIPRFFCDPSQLLSLACFQIPSSNILIYFIGAIFGGFPFTGILFSYTCIVSS
ILRVPSTGGKYKPFSTCGCHLAIMCLFYGRGIGVHLSSTVSSSPRDSAVASVMYTVVTPMLNPFVYSLRNRDIKRVMWGLFSKTT*
639 >lcl|XP_591864.2|Plus179574..80509 NW_001493372 odorant receptor MOR10-like LOC514071 __SEG__ Chr15 {Bos taurus} MELGNGTRVKEFIFLGLTQNQELSLLLFLFLLLVYVTTLLGNLLIMVTVTRDSRLHTPMYFLLRNLSVADICFSSITTPKVLADLLVQRKAISFNGCFTQMFFFHLIGGV
DVFSLSLMALDRYVAITKPLHYVTIMSRGRCIGLIVASWAGGFVHSIVQISLLLPLPFCGPNVLDTFYCDIPQVLTLACTDTAVLELLMISNSGLLTTLWFVFLLVSYMV
TLLLIRSQAGEGRGKAISTCTAHITVVTLHFVPCIYVYARPFSTLPMDRAVSINLTVIIPVLNPLIYTLRNQEMKAAMKRLRRRFMLFEKG*
640 >lcl|XP_592049.4|Plus1173578..174504 NW_001494179 olfactory receptor, family 2, subfamily B, member 2-like LOC514235 __SEG__ Chr23 {Bos taurus} MEWDNQTFNPDFILMGIFSYTPTHIFLFSLVLGIFTMALLANTLMVLVIYLDTRLHTPMYFLLSQLSLMDLMLICTTVPKMAHSYLSGRKSISVAGCEAQIFFYVSLFGA
ECFLLAVMAYDRSVAICYPLQYHSLMNWKLCGLMAVSTWILGGFDGIVDVAATMSFSYCGSREIAQFFCDVPALLHLSCMDTSTFETLIFICCVVMLLLPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCTSHLTVVGMYYGAAMFIYMRPTSNRSPTQDKMVSAFYTILTPTLNPLIYSLRNKDVAKAFSKVLGKR*
641 >lcl|XP_592083.1|Plus1245745..246374 NW_001494990 COP9 signalosome subunit 8 isoform 1 COPS8 __SEG__ Chr5 {Bos taurus} MPVAVMAESSFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQQIWQRDFPGVYSTINAHQWSEAVQPIMEALR
DATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTIRIVMPKKPVAGTLDVSFNRFISLSEPTPVPPIPKEQQLARLTDYVAFLKN*
642 >lcl|XP_592100.2|Plus11395593..1397158 NW_001495020 adhesion molecule with Ig-like domain 2 AMIGO2 __SEG__ Chr5 {Bos taurus} MSLRLHALPTLPGVVRPGCKQLLCLLVITMTVSRGASGVCPTACICATDIVSCTNKNLSRVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSLVKLNTLIIRHNNITSISTD
SFSTTPNLKCLDLSSNKLKTVKSAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRISSLPMHHINLVPGKQLR
GIFLHGNPFVCDCSLYSLLIFWYRRHFSSVMDFKNDYTCRLWSDTRHFHQVLLLQDSFLNCSDSIINSSFRALGFIHEAQVGERLMVHCDGKTGRANTDFMWVGPDNRVL
EPDKEMENFHVFPNGSLVIESPRFEDAGVYSCVAMNRQRLLNETVDVTINVSNFTINKSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCKHKRRKNMLNQSNVH
ASILTSGPDSDAPTDERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSETVIAEGILKSTRVKSDSDSVNSVFSDTPFVAST*
643 >lcl|XP_592150.1|Plus11236249..1237184 NW_001493648 olfactory receptor 463-like LOC514319 __SEG__ Chr19 {Bos taurus} MQPGNLTCVSEFVFLGLSQTHELHLFLFLVFLLVYTTTVMGNLLIMVMVSSDSRLHTPMYFLLRNLAVIDLCFSSVTAPKMLVDFLAEKKTISYQGCMTQIFFFHFLGGA
MVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVASWVGGFIHSISQVALMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLVISNSGMLDVIWFLLLLVSYSA
ILVMLRSHSGQARRKAASTCTTHIIVMSMVFIPSIYLYARPFTSFSMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAVKRLGRHWLLCKRE*
644 >lcl|XP_592203.1|Plus1137921..138856 NW_001493372 odorant receptor MOR10-like LOC514366 __SEG__ Chr15 {Bos taurus} MDQGNYTRVKEFIFLGITQSRELSWVLFVFLFLVYMTTLLGNLLIMVTVTWDSRLHTPMYFLLRNLSVLDICFSSITAPKVLADLLSERKTISFRGCVSQMFFFHLLGGA
DVFSLSVMAFDRYVAISRPLHYLTVMSRGRCTALIVASWAGGFVHSIVQISLLLPLPFCGPNVLDTFYCDVPQVLTLACTDTSSLELLMISNNGLVSWFIFFFLLVSYTV
ILTMLRSHSGEGRRKAISTCTAHITVVTLHFVPCIYVYARPFTALPTDKAVSVTFTVISPLLNPLIYTLRNQEMKAAMQRLKKQLGHSERV*
645 >lcl|XP_592204.1|Plus1151836..152771 NW_001493372 olfactory receptor 1264-like isoform 1 LOC514367 __SEG__ Chr15 {Bos taurus} MEQGNHSRVKEFIFQGLTQSRELSRVLFLLLSLVYTTTVLGNLLIMVTVSCESRLQTPMYFLLRNLSVLDICFSSTTAPKVLVDLLSERKTISFRGCLTQMFFFHLLGGA
DIFSLSVMAFDRYVAISKPLHYVTIMSRGRCIGLIVASWAGGFVHSIVQISLLLPLPFCGPNIVDGFYCDVPQVLTLACTDTFVLELLMISNNGLISTLWFVFLLVSYTV
ILMMLRSHSGEGRRKAISTCTAHITVVTLHFVPCIYVYARPFSALPMDRAVSITFTVIIPVLNPLIYTLRNQEMKAAMKRLKKRLGPSEKE*
646 >lcl|XP_592284.3|Plus1556809..557759 NW_001494175 olfactory receptor, family 12, subfamily D, member 3-like LOC540205 __SEG__ Chr23 {Bos taurus} MENVTTVNEFLLLGLTSVQQLQPFFFVIFLIIYLINLVGNGAILVITILEPKLHSAMFFFLGNLSCLDICYSSVTLPKVLINLLSAHRTISFLGCITQLYFFHFLGSTEA
VLLAVMAFDRFTAICNPLCYPVIMSPKVCILLAAMAWITSIFNALVHSVMTARLNFCHSQELNHFFCDVKPLLELACSNTLLNQWLLFVVTGSVSMGAFFLTLLSYFYII
CSLLLKHKSCRILHKALSTCASHFTVVCLFYGPVGFTYIHPASATSMTQDRMVAIVYSAVTPVLNPLIYTLRNKEVRLALKEIFRSKLFKDCRQHH*
647 >lcl|XP_592285.4|Plus1550384..551331 NW_001494175 olfactory receptor Olr1654-like isoform 1 LOC514434 __SEG__ Chr23 {Bos taurus} MEGENHTLSEFIILGFSDLNDVQFLFFTIFLMIYLCTLGGNIFIILVTLVDIRLYTPMYFFLRNLAFLDICYTTTNVPQMMVHLLSKKKSISYGGCVAQLFAFLFFVGVE
CLLLAAMAYDRYIAICKPLRYSVIMNKVLYSQLAASCWTGGFLNSVVHTVLTFHLPFCGNNEINYFFCDIPPLLILSCGDTSVNELVLLIIGVFIGWAPFLGIILSYLYI
ISTILRIRSSEGRQKAFSTCASHLVIVLLYYGSSIFTYVRPISSYSLAKDRLISVLYSVVTPMLNPIIYTLRNKDIRKALRAVGEKVATFKFHFP*
648 >lcl|XP_592316.2|Plus1complement(406525..406974) NW_001494536 calmodulin 2 LOC514457 __SEG__ Chr29 {Bos taurus} MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISATELRHVM
TNLGEKLTDEEVDEMIREADIDGDRQVNYEEFVQMMTAK*
649 >lcl|XP_592364.2|Plus1complement(48633..49574) NW_001492989 olfactory receptor, family 1, subfamily E, member 2-like LOC514505 __SEG__ Chr11 {Bos taurus} MTVENQSSVSEFLLLGIPIQSEQQGVFFALFLGMYLTTVLGNLLILLLIRLDSRLHNPMYFFLSHLALTDITFSSVTVPKMLVIMQTKRKSIPYAGCLSQTCFFILLADL
DSFLITTMAYDRYVAICHPLHYTTIMSQSVCVTLVLGSWVIACACALLHTLLLAQLSFCADNTIPYFFCDLAALLKLSCSDTSLNQLVIFTAGLTAIMLPFVCILVSYGH
IGATILRVPSAKGICKALSTCGSHLSVVTLYYGAIIGVYFLPSSNSTNDSNIISSLMYTVVTPMLNPFIYSLRNKDMKGALRKLLSKRTYSSN*
650 >lcl|XP_592408.1|Plus12780124..2781074 NW_001494714 olfactory receptor 424-like LOC514540 __SEG__ Chr3 {Bos taurus} MVRSNQTSMVTEFFFSGLPELEDGNLLFFIPLLVIYIFIIIGNLIVFFAVRIDTHLHNPMYNFISIFSFLEIWYTTATIPKMLSNLVSKKRTISITGCLLQMYFFHSLGN
SEGILLTTMAIDRYVAICNPLRYPTIMTPRLCTQLSIGSCIFGFLLLLPEIVWISTLPFCGPNQIHQIFCDFEPVLCLACTDTSMILIEDVIHAIAIIFSVLIIALSYIR
IITVILRIPSAEGRQKAFSTCASHLGVFLMFYGSVSLMYLRFSATFPPILDTIIALMFAVLAPFFNPIIYSLRNKDMKIAIKKLLCLQKVFYASAS*
651 >lcl|XP_592414.4|Plus121932..22873 NW_001492989 olfactory receptor, family 1, subfamily J, member 4-like LOC514546 __SEG__ Chr11 {Bos taurus} MRRENQSSVSEFLLLGLPIWPEQQGMFFTLFLGVYLTTVLGNLLILLLIRLDARLHTPMYFFLSHLALTDVSFSSVTVPKMLINMQTQHQSISYVGCVTQTYFFLFFTDL
DDFLLTSMAYDRYVAICHPLHYSTVMGQGLCTLLVTVSWILSCASALCHTLLLTRMSFCADHSIPHFFCDLDALLKLSCSDTSLNKLAIFTVGVAVIVLPLVCILISYGR
IGATILKVPSTKGICKALSTCGSHLSVVFLFYGTIIGLYTLPSSSTSNDKNIIASVMYTAVTPMLNPFIYSLRNREMKGALGRLSRREIFFSK*
652 >lcl|XP_592528.1|Plus1complement(1864163..1865098) NW_001495357 olfactory receptor Olr1654-like LOC514645 __SEG__ Chr7 {Bos taurus} MAWEFQTFNSDFILLGIFDHRPTHIFLFSRVLGVSAVAIMGNTLVVLFLYLNAQLHTPMYFLLSQLSLTDLVLISTTIPKMAFNYLSGSKSITMADCATHIFFYASLTGC
ECFLLAVMAYDCDVATCHPLRYTSLMRLKICGLMTASSWVLGSTDGVIDAVVTFSFSCCGFWVIAHFFCDFPFLLVIQCNDTSIFEEVLFYCCIMMILFPVAIIIASYAR
VLLTVILMGSGKGRHRAFATCSSHLIVVGTYYGAVLFMYMRPASNHSPTQDRMMSVFYTILTPTLNPLIYSFRNKEVACAFQVFRKGKTGE*
653 >lcl|XP_592537.1|Plus11127637..1128734 NW_001508776 pyrimidinergic receptor P2Y4 P2RY4 __SEG__ ChrX {Bos taurus} MAGTESLLFTTLGTHSDPDNSEMELDCQFNEEFKFILLPVTYAVVFLLGLGLNTLTIWLFLFRLRPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGLCKF
IRFLFYWNLYCSILFLTCISVHRYLGICHPLRALRWGCPRLAGLLCLAVWLVVAGCLVPNLFFVTTSPKGDTILCHDTTRPEEFDHYVHFSSAIMGLLFGVPCLVTLVCY
GLMAQRLYRPLPGATQSSSRLRSLHTIAVVLTVFAVCFVPFHITRTIYYMARLLEADCRVLNIVNLVYKVTRPLASANSCLDPVLYLLTGEKYRRQLQQLCRGSRSRPPR
ASSSLVLVSLPEDSRCRWTAAPQDSGCPTPWADSL*
654 >lcl|XP_592549.4|Plus13817851..3818783 NW_001494955 olfactory receptor, family 2, subfamily A, member 4-like LOC514662 __SEG__ Chr4 {Bos taurus} MEGNQSWIAEFILIGFQLSEDMELVLFGIFSLLYTFNLLANGMILGLICLDPRLHTPMYYFLSHLAIIDISYASSNLPNLLANLVKHKKDISFVLCTLQMIFNLIFSSME
CLILVVMSYDRFVAICHPLQYTVIMNWRVCMFLAIACWSCGLCLAIVQVSLFLRLPFCGPQKVNHFFCEIQSVLKVTCGDIWINEMFLFAEGVFILVGPLALMLVSYVHI
LWAILKIQSKEGRKKAFSTCSSHLCVVGFYFGIAMMVYLAPESSHREEQKKILFLFYCLFNPLLNPLVYSVRNAQVKAAFHRVLQKKRTV*
655 >lcl|XP_592665.1|Plus191644..92582 NW_001494276 olfactory receptor Olr1654-like LOC514760 __SEG__ Chr25 {Bos taurus} MERANSSSLEGFILMGVSDHPQLETIFFVGILFSYLLTLFGNSAIILLFNLDARLHTPMYFFLSNLSSLDLAFTTSSVPQMLTNLWGADKTISYGGCVTQLYVFLWLGAT
ECILLVVMAFDRFVAVCRPLHYTTIMNPRLCWLLAAIAWLGGLGNSVVQSTFTLQLPLCGHRRVDSFLCEVPAMIKLACVDTSLNEAVLNSVCTFFTAVPLSVILISYCY
IAQAVLKIRSAEGRRKAFNTCLSHLVVVLLFYGSAIYGYLLPAKTSKQDQGKFISLFYSVVTPMVNPLIYTLRNKEVKGALRRLLGKGREVS*
656 >lcl|XP_592724.4|Plus1221449..222378 NW_001493367 olfactory receptor 1264-like LOC514818 __SEG__ Chr15 {Bos taurus} MASTNNVTELIISGLSQDPEVQRGCFVVFLPMYLATVVGNGLIVLMVRVSKSLRSPMYFFLSHLSLVEISYSSTVVPKFITDLLSKIKTISLEGCLAQIFFFHFLGVAEI
LLLVVMAYDRYVAICKPLHYMSIMNRQLCHILVAGSWFGGFLHSIIQILITIQLPFCGPNVIDHYFCDLQPLFKLACTDTSVEGVVVLANSGLIALCSFLLLVSSYIVIL
VNLRNHSAEGRRKALSTCASHVTVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVVTPMLNPIIYTLRNAEVKVAMRRLWGKKKNSGLE*
657 >lcl|XP_592758.1|Plus1398103..399044 NW_001494720 olfactory receptor 16-like LOC514846 __SEG__ Chr3 {Bos taurus} MQGFNRTAVVTQFILVGFSSLEELQVLLFVIFLLLYLTILMANAIIMTVICFSRTLHTPMYGFLFILSFSESCYTFVIIPQLLVHLLSATKTISFIACATQLFFFLGFAC
TNCFLIAVMGYDRYVAICHPLRYTLIMSKRLGLGLVSLSTVTGFFIALVATNLICGMHFCGPNRVNHYFCDMAPVIKLACTDTHVKELALFSLSILVIMMPFLLILVSYG
FIVNTILKIPSAEGKRKAFATCASHLTVVFVHYGCASIIYLQPKSKSASDKDQLVAVTYTVVTPLLNPLVYSLRNKEVKTALKRVLGMPVATK*
658 >lcl|XP_592773.3|Plus1491086..492015 NW_001501761 olfactory receptor, family 7, subfamily E, member 24-like LOC514861 __SEG__ Chr7 {Bos taurus} MESQNLTGVSEFLLLGLSDDPNLQLLLFGLFLSLYLMTLFGNLLIILVISSDPHLHIPMYFFLSSLSLADISISTTTIPKMLVNLQTYNKSITYRGCLTQLTFFSLFAFL
ESLLLTVMAYDRLVAICNPLHYLVIMNPRTCGVLVLASFFISFLTSLLHYLMMLQLTFCANVKIPHFFCDPPQLVNLACSNTSISNLLIYFIGTIFGGVPLLGILYSYAR
IISSILRVSSSDGKYKAFSTCGSHLSVVCLFFGTGLGMYVSSTVLSSPRKSAVASVMYTVVTPMLNPFIYSLRNKDIKSALWRIIIRKA*
659 >lcl|XP_592806.4|Plus13710566..3711498 NW_001494955 olfactory receptor OR7-15-like LOC514891 __SEG__ Chr4 {Bos taurus} MEGNQSWIAEFILLGFQLSEDMELLLFVIFILLYTFNLLANGMILGLISLEPRLHTPMYYFLSHLAITDVAYASSHLPNMLENLVKHKKTISYFSCTMQMVSYLAFASVE
CLTLVVMSYDRFVAICHPLQYTVIMNWRVCTFLAIACWACGFSLAIVQVSLFLRLPFCGPQKVNHFFCEIRSVLKVTCGETWINDIFLLADGVFILIAPISLVLVSYVRI
LWAILKIQSKEGRKKAFSTCSSHLCVVGFYFGIVLMVYMIPDDNNREEPQKILFLFYTFFNPLLNPLVYSLRNAQVKAAFHRLLQKRRTV*
660 >lcl|XP_592982.4|Plus1complement(59454..60395) NW_001494720 putative olfactory receptor 10K1-like LOC515038 __SEG__ Chr3 {Bos taurus} MEWVNETLVREFVFLGFSSLAGLQQLLFAVFLVVYLFTLSTNAIIISTIVLDRALHTPMYFFLAVLSCFETCYTFIIVPKMLVDLLAQKKTISFLGCAIQMFSFLFLGCS
HSFLLAAMGYDRYVAICDPLRYTVLMDYGMCLGLVAAACACGFTVSLVTTSLVFHLPFHSSNQLHHFFCDISPVLKLASHYSRLSQLVIFMLGVFALIIPLLLILVSYIR
IISAILKISSSVGRYKAFSTCASHLIVVTVHYGCASFIYLRPKSNYSSSQDALISVSYTILTPLFNPMIYSLRNKEFKSALRRAMVQTSYPVN*
661 >lcl|XP_593159.2|Plus1complement(735360..736958) NW_001492804 cholinergic receptor, muscarinic 5 CHRM5 __SEG__ Chr10 {Bos taurus} MEGEPYHNASTVNSTPVSHQPLERHGLWEVITIAAVTAVVSLITIVGNVFVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALD
YVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPPDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRET
EKRTKDLADLQGSDSVAEAEKRKSAHQALLRSCFSCPWPTLTQRERNQASWSSSRRSTSITGKPSQATGPSTEWAKAEQLTTCSSYPSSEDEDKPTTDPVFQVVYKSQAK
ESPREELSAEETKQAFVNAQSEKNDYDTPKYFLSPASAHGPKSQKWVAYKFRLVVKAEGTHDTNNGCRKVKIMPCSFPVSKDPSTKGLDPNLSHQMTKRKRMVLVKERKA
AQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLFCRWKKKKVEEKLYWQGNSKLP*
662 >lcl|XP_593313.3|Plus12054492..2055433 NW_001495357 olfactory receptor, family 2, subfamily T, member 27-like LOC515313 __SEG__ Chr7 {Bos taurus} MEWSNYSMYADFVLLGLFSNTRFPWLLFALIVLVFVISVASNTMMIILIHLDSRLHTPMYFLLSQLSIMDILYISTIVPKMLVDQMVDQRAISFAGCTAQHFLYLTLAGA
EFFLLGLMSYDRYVAICNPLRYPVLMNRKVCLLIVMAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCEVPALLKLSCMDTSAYETAMYVCCIMMLLIPFSVISASYTR
ILITVYRMNEAEGRKKAVATCSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPLLNPLIYSLRNKDVTGALQKVLGRCSSSGR*
663 >lcl|XP_593435.4|Plus1158663..159610 NW_001494179 olfactory receptor, family 2, subfamily B, member 2-like LOC515414 __SEG__ Chr23 {Bos taurus} MEWENQTFNPDFILMGIFNYTPTHIFLFSLVLGIFTMALLANTLMVLVIYLDTRLHTPMYFLLSQLSLMDLMVICTTVPKMAHSYLSGRKSISVAGCEAQIFFYVSLFGA
ECFLLAVMAYDRYVAICSPLQYHSLMNWKLCGLLAASSWFLGAFDGIVELAATLSFSYCGSREIAQFFCDVPALLHLSCTDTSTFETLIFICCVVMLLLPLSLIIISYTR
VIITVIRMSSGEGRHKAFTTCTSHLIVVGMYYGAAMFIYMRPNSNRSPTQDKMVSTFYTILTPTLNPLIYSLRNKDVAKAFSKVLGKRKFREQIG*
664 >lcl|XP_593502.3|Plus1485387..486649 NW_001495544 trophoblast glycoprotein TPBG __SEG__ Chr9 {Bos taurus} MPGGCSRGPAAGDGRLRLARLALVLLGWVSSTSLPSSASSSTSSASLPAPAASGQPALPGRCPAPCECSEAARTVKCVNRNLTEVPADLPPYVRNLFLTGNQLAVLPAGA
FARRPPLADLAALNLSGNRLKEVDAGAFEHLPGLRQLDLSHNPLADLSPFAFSGSNASVATPSPLAELILNRLELPAAERQNLSLEGMVAAALRAGHALRGLRRLELASN
QLLYLPHDVLAHLPGLRHLDLRNNSLVGLTHVSFRNLTHLESLHLEDNALKVLRNGTLAELQSLPHVRVFLDDNPWVCDCHMVDMVAWLKETEVVQGKGRLTCAFPEKMR
HRVLLELNSSDLDCDPILPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV*
665 >lcl|XP_593509.4|Plus1complement(11527..12471) NW_001505431 olfactory receptor, family 1, subfamily F, member 1-like LOC515482 __SEG__ Chr11 {Bos taurus} MERLNQTSSVSEFILLGLSSRPQDQKPLFILFLIIYLVTITGNLLIVLAICSDPQLHTPMYFFLSVLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLSQMYFIYALGNT
DSCLLAVMAFDRYVAICDPFHYVTIMGHRRCVLLVAFSCSLPHFHSLLHVLLLNQLTFCDSNVIHHFLCDLSPLMKLSCSPTLINEIVIMTEGPVLLVTPFLFITFSYIR
ILIAILKIPSTSGKHKAFSTCGSHLTVVTLFYGSIFYVYLQPVSTYTVRDHVATIVYTVLSSMLNPFIYSLRNKDLKQSLRKLVGRRKPQTAPP*
666 >lcl|XP_593553.2|Plus1370486..371427 NW_001501755 olfactory receptor 73-like isoform 3 LOC515520 __SEG__ Chr26 {Bos taurus} MFLSERNKSGATFTLLGFSNYPELQVPLFLTFLAIYSVTVVGNLGMIVIIKINPKLHTPMYFFLSHLSFVDFCYSSIIAPKTMVNLMVEDRTISFVGCVIQFFFFCTFVV
TESFLLAVMAYDRFVAICDPLLYVVAMSPRLCATLVVGSYAWGVACSLILTCTVIKLSFQGFNTIDHFFCELSSLLSLSCSDTYLNQLLLFIFATFNEVSTLVIVLLSYV
FIVVTILKMCSACGRHKAFSTCASHLTSISIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKDTVSKIMDSKVFSY*
667 >lcl|XP_593576.3|Plus1complement(2597391..2598335) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC515540 __SEG__ Chr19 {Bos taurus} MTGRNQTTISEFLLLGLPIKSEHQNLFYTLFLAMYVTTVLGNLLILVLICLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQDLSIPYAGCLTQMYFFLFFADL
EDFLLVAMAYDRYVAICFPLHYTTIMSPRLCLFLVLLPWILTTFHAMLHTLLMARLHFCEDNVIPHFFCDSSALLKLSCSDTRVNELVIFFVGGLIIIIPFLLIIMSYAR
IVSSILKVPSAKGICKAFSTCGSHLTVVSLFYGTIIGLYLCPSAHNSTVKETVMSMMYTVVAPMLNPFIYSLRNRDMKGALRRVFCKKKNAFSL*
668 >lcl|XP_593580.4|Plus1804912..805865 NW_001494525 olfactory receptor, family 8, subfamily A, member 1-like LOC515545 __SEG__ Chr29 {Bos taurus} MAAENHSTVTEFILGGLTSQPELQLPLFFLFLGIYSVTMVGNLGMIALICLNAQLHTPMYYFLSNLSFVDLCYSSVTTSKMLVNFVSGKNTISYAGCMAQLYFFLLFVVT
ESYTLTVMAYDRYVAICRPLFYNIIMSQRACFLLLAGVYVMSVIGSNIETIILSKLSYCETLISHYYCDILALMKLSCFSTYHIDMIVFFLAGFDIIVTSLTILVSYAFI
LSSIFRIRTTEGRSKAFSTGGSHFAAMGMFYGTTAFIYLKPSTASSLAQENVASVFYTSVISMLNPLIYSLRNKNVKAAMQKTLRGKCFKANVITLS*
669 >lcl|XP_593724.4|Plus1complement(435184..436119) NW_001493367 olfactory receptor 1264-like LOC515666 __SEG__ Chr15 {Bos taurus} MKPMNRNNVTEFFLLGLTQNPKMQNIIFAVFLVIYIITVVGNMLIVVTVATSSLLESAMYFFLAYLSFIDASYSSVNTPKLIVDSLHESKTILFNGCMTQIFGEHFFGGA
EGILLTVMAYNRYVAICKPLHYTSIMNRWVCGLLVGVSWVGGFLHATIQILFIFHLPFCGPNVIDHFMCDLNPLLSLACTDTHTLGLFVAANSGFICLLNFLLLMVSYVV
ILRSLRTHSLEARRKALSTCVSHITVVVLFFVPCVFVYMRPAATLSIDKAVALFYTIITPMLNPLIYTLRNAQMKNAIRKLCSRKDILGGT*
670 >lcl|XP_593766.5|Plus1complement(52277..53206) NW_001492804 olfactory receptor MOR245-2-like LOC515694 __SEG__ Chr10 {Bos taurus} MNHSMVSEFVFLGLTNSWEIQLLLFMFSSIFYMASMLGNSLIVLTVMMNPHLHSPMYFLLANLSITDLGVSSVISPKMIYDIFRKHKVISFGGCIAQIFFIHIIGGVEMV
LLIAMAFDRYVAICKPLHYFTIMSRKMCLLLLVAAWIIGFIHSVVQLGFVVKLPICGPNIIDSFYCDFPRFIKLACTDTFRLESMVTANSGFISLGSFFILIVSYIFILI
TVRKHSSGSSSKALSTLSTHVMVVILFFGPCIFVYIWPHSTSHLDKFLVVFDAVLTPFLNSVIYTLRNKEMKVAMKKVCSQFIIYGRIS*
671 >lcl|XP_593767.1|Plus117208..18293 NW_001493185 G protein-coupled receptor 20 GPR20 __SEG__ Chr14 {Bos taurus} MPSTSPAGPSAGAAPNATAAAAAAWTNVSLPEMPLFHRFAQLDEQLHASFPGLWLALMAAHGVIFLAGMVLNGLALYVFGCRTRAKTPSVVYTINLVVTDLLVGLSLPTR
FAVFYGARGCLRCALPHVFGYFLNMHCSILFLSCICVDRYLAIVRPGGSRRWRQPACARAVCAFVWLAAGAVTLSVLGVTTAGGPCCRIFALTVLEFLLPLLVISVFTGR
IVCALSRPGLLHQGRQRRVRAMQLLLTVLVIFLVCFTPFHARQVAVALWPGMPHHASLVAYHVAVTLSSLNSCMDPIVYCFVTSSFQATVRGLCGRRGAECEPNSCDVVS
VQKSSKGSAHHHILGARAQAVTQALPNGPDA*
672 >lcl|XP_593853.4|Plus13571127..3572059 NW_001494955 olfactory receptor, family 2, subfamily A, member 5-like LOC515772 __SEG__ Chr4 {Bos taurus} MTENQTWVTEFILLGFPLSPSMQMLLFGLFSLFYVLTLMGNGVILGLISLDPRLHTPMYFFLSHLAIVDISYASNNVPKMLVNLLNKKNTISFVPCIMQTFLYMAFAHTE
CLILVVMSHDRYVAICHPLRYSVIMSWRVCTVQAVASWTCGSLLALVHVGLILRLPFCGPHEINHFFCEILSVLKLACADTKLNQVVIFAASVFILVGPLCLVLGSYARI
LAAILRIQSAEGRRKAFSTCSSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNKEVKGAFRRVLWKDRLM*
673 >lcl|XP_593961.4|Plus12210316..2211242 NW_001492801 olfactory receptor, family 4, subfamily N, member 5-like LOC515867 __SEG__ Chr10 {Bos taurus} MERENSTVVTEFILAGLTQSQDVQLLVFTLVLIFYLIILPGNFLIILTIRSDPSLTAPLYFFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGG
EMLLLNVMAFDPYIAICRPLHYSTVMNPRACYALLLALWLGGFVHSIIQVALILCLPFCGPNRLDNFFCDVPQVIKLACTDTFVVELLMVFNSGLLTLLCFLGLLASYAV
ILCRVHGSSSEGKSKALSMCTTHVIIILLMFGPAIFIYTRPFTALSADKVVSFFHTVIFPLMNPVIYTLRNQEVKASMRKILSQHMVC*
674 >lcl|XP_593989.4|Plus1complement(53850..54785) NW_001501816 olfactory receptor 281-like LOC515887 __SEG__ Chr5 {Bos taurus} MALRNHSTITEFILTGLSDDPHIQALLFVLFLVIYLLTVMGNLTMLLVIRADSHLHTPMYFFLSNLSFLDLCFSSVTVPKLLKDLLSEKKTISVEGCLTQVFFVFITAGT
EAFLLSMMAYDRYAAICHPLLYGQLMSTQLCVKLILASWGLASLNSVIIVLLAVNLDFCEAQTIHHYTCELPSLFPLSCSDVSVNIDILICSILLHGLGTFLPVVFSYAR
IVSTILSISSTTGRSKAFSTCSSHLIAVILFFGSGLIRYLMPSSGSSLDLLSSLQYSAVTPMLNPLIYSLKNMEVKAAVKRTLGKYLQYFK*
675 >lcl|XP_594083.1|Plus1complement(6634114..6635058) NW_003101170 olfactory receptor Olr878-like LOC515967 __SEG__ Chr5 {Bos taurus} MKNKTVLTEFILLGLTDVPELQVMVFIFLFLTYLLSIIGNLTILILTLLDSHLQTSMYFFLRNFSFLEISFTSIFIPRVLISITIGNKSISFAGCFAECFFAIFLGATEF
YLLAAMSYDRYVAVCKPLHYTTTMSSKVCTQLVLCSWLAGLMVIISPITLMSQQDFCESNRLNHYFCDYEPLRELSCSDTNLIQKVAFLVASVTLVVTLVLVILSYTSII
RTILKLPSVHQRTNAFSTCSSHLVVISLSYGSCFFIYVKPTAKEVDTFNKGVALLSTSAAPLLNPFIYTLRNQQVKQAFKDTVQKLVNLKEFHN*
676 >lcl|XP_594189.4|Plus11337463..1338398 NW_001493648 odorant receptor MOR10-like LOC540460 __SEG__ Chr19 {Bos taurus} MASGNLTWVSEFVFLGLSQTQELQLFLFLVFLLVYTTTLMGNLLIMVTVTFDSRLQTPMYFLLRNLAVLELCFSSVTAPKMLVDFLSKKKTISYQGCMAQIFFFHFLGGS
MVFFLSVMAYDRLVAISRPLHYVTIMNTQVCVGLVAASWVGGFIHSISQLALMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLIISNSGVLVLIWFLLLLVSYSA
ILVMLRSYSGKARRKAASTCTTHIVVVSMVFVPSIYLYARPFTSFSMDKAVSVSQTVMTPMLNPMIYTLRNQEMQAAVKRLGRCRLASRKE*
677 >lcl|XP_594226.2|Plus1complement(287854..288795) NW_003101172 olfactory receptor 78-like LOC516089 __SEG__ Chr15 {Bos taurus} MSVRPDHKISNSTFLLTGFPGLERDYPWLSIPFSCIYVMVLSGNCLVLHVIHTEPSLHEPMFYFLAMLALTDLCMGLSTVHTVLGILWGLSQEIGLDACIAQTFFVHGLS
CMESGVLLAMAFDRFTAICNPLRYTSILTNTRIINIGVVILGRSFLFITAPIVRLKFFHYCRHRILSHSFCLHQDLLRLACSDIRFNSFYALALVICTLLLDSVLIFISY
ILILHSVLTIASQEERLKSLKTCVSHICAVLVFYIPIIGLTMVHCFGKHLSPVVHVLMGNIYILFPPLMNPIIYSIKTQQIRNRIQRWFIKQT*
678 >lcl|XP_594274.4|Plus1527455..528423 NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC516132 __SEG__ Chr7 {Bos taurus} MEPGNNTHFSEFFLLGFSKDPKLQPLIYGLFLSMYLIAVFGNLLIILVTISDSHLHTPMYFFLSNLSFVDICFTSTTIPKILQNIENQSKVITYEGCLVQVYFYIFFAGL
DDFLLTVMAYDRFVAICHPLHYTVIMNPRLCGLLVLVSWMMSAMYSLLQTLMALQLTFCTEVEIPHFFCELNQMVQLACSDTFLNDMVMYLASVLLAGGPFAGILYSYSK
IVSSIRRISSTQGKFKAFSTCASHLSVVLLFYCTSLGVYLSSAATHSSDSSATASVMYTVVTPMLNPFIYSLRNKDIKRALKRVYGIVAIKRPIVLGQMKCP*
679 >lcl|XP_594279.2|Plus1complement(1887871..1888416) NW_001493648 teratocarcinoma-derived growth factor 1-like TDGF1 __SEG__ Chr19 {Bos taurus} MERFSYSVILIMAFSRALELGLVAGLGDLELAHPSQGELAFRDDGLWSQEEPAIRQQPSQFVASMGIQESKKLRRTCCLNGGTCMLGSFCACPPSFYGRNCEHDSCKENC
GSVPHDTWLPRKCSMCKCWHGQLRCFPQSFLPGCDSHVMDEHLTASRTSELTLSACALMLPGICLAIQSYY*
680 >lcl|XP_594427.2|Plus1721547..722497 NW_001494175 olfactory receptor Olr1686-like LOC516274 __SEG__ Chr23 {Bos taurus} MTMINESLAGDFILVGFSDHPQLEKILFAVVLISYLLTLVGNTAIILISYLDPMLHTPMYYFLTHLSFVDLCFTTSIAPQLLWNLRGPYKTISPTGCAIQLYVSLALGST
ECVLLAVMAFDRYVAVCRPLHYATGMHSRLCQSLVGMAWLSGVGNTLIQGTITLRLPRCGNRRIYHFICEVPAMVKLACVNIHANEVQLFMASLVLLLLPLTLILISYGC
IAQAVMRIRSAQAWRKALGTCGSHLLVVTLFYGTITAVYIQPNSSYAHSQGKFITLLYTIVTPTLNPLIYTLRNKDVKGALRRLVQKDRAQQSEKL*
681 >lcl|XP_594567.3|Plus1406814..407764 NW_003101172 olfactory receptor Olr114 (predicted)-like LOC516414 __SEG__ Chr15 {Bos taurus} MSAVSILNFNSSRFTLTGFPGLEVDYLWLSIPFASIYAMVFLGNCMVLHVIRTEPSLHQPMFYFLAMLALTDLCVGLSTVHTVLGILWGVIQEISLDSCIAQSYFIHGLS
FMESSVLLTMAFDRYIAICNPLRYSSILTNDKIMKIGVAILCRSSMLIPPVIIRLKFLNYCHPHILSHSFCLHQDLIRMACSDIRFNSIYGLALVISNLLLDAVLIIISY
IMILHAVLAIASREERIKSLQTCVSHICAVLVFYIPIIGLTMVHRFGRHLSPWVHVLMGNVYIIFPPLMNPIIYSIKTQQIRRRVQRLFYLKKCKS*
682 >lcl|XP_594575.3|Plus1complement(527244..528587) NW_001492891 adrenergic, alpha-2B-, receptor ADRA2B __SEG__ Chr11 {Bos taurus} MDHQEPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDR
YWAVSRALEYNSKRTPRRIKFIILIVWLIAAVISLPPLIYKGDQGPQPLARPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSHCRGPRAKGGPGERESKQ
PHPVPGEVSDSAKLPTLASQLATPGEANGCSQPRPGEKGDGETPEAPGTPALPPSWPAIPKSGQGQKEGVCGSSPEEEAEEEEEEGCEPQALPASPASACSPPLQQPQGS
RVLATLRGQVLLGRGTGTAGAQWWRRRTQLSREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTVFNQDFRRAFRRILCR
EWTQTAW*
683 >lcl|XP_594622.2|Plus1complement(424485..425423) NW_001492804 odorant receptor MOR10-like LOC516467 __SEG__ Chr10 {Bos taurus} MGGGNRSVVSEIVLVGLTSSLEMQLVLFLIFSVFYVTSILGNLLIVLTVTSDSHLHSPMYFLLANLSFIDMWVSSITAPKMISDLFKERKVISFQGCIAQMFFVHVIGGT
EMVLLIAMAFDRYVAICRPLHYLIIMNFRTCISLLVAAWTIGIIHSLIQILFVVNLPFCGPNKVDSFYCDLPRFIRLACTDTYRLELVVTANSGFISLGTFFILITSYIF
ILATVWQRSSGDLSKALSTLSAHIAVVVLFFGPCIFVYSWPFPTVPVDKFLAIFDVVITPFLNPAIYSLRNKEMKVAMRRIFSQMLSFRKLF*
684 >lcl|XP_594791.1|Plus1complement(561792..562313) NW_001494496 protein tyrosine phosphatase 4a1-like LOC516634 __SEG__ Chr29 {Bos taurus} MAPLNRPAPVEVTYRNMRFLITHNPTSATLSKFIEDLKKYGVTTIVRVCEATYDTALVEKEGIQVLDWPFDDGSSPSNQIVDDWLSLLNIKFREEPGCCIAVHCVAGLGR
TPVLVALALMEGGMKNEEAVQFIRQKRRGAFNSKQLLYLEKYHSKMRLCFKDSSGHRNNCCVQ*
685 >lcl|XP_594906.3|Plus1524725..525864 NW_001508735 armadillo repeat containing, X-linked 3 ARMCX3 __SEG__ ChrX {Bos taurus} MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDVGDCPGARYNDWSDDDDDNSENKGVVWYPPWARIGTEAGTRARARARARATRARRAVQKRAS
PNSDDTILSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKIYMNQVCDDTITSRLNSSV
QLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKFQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVVFENINDNFKWEENESTQNQFSE
GSLFFFLKEFQVCADKILGLESHQDFLVKVKVGKFVAKLAENMFPKSQE*
686 >lcl|XP_595062.2|Plus1complement(18586..19536) NW_001493327 olfactory receptor 564 (predicted)-like LOC516904 __SEG__ Chr15 {Bos taurus} MSAFKNTTSSSVVFFLTGVPGLEAFHTWISIPFCFLYATALSGNSLVLFAIIIQPSLHEPMYYFLSMLSTTDLGLSISTLVTMLGIFWFNAREISFNACLSQMFFIQLFT
VMESSVLLAMAFDRFVAISNSLRYASILTDFKIAEIGVAIITRGTLTLTPMVVLLKRLSYCRSHVLHHSYCFHPDVMKLSCTDTRINSAVGLTALITTAGVDSIFIILSY
LLIIKTVFSIASSEERKKAFSTCISHLGAVAVFYIPLISLSFVHRFGKWAPPYVHTLIANAYLLILPVMNPIIYSVKTKQIRRAVLKVLHTTATKK*
687 >lcl|XP_595100.4|Plus1complement(35398..36324) NW_001494525 olfactory receptor Olr1242-like LOC516940 __SEG__ Chr29 {Bos taurus} MAPGNNSFVTEFILLGLTDRPDLQLPLFFLFLGIYMVTVLGNLGLIILIALNSHLHTPMYFFLFNLSFIDLCYSSVFTPKMLINFTSKKNIISYVGCMAQLYFFCFFVIS
EIYVLTSMAYDRYVAICKPLLYNATMSPKVCSSLMLGSYLMAFSGAMAHTGCILRLTFCDANTINHYFCDVHPLLQLSCTSTYVNELVVFIVVGINIIVPSFTIFVSYCL
ILTNILHIKSTEGRSKALSTCSSHIIAISLFFGSSAFMYLKPSAAGSMDEEKISSVFYTNVVSVMNPLIYSLRNKDVKTALRKTLSRR*
688 >lcl|XP_595310.4|Plus1164480..165412 NW_001494524 olfactory receptor, family 2, subfamily B, member 2-like LOC517144 __SEG__ Chr29 {Bos taurus} MKNCSEVTEFILLGIPHTEGLETLLFVLFLPFYACTLLGNMSILVTVLSSNSLHTPMYFFLGNLSVFDMSFSSVTCPKMLLYLMGLSPRISYKDCVSQLFFFHFLGSIDC
FLYTVMAYDRFTAICHPLRYAVIMSPRVCVALAVGTWLLGCVHSSVLTLLTFTLPYCGPNEVAHFFCDIPALLPLACADTSLAQRVSFTNVGLVSLVCFLLILVSYTRII
ISILRIPSAEGRHRAFSTCSAHLIAILCAYGHIITVYLQPTPNPMLGTVVQILMNLVGPMLNPLIYTLRNKEVKTALKKVLHRTNHVLVI*
689 >lcl|XP_595420.3|Plus1complement(5330..6265) NW_001502368 odorant receptor MOR10-like LOC517252 __SEG__ Chr10 {Bos taurus} MYEANDSSVSEFVFLGLSTSRPVQHFLLAFSTVFYVTIVLGNLLVVFTVTFDPHLHSPMYFLLANLSSIDLCLSTLTVPKMISDLYSVHKTISFQGCIIQIFVLHTLGGS
EMVLLTAMAFDRYVAICKPLHYLTLMSPRVCLLLLCGAWAIGLIHSVVQLAFVIHLPFCGPNEIDSFYCDLPWFIKLACVDSYRMEFMVTANSGFISMGTFFLLIISYVF
ILVTMWKRSSGGLHKALSTLSAHITVVVLFFGPCIFVYMWPFPTVPVDKFLAILDFLVTPILNPAIYTLRNKDMKMAMRRLSSQLLSLKIS*
690 >lcl|XP_595585.2|Plus11629489..1630451 NW_001493981 olfactory receptor Olr60 (predicted)-like LOC517416 __SEG__ Chr20 {Bos taurus} MFFSWSFANISFFQPHAFLMIGIPGLEAIHGWISILFSSMYTAALTGNCLILLALTRTPSLHQPMYYFLSMLALTDMGLTLATMPTTLAVLWFDHRLIGFDTCLVQMFFL
HFFSVVESSVLLAMSFDRFVAISNPLRYASVHTNNVIIRIGLAIVARATVSLFPLPFLLKRLNFCPGKILLSHSFCFHADVMKRACADITVNIIYGLYVVLSTVGFDSLL
IVLSYTLILHTVMSLASPRERIRALNTCVSHILAVLVFFIPVIGVSMIHRFGRHLPPIVHALVAYVYLVVPPVLNPIIYSVKSKPIREAMLRVLSEKRKG*
691 >lcl|XP_595705.3|Plus1complement(95983..97182) NW_001495326 endothelial differentiation, sphingolipid G-protein-coupled receptor, 8 S1PR5 __SEG__ Chr7 {Bos taurus} MEPGLLRPAPRVSEVILQHYNYTGKLRGTRYQPGAGLRADAVVCLAVCALIMLENLAVLVVLGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPFTLRLSPGLWF
AREGGVFVALSASVLSLLAIALERLLTMERRGPAPASRRGRTLALAAAAWGLSLLLGLLPALGWNCLGRLEACSTVLPLYAKAYVLFCVLAFLGILAAICALYARIYCQV
RSKARRLRAHPRTGEGASMRARHTPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARACPVLLQADPFLGLAMANSLLNPIIYTFTNLDLRHALLRLVCCNRGPCC
RDPGASRRPGSAPGASGDLHRWLPPGLDGSSSRSERSSPQRDGLETSGSTACPGAPTVAGTLVTPPATD*
692 >lcl|XP_595741.3|Plus12564826..2565803 NW_001493662 olfactory receptor Olr1507-like LOC517569 __SEG__ Chr19 {Bos taurus} MALANLTSRPEFLLLGLMDGTDIHPLLFLLFLGVYLVNALGNLSMVVLVRSDGALRSPMYYFLGHLSLVDVCFTTVTVPRLLAGLLHPGQAVSFWGCFAQMYFFVALGIT
ESYLLAAMSYDRAAAVCRPLHYAAVMTPGRCMALVGASWAVAHLHSLLHTLLISKLSYPRATPVRHFFCDMTVMLSLATSDTSAAETAIFSEGLAVVLTPLILVALSYAR
ILAAVLGVRSAGGRRRAFSTCGAHLVAVSLFFGSILSVYFRPSSAYSARYDRLASVVYAVVTPTLNPFIYSLRNKEVKGALKRGLRWRAAPPRGVRAGLDSLASQ*
693 >lcl|XP_595841.5|Plus1complement(1987470..1988408) NW_001492801 olfactory receptor Olr1614-like LOC517667 __SEG__ Chr10 {Bos taurus} MSKVSNISHVVSEFILLGFPCRWEIEIFLFSIFFITYILTLLGNMAIVCAVRWDRRLHTPMYILLANFSFLEICYVNSDVPNMLANFFSQTKTISFARCLLQLYFFFSLG
TTECLFLSIMAYDRFLAICRPLHYPTIMTTKFCSSLVIFCWVYGFLWFLIPVVLVTQLPFCGPNVIDDFLCDLGPLLALASACAPVPGTVLICGTMSSLLIFATFFYIAG
SYTLVLRVVMQVPSVAGRKKAFSTCSSHLVVVFLFYGSVMMTYVSPGSGQAEGMQKFTTLFYSVLTPFFNPMIYSLRNKEMKDALKKVVGGS*
694 >lcl|XP_595871.2|Plus1596271..597530 NW_001495571 G protein-coupled receptor 63 GPR63 __SEG__ Chr9 {Bos taurus} MVVSAVLTASHTGASNTTFVVYENTYMNITVPPPFQYPGVGPLLRYSVESLAPTGMSSLTVNSTAVSPTPAASKSLNLPLQIILSALMMFILCVSFLGNLVVCLMVYQKA
AMRSAINILLASLAFADMLLAVLNMPLALVTILTTRWIFGKFFCRVSAMFFWLFVIEGVAILLIISIDRFLIIVQRQDKLNPYRAKVLIAVSWATSFCVAFPLAVGNPDL
QIPSRAPQCVFGYTTDPGYQAYVILISLISFFLPFLVILYSFMGILNTLRHNALRIHSYPEGICLSQASKLGLMSLQRPFQMSIDMGFKTRAFTTILILFAVFIICWAPF
TTYSLVATFSKHFYYQHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDACLDMMPKSFKILPRLPGHTRRRIRPSAVYVCGEHRTVV*
695 >lcl|XP_595898.3|Plus12353186..2354112 NW_001495357 olfactory receptor 332-like LOC517722 __SEG__ Chr7 {Bos taurus} MNQKNDTSTDFILLGLFPWFRHPNLILIIILIYTAAFTGNAILLLLIWLDSHLHMPMYFLLSQLSLIDLAYISCTVPKMVTNYFTGKKNISYFSCATQLFFFLTLGLAEC
ILLTLMAYDCYVAVCNPLRYTVLMNPNTCLQMAAAAWIGGALAALVHTIYPMNFPICGSREINHYFCEMPAILRLSCMDISAYEMVKFVSTIVFLLIPFILILTSYTLIF
LTVLRMNSQKGKNKALATCSSHMTVVSLYFGQAIFIYMTPTLAHTPEQDQIGAVLGTIVTPMLNPLIYSLRNKEVAGALRKCMGKCYN*
696 >lcl|XP_596185.3|Plus11388991..1391423 NW_001494915 TLR4 interactor with leucine rich repeats LOC518003 __SEG__ Chr4 {Bos taurus} MEAARAVRFLLVVCGCLALPPWAQPVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQDVLTYSLGGNFISNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLE
ELYLGNNLLQALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGNLLYLHLESNRIRFLGKNAFAQLGKLRFLNLSANELQPSLR
HAATFAPLRSLSTLILSANSLQHLGPRVFQHLSRLGLLSLRGNQLAHLAPEAFWGLEALRELRLEGNRLSQLPVALLEPLHSLEALDLSGNELSTLHPTVFGRLGRLREL
SLRDNALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQQLQNGSCTDPTSSVPPIADNKRRPLPTAPGEEV
APPAGALAEELLPQPQPQQRSRVLPGMAWDGAARELLGNRSALRLSRRGPGLQQPGSNAAAAAGTAPHPLDLLEKPEGARPTPSDPDPAEPTQTATLSYAPAGDPWQRAA
KQRLAAQQQESAAQSDGGVGLPPLVSDPCDFNKFILCNLTVEAVGADSASVRWAVRKHRSPRPLGGARFRLLFDRFGQQPKFHRFVYLPERSDSATLRELRGDTPYLVCV
EGVLGGRVCPVAPRDHCAGLVTLPEPGSQGGVDYQLLTLALLAANALLVLLALAAWASRWLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTTV
CALSEADLIEFPCGRFMDSGGGGAGGSLRREDHLLQRFAD*
697 >lcl|XP_596267.3|Plus1695072..696580 NW_001492996 zinc finger and BTB domain containing 37 ZBTB34 __SEG__ Chr11 {Bos taurus} MDSSSFIQFDVPEYSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQ
MQCVIDKCTQILESIHSKISVGDVDSVTVGAEETPESRNGVKDSSFFANPVEISPPYCSQVRQPTTSSDLRMETTPSKALRSSRLQEEGHSDRGSSGSVSEYEIQIEGDH
EQGDLLGRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGSYGSVLQHAYSYCQAASQPAGGVSEAFGSLSNSSPSRSMLSCFRGGRARQKRALSV
HLHSDLQGLVQGSDSEAVVSNPGFESSPRERSARGHWYPYNERLICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEICGKCFP
FQGTLNQHLRKNHPGVAEVRSRMESPERTDVYAEQKLENDASASEMALDSRMEIHTVSDAPD*
698 >lcl|XP_596620.3|Plus11003700..1004626 NW_001495357 olfactory receptor, family 6, subfamily F, member 1-like LOC518429 __SEG__ Chr7 {Bos taurus} MNTHNETLPQDFLLLGFPGSQILQLSLFMLFLVMYILTVGGNVAILILVSTSHQLHTPMYFFLSNLSFLEIWYTTAAVPKALAILLGKSQSISFTSCLLQMYLVFSLGCT
EYFLLAAMAYDRYLAICYPLHYGTIMNSLLSMQLALGSWVCGFLAIAVPTALISSLTFCGPHTINHFFCDIAPWIALACTSTRPVELVSFVIAFVVILSSCLITLVSYVY
IISTIFRIPSAQGRSKAFSTCSSHLTVVLIWYGSTIFLHVRTSIKEALNLTKAVHVLNTVVTPVLNPFIYTLRNKEVRETLLKKCKGK*
699 >lcl|XP_596655.3|Plus1complement(407929..408879) NW_001493327 olfactory receptor, family 51, subfamily E, member 2-like LOC518464 __SEG__ Chr15 {Bos taurus} MATPNHTSPSHSLFILLGIPGLEDQHTWISLPFLLSYLVAVLGNSLLVFIIMTERSLHEPMYFFLCMLGVADLILSTTTVPKALAIFWFHAGEISLDGCVTQIFFIHATF
IAESGILLAMAFDRYVAICDPLRYTTVLSRAVIIRVGLAVVLRSFSVILPDVFLVKRLPFCHSNMLPHTYCEHMAVAKFACADIRVNVWYGLSVLLSTVVVDALLILVSY
IFILNAVFQLPSRGALQKALGTCGSHLGVISMFYLPGIFTIIAQRFEHHVPPYIHILLANVCMLAPPMLNPIIYGVKTRQIRECVVSTLSSQWKLC*
700 >lcl|XP_596659.4|Plus1complement(937288..938208) NW_001494173 olfactory receptor MOR256-13-like LOC518468 __SEG__ Chr23 {Bos taurus} MTNQSCQEGFILLGFSDRPKLEQILFVFVLIFYLVTLVGNAVIILVSRLDPSLHMPMYFFLTNLSFLDLCFTTSSIPQLLFNLGSPDKTISYVGCAIQLFMFLGLGGTEC
VLLAVMAYDRFTAICKPLHYSVLMHPQLCWKLVSVAWGVGLLNSLVMSPVTMKLPRCGRCRVKHFLCEMPALIKVACVDTVAVESAVFILSVIIVLVPLSFILISYSCIA
LAVLRMKSAAGRRKAFNTCGSHLTVVSLFYGNIIYMYMQPGNNSSQDQGKFLTLFYNLVTPMLNPVIYTLRNKDVKGALRRLVSTK*
701 >lcl|XP_596665.4|Plus12396081..2397016 NW_001495357 olfactory receptor Olr1414-like LOC518474 __SEG__ Chr7 {Bos taurus} MDGKNETLTDFFLLGLFPELQYISVLITSILLVYIIAFTGNAILILLIWVDSHLHTPMYILLSHLSLIDLALISTTVPKMAINFFSGKKNISKVACGTQIFFFFALGGGE
CLLLTLMSYDRYVAICNPLRYTVIMNPRVCLQMALVSWGGGALNSLFNTIYTMHFPFCGSREIHHFFCEMPAVLKLSCEDTSLYEMVVSVICIVFVLLPLGLIMASYMLI
FLTVLHMNSPEGRRKALAICSSHLAVVSLYYGPAMIIYMTPHSFHTLEQDEILSMINTIFTPMLNPLIYSLRNKEVLGALRKAMNRRFILS*
702 >lcl|XP_596779.4|Plus1complement(1376888..1378156) NW_001495062 somatostatin receptor subtype 3-like SSTR3 __SEG__ Chr5 {Bos taurus} MNTPGSLSLLPVTSEPGNTSSAWPPDAVLGNVSAASSAAGLAVSGILIPLVYLVVCVVGLLGNSLVIYVVLRQTATPSVTNVYILNLALADELFMLGLPFLAAQNALSYW
PFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPL
LVICLCYLLIVVKVRSAGRRVRAPSCQRRRHSERKVTRMVVAVVALFVLCWMPFYVLNIINVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLL
RPSRRVQNQEPPVGPPEKTEEEEEAGDGEDRHAGAGKQGDWGEMNGQVNQIIQPGPSGQERPPSSTTSKERQFLPQEPLAGEKSDTLHISYL*
703 >lcl|XP_597017.5|Plus11221137..1222069 NW_001495357 olfactory receptor Olr1455-like LOC518816 __SEG__ Chr7 {Bos taurus} MENTNDTTGINFILLGLLNYTQIHIFFFSVVLMTFLTSLMSNIFMIMLIRMDSRLCTPMYFLLSQLSLMDVMLVLTVVPKMVGNYLMHIRSISSAGCGAQIFLFVTLEGG
ECFLLAAMAYDRYVAICHPLRYPILMNQKLCLHMTAGSWLLGGVDGLMQAGVTLSFPYCHSREINHFFCEAPSLVRLACTDTMIFEFFMYICCVMMLLIPVSFILASYGL
ILITVLRMHSAAARKKAFATCSSHLAVVGFFYGTIIFIYMRPKSYRSVAHDKVVSAFYTIFTPVLNPLIYSVRNKEVKGALRMWLEKYFQ*
704 >lcl|XP_597374.2|Plus11088559..1089503 NW_001494955 olfactory receptor 49-like LOC519161 __SEG__ Chr4 {Bos taurus} MLKNYSSVTEFYLLGFPGSKELHSVLFATFFFFYSVTLIGNMVIILTVCVDKRLQSPMYFFLGHLSVLEILITSVAVPLMLWGLLLPGMQAISLSACCVQLYLYLSLGTS
ELLLIGAMAVDRYVAVCNPLRYTSIMNSHTCLWVVIVSWVFGFLFQIWPAYATFHLTFCKSNVLDHFYCDRGQLLKLSCDNSLFTEFILFLMAVFIIVGSMIPTIVSYTY
IVSTILKIPTASGRRKAFSTCASHFTFVVIGYGSCLFLFVKPKQTQAAEYNRVASLMVLVVNPFLNPFIFTLRNDKFIEAFRNVMKRCYQLLKD*
705 >lcl|XP_597389.5|Plus1complement(606268..607191) NW_003101172 olfactory receptor 598-like LOC519176 __SEG__ Chr15 {Bos taurus} MSYMDPKTVTLIGIPGLEHVQFWIGFSFFAVCLVALLGNIILLIIIPTELSLHQPMYIFLAVLAATDIGLCVAIALKMLAIFWFGFYSTAFDACLAQLFFIHALQGMESG
ILLAMAFDRYVAICDPLRHTTTLTPFLLVSMVLAVAIRAAVLVGILPILLKRLHFFQSIVIAHSYCEHMAVVKLAAEDTHVNKTCDLFVGFTILGFDMIFILISYILIFQ
AVFCLHQKEARLKAFNTCTAHIFVFLEFYILAFFSFFSHRFGHVVPSTHILLSTVYLLVPPALNPIVYGVKNKAIRKHVAWIFFLNH*
706 >lcl|XP_597510.3|Plus12687948..2688892 NW_001494714 olfactory receptor MOR123-1-like LOC519294 __SEG__ Chr3 {Bos taurus} MDLVNHTWTQNFLLAGFTTTGALQPLAFLGTLCIYLLTLAGNLFIIVLVQADSRLSTPMYFFISVLSFLELWYVSTTVPTLLHTLLHRHSCISSTGCFVQLYVFHSLGMT
ECYLLGVMALDRYLAICRPLHYHALMSRQVQLWLAGATWAAGFSAALVPASLTATLPFCLKEVAHYFCDLAPLMRLACVDTRWHNEVHGAVIGVATGCNLVLILGLYGGI
LRAVLKLPSAASRARAFSTCSSHITVVVLFYASAFTVYVGSPGSLLEGIDKHIALVYAFLTPFLNPIIYTLRNKEVKDAMKRVRVRIRTILQEV*
707 >lcl|XP_597656.4|Plus12562468..2563409 NW_001494955 olfactory receptor 49-like LOC519437 __SEG__ Chr4 {Bos taurus} MANLSHPSEFILLGFSPLGELQVLLYGPFLVLYLLAFIGNTVIIIMVFVDTHLHTPMYFFLGNFSLLEILVTMTAVPRMLSDLLAPRKVISFTGCMVQFYFYFSLGSTSF
LILSDMALDRFVAICHPLHYGTLMRGAVCAQLAGAAWATPFLAMVPTVLSRVHLSYCHGNVINHFFCDNAPLLQLSCSDTKLLESWDFVMALAFVLSSFLVTLISYGYIV
STVLHIPSASGRQKAFSTCGSHLTLVFIGYSSTIFLYVQPGKAHSAEVNKTVALVTSVLTPFLNPFILTLHNETFKAVLRGQMQRLKGLLQAL*
708 >lcl|XP_597829.2|Plus1819004..820965 NW_001508835 kelch-like 34 KLHL34 __SEG__ ChrX {Bos taurus} MSYFLSYCKAHGGSLLTGYQALRAEGFLCDVTLEAEGSEFPAHRSLLACSSDYFRALFKSHTRESQASVIHLHVPSAAGLQRLLDFIYTAWLPLSMDTVEDTLEAASYLQ
VTEALGLCGRYLERQLALENCCFAANVAARFGLAHTLSAAERCIVTHLRELLARGAGPAGLLELNPASLRAVLGAPDVARVPEARLLGLALAWLRQEPEAERLAHCTQLL
ERVRFGLVPADVLRRVYSGSGLTLPARVKGLIIQALNYHTSPSRQPLMQGEQTSVRSPQTRILLVGGRRGREVVTEEVVVPPRAARGRGAAPEPEPEEEEGEEEEEEEEQ
VEEEEWELTQDVVAFDVYNHRWRSLTRLPAQLLGHSVCVAGNFLFVLGGESPSGGACSPPADGPMAVVAQVHRYDPRFHVWTTVPPMREARAHFWCGAVGEGLLAVGGLG
AGGQALASVEMYDLRRDRWTAAGALPRALHGHAGAVGDRGVVYISGGKAGRGDGGASSLRDVFSLAPGEQTWSKRAPMGTARFGHHMAALRGAVFAFLGRYEPFSEIERY
DPGTDQWTRLRPLPYDRFCYGLALVEETVLLLGGLKWRDSRQVPTRNVVGYDLDLDRWEDIGCALPWAWSGLQCAVLQLAEGGDEQREGEPGETPDFVLGLMG*
709 >lcl|XP_598133.1|Plus1339877..340830 NW_003101172 olfactory receptor Olr115 (predicted)-like LOC519902 __SEG__ Chr15 {Bos taurus} MADNATHHYISSFFLVGIPGLQDFHCWIGIPVCLLFSLTLLGNSIIIITIKLEPSLHQPMYFFLGMLAMNDMALASSTAPKMLGIFWLDAHWIDFDICLAQLYFIHTFCI
IESALLVAMAFDRYVAICIPLQYTTLLTTTMVMKMGLASVVRAIFLVLPGPFLIRRLPYYTKYVINHAYCEHMAVVKLASANTHVNRTYGISVAFSVMVLDLGLIATSYL
KILQAVFRLSSQNARSKALGTCAAHVCTILVSYTPALFSFLTHRIGKKVPPSVHIIFASLYLLVPPTVNPLVYGVKTKQIRDRVIGLFFPNKKISEN*
710 >lcl|XP_598233.3|Plus1674785..675717 NW_001494175 olfactory receptor Olr1654-like LOC520002 __SEG__ Chr23 {Bos taurus} MKGTNASTLAGFTLLGFSDQPHLEMVLLLVVSIIYILTLMGNTAIILVSYFNPKLHTPMYFFLSNLSFLDLCFTTSVVPQMLWNLKGPDKTISYTGCVIQLYVALGLGST
ECVLLTVMAYDRFNAICRPLHYGVIMHPKLLQQLAALAWISGFVESTVQTILVFQLPLCSHHMVDDFMCEEPALIKIACVNTTFLENELSIACVLYVVIPLGLILVSYGC
IVRSMLKIKSTEGRRKAFGTCGSHLIVVVLFFGTLASIYIQPKSKYTQNYSKFLTLFYTVVTPSLNPLIYTLRNKEAKWALRRLLGRDPS*
711 >lcl|XP_598243.3|Plus11326772..1327758 NW_001494480 olfactory receptor 414-like LOC520012 __SEG__ Chr28 {Bos taurus} MKLWLEIHLIVPETSFSLRTMSNQTLVTKFVLQGFSEHPEYRVLLFSCFLSLYSVALTGNILIILAIAFNPRLRTRMYFFLFNLATMDIICTSSIMPKALEGLVLEENSI
SYGGCMAQLYFLTWAASSELLLLSVMAYDRYAAICHPLHYSTAMSKAFCGMLVAGVWALCAFNTAIHAGLMLRLDFCGPNVVAHFFCEVPPLLLLSCSSTYVNSIMIVLA
DAFYGILNFLMTIVSYGFIISSILKMRTAEGKKKAFSTCSSHLVVVCMYYAAVFCAYISPVSSYSAEKSKLAGVLYTMLSPTLNPLIYTLRNKEVKAALRKLFPFFRN*
712 >lcl|XP_598415.1|Plus1349584..350558 NW_001493639 olfactory receptor Olr4-like LOC520180 __SEG__ Chr18 {Bos taurus} MERALYLGNMSGVQEFILLGLSARQGVRVVVLAVFLPLYLLTLLENALIIFLVCSHTELHKPMYFFLGNLSCLEMCYVSVTMPSLLAGLWTGPYHVPFTACLIQLFLFIS
LISTKCTLLASMACDRYVAICHPLRYPLLMRPQVCLGLAGTSWLGGLLVSVAKTACIASLSYCSPNVLNHFFCDVCPLLNLSCTHVALTELVDFLSAIVTFCGTLLVALA
SYSAIGVAVLRMPSATARRKAFSTCASHLVVVGIFYSVALFMYSCPSRVESTDLHKLLSVIYTVVTPACSPVVYCLRNREVHAALRRTFHPCKGSSVRTDISRS*
713 >lcl|XP_598416.4|Plus1complement(355441..356379) NW_001493639 olfactory receptor Olr8-like LOC520181 __SEG__ Chr18 {Bos taurus} MERSLESGNVTRVQEFVLLGLSTSPETREVLFAVFLPLYLLTLLENALIVFLVCSHTELHKPMYFFLGNLSCLEMCYVSVTMPSLLAGLWMGPYHVPFPACMTQLFFFIA
LICTECTLLASMAYDRYVAICRPLRYPLLMRPQVCLGLARTSWLGGLLVSVAKTACIASLSYCGPNVLNHFFCDVSPLLNLSCTHVALTELVDFLSAIIILWGSLLVAIA
SYVAIGRAVLHMPSAAARCKAFSTCASHLVVVGIFYSAALFIYARPSRIEAMDLNKMLSVVYTVATPMCNPVIYCLRNREVQAAFRRALRGS*
714 >lcl|XP_598492.2|Plus13066873..3067850 NW_001494714 olfactory receptor Olr1602-like LOC520257 __SEG__ Chr3 {Bos taurus} MITKVLEVDNHTVTTHFVLLGFPTRSAFQLLLFFVFLAIYLLTLVENFLIILVIYSDGKLHKPMYFFLSNLSFLEMWYVTVISPKMQIDFLSHDKTISFNGCMTQLYFFV
TFVCTEYILLAAMAFDRYVAICNPLRYPLIMTNQLCGTLAAGCWFCGLMTAMIKIVFIARLYYCGTPRINHYFCDISPLLNISCEDSSQAELVDFFLALMVIAVPLCVVV
ASYTTILTTVLRIPSSQGRHKAFSTCASHLAVVILFYSTTLFTYARPKLMYAYNSNKMVSVLYTVIVPLLNPIIYCLRNREVKAALRKTILCKSSEPREDGAVIN*
715 >lcl|XP_598639.2|Plus1314956..315897 NW_001501890 olfactory receptor 73-like LOC520399 __SEG__ Chr15 {Bos taurus} MDKQNQTVPGEFILMRITDRPELQAPFFVLFLTIYAVSAVGNLGMIVLTKVDSKLQTPMYFFLRNLAFIDLGYSTSVGPKMLVAFVTDQNTISYHWCAMQLTFFILFIIS
ELFILSAMAYDRYVAICNPLLYTVVMSPRICWVLVAVPYVYSASVSLITTIQIFISSFCGYNIISHFYCDSLPLLTLLCSSTWEIELFILICSVFNLVSSFLIVLVSYIL
ILKAILKMNTAQGRQKAFSTCGSHLTVVAVLYATLAFMYMQPKSSHSFDTDKMASVFFTLVIPMLNPMIYSLRNKEVKGALHRMWKNLCKIPI*
716 >lcl|XP_599085.3|Plus12421000..2421953 NW_001493662 cOR1P2 olfactory receptor family 1 subfamily P-like LOC520835 __SEG__ Chr19 {Bos taurus} MAGGNQSSVFEFLLWGLSEQPEQQHRLFLLFLWMYLVTVAGNLLIILAIGTDTRLHTPMYFFLASLSCADILFISTTVPRALVNIQTQNRSISYVECLTQLYFFLTFGDM
DIFILTTMAYDRYVAICHPLHYAMVMSRRCCIILVTACWTLTSLVAMTHTFLIFRLSFCSKKIIPDFFCDLGPLMKVSCSDTQVNERVLLFLGGAVILIPFGLILVSYIR
IVSAILRVPSAQGRYKAFSTCGAHLAVVALFFGTVIRAYLWPSSSSSSSIEEDTAAAVMYTVVTPLLNPFIYSLRTKDMQGALGRLLRGKVSFSCGQ*
717 >lcl|XP_599147.3|Plus1complement(133872..134813) NW_001502138 olfactory receptor 651 (predicted)-like LOC520895 __SEG__ Chr15 {Bos taurus} MYNLSCYNPGSFILAGIPGLEKFHVWIGIPFCVIYGLAIVGNGTLLYLIVVEDSLHEPMFFFLSLLATTDLILSTDTVPKLLSNLWLGSQEITFTGCLAQMFFLHFSFVV
DSAILLTMALDRYVAICFPLRYTSILAPQVIIKLVVVIVVRSFSVILPDVFLLKRLPFCGTRIIPHTYCEHIGVARLSSTDISINIWYGFSVPVMTVASDVIFIAVSYIF
ILRAVFHLSSQGARQKALGTCGSHVCVILIFYTPAAFSILAHRFGHSVPRNMLILFANFYVAIPPALNPVVYGVKTKKIQDKFVLLFTLKKTQ*
718 >lcl|XP_599400.3|Plus1complement(1434574..1435539) NW_001494480 olfactory receptor 49-like LOC521142 __SEG__ Chr28 {Bos taurus} MIVRDTERTVGVKNESTIQEFVLEAFPAAQHLGGLLFLVHLLAYLASIMGNTVIILITWADHRLQTPMYVLLSTFSFCECCFITTVIPKLLSIFLSGRQTIPFPACLTQA
FFFLFIGAGIFFLMAVMSLDRYLAICKPLHYASIMNLRVSFLLIFLCYSLSFIFFTGLMLRVSQLSFCGPNIISHFFCDLGSLIHLSCSDTSSVETYFFFVTSFVILLSL
IVTITAYSNIVITILRLPSAKERQKAFSTCSSHLIVLSLMYGSCVFIYVKPKQVDRLDSNKEAALVNTVVTPVLNPVIYTLRNKQVHQALRDTLSRVRWQK*
719 >lcl|XP_599425.3|Plus1183570..184493 NW_001494179 olfactory receptor, family 2, subfamily B, member 2-like LOC521167 __SEG__ Chr23 {Bos taurus} MEWDNQTFNPDFILMGIFSYTPTHVFLFSLVLGIFTMALLANTLMVLVIYLDTRLHTPMYFLLSQLSLMDFMIICTTVPKMAHSYLSGRKSISVAGYEAEICFCVSLCGA
ECFLLAVMAYDRYVAICYPLQYPSLMNWNLCRLMAASSWFLGVFDGIVDVAVTLSFSYCSQAISQFFCDVPALLHLSCMDTSTFETLIFICCEVMLLLPLSLINISYTCV
IITIIRMSSGEVWHKTFTICTSHLIVVGLYYGVAMFIYKRPTSNRSPAQDKMVSAFYTILTPMLNPLIYSLQNKDVAKVFSKVLGKK*
720 >lcl|XP_599517.2|Plus1435187..436266 NW_001492776 histamine receptor H2 HRH2 __SEG__ Chr10 {Bos taurus} MAANGTASSSCLDPTAFKVTVTVVLILLILITIAGNVVVCLAVGLNRRLRSLTNCFIVSLAITDLLLGLLVLPFSAFYQLSCQWSFGKVFCNIYTSLDVMLCTASILNLF
MISLDRYCAVTDPLRYPVLVTPVRVAVSLVLIWVISITLSFLSIHLEWNSRPENHSDSHTIPKCKVQVNLVYGLVDGLVTFYLPLLVMCITYYRIFRIAREQARRIHNVG
PWRAATLREHKATVTLAAVMGAFIVCWLPYFTVFVYRGLRGDSAVDKTVEDVVLWLGYANSALNPVLYAALNRDFRTAYQQLFRCSPAGQDARRTSLGSNSSQLVRHPGQ
GPRWPEERPLRLQVWSGTELTAPQGATDR*
721 >lcl|XP_599625.3|Plus1complement(187561..189330) NW_001494318 frizzled homolog 9 (Drosophila) FZD9 __SEG__ Chr25 {Bos taurus} MAVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQVVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPA
CRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPAEDALQGAGGTCENPEKFQYVEKSRSCAPRCGPGVEVF
WSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWV
VLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIIILTLRKVAGDELTGLCYVANMDAAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLE
KLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQACSAATTPGGRRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCHRKMAAGRARA
KACRAPGGYGRGTHGHYKAPTVVLHMTKTDPSLENPTHL*
722 >lcl|XP_599911.1|Plus1255715..256641 NW_001493369 olfactory receptor MOR235-2-like LOC521645 __SEG__ Chr15 {Bos taurus} MDVFSPSNNVTEFVLLGLTQNPHVQKILLIVFLFIFLFTVLSNLLIVITISLSPTLSAPMYFFLTYLALLDASFTSVTTPKFIIDLLFQRRTISWRGCLTQIFLEHFLAA
SEAIVLIAMAYDRYVAICKPLHYTTIMRQGLCQLLVVVAWIGGILHASVQILFTTDLTFCGRNVIDHFMCDFFSLLELACSDTYRLGMVVAANSGGMCLLIFSMLLISYI
VILSSLRSHGSEGRRRALSTCGAHFTVVVLFFVPCVFTYTRPVATYPVDKWVAMFFATLTPMLNPIIYTVRNTEVKKAMRSLMKKRAT*
723 >lcl|XP_599944.1|Plus1352635..353582 NW_001493327 olfactory receptor, family 51, subfamily E, member 2-like LOC521676 __SEG__ Chr15 {Bos taurus} MKFTNHSQQNPTSFLLMGIPGLEASHFWIAFPFCSMYTLAVLGNMAVLLVVYSEPELHQPMYLFLCMLSIIDLVLCTSTVPKLLALFWANTAEITFGGCATQMFFIHGFS
AVESGILLAMAFDRYLAICWPLHYGSLLPPEAVGKLGAAAVFRGLGLMTPLTCLLARLSYCGRVVAHSYCEHMAVVKLACGGTQPNNIYGITAATLVVGTDSICIVISYA
LILRAVLGLSSKEARAKTFGTCGSHLGVILLFYIPGLFSFYTQRFGQHVPRHIHILLADLYLVMPPMLNPLIYGMKTKQIRDGALRLLKQGIVQS*
724 >lcl|XP_600016.4|Plus1complement(397023..397988) NW_001492804 odorant receptor MOR10-like LOC521749 __SEG__ Chr10 {Bos taurus} MDGGNRSVVSEFLLQGLTSSWEVQILLFLLFILFYIASMLGNLLIVLTILSDHHLHSPMYFLLANLSFIDTGVSSIATPKMISDLFRRHKVISLRGCITQMFFIHTVGGA
EMVLLTVMAYDRYVAICKPLHYPTIMSLRMCTSLLAVAWTIGLIHSVTQLAFVVNLPFCGPNEMDSFYCDFPRFIKLACTDTYRLEFLVTANSGFISMGTFFILIVSYIF
VLVTVRKHSSGGSSKALSTLSAHITVVVFFFGPCIIVYVWPFPTLPIDKFLAIFDALITPFMNPIIYTLRNKEMKMAMRRLFGKVLSFKKSFFMHNSRNSD*
725 >lcl|XP_600175.4|Plus111058..11999 NW_001494525 olfactory receptor 974-like LOC521903 __SEG__ Chr29 {Bos taurus} MDTGNHSSVTEFILEGLTDQPGLQLPLFFLFLMIYMVSMVNNLGLVILIRISSQLHVPMYYFLSNLSFIGLCYSSVIIPKMLVNFMSEKNFTSFPECMVQLFFFCFFGIN
DSYMLTAMAYDRYVAICNPLLYTVTMSHRVCFLLVTGVYIMGAVGASIHTSFISSRSFCGTNVIHHYFCDILPLLNISCSRDYTKELSVMILVGFNVFACAVAIFISYAF
ILPSILRIHSAEGRSKAFSTCSSHLAAVGVFYGSIIFMYFKPSTSDTVQEKVASVFYTTVIPMLNPLIYSLRNKDVKESIKKVLKGGIVPRSV*
726 >lcl|XP_600414.2|Plus1718657..720072 NW_001493023 CAP1 protein-like isoform 2 LOC522140 __SEG__ Chr12 {Bos taurus} MADMRNLVERLERVVGRLEAVSHASDTHCGYGDSAAKGTTPYVQAFDSLLAGPVAEYLKISKESGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQ
IQEVVTFREKNRGSKLFNHLSAVSESIQALGWVAMAPKPGLYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSRTGPVAKELSGLP
SGPSAGSGPPPPPRQVHLPPPVPTSSGSDDSASRSALFAQINQGESIIHALKHVSDDMKTHKNPALKAQSGLIRSGPKPFSASKPDPPKPVTKKEPALLELEGKKWRVEN
QENVSNLVIEDTELKQVAYIFKCVNSTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVTVQVMGKVPTISINKTDGCHVYLSKNSLDCEIVSAKSSEMNVIPTE
GGDFNEFPVAEQFKTLWNGQKLVTTVTEIAG*
727 >lcl|XP_600425.4|Plus1184496..185443 NW_001502164 olfactory receptor, family 8, subfamily J, member 3-like LOC522150 __SEG__ Chr15 {Bos taurus} MAHENFTRVIEFILTGVSERPDLQIPLFFVFLVIYGLTVTGNLSIITLTSVDSRLQTPMYFFLRHLAIINLGNSTVIAPKMLINFLVKKHTTSFYECATQLGMFLVFIVA
EIFILAVMAYDRYVAICNPLLYLAVVSRRVCFLLVSLTYLYSFSTAIVASSSVFSMSYCSSNVINHFYCDIVPLIALSCSDTSFPETVVFVSASTNLVFSIITVVASYFN
IVLSILRIRSSEGRKRAFSTCTSHMTAVSVFYGTLLFMYLQPQTNHSMGADKMASVFYTLVIPMLNPMIYSLRNKDVKAALKRFLTNSCCSFKLI*
728 >lcl|XP_600535.2|Plus1897914..899182 NW_001493933 5-hydroxytryptamine (serotonin) receptor 1A HTR1A __SEG__ Chr20 {Bos taurus} MDVLSPGQGNNTTSSQGPFGTRGNATGISDVTFSYQVITSLVLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAITDLMVSVLVLPMAALYQVLNKWTLGQVTCD
LFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFR
AARFRIRKTVKKVDKKAANHRLAASPAPQPRKSVSGESDSRDWRQGTENKVTGAPCANGAVRQGEEGAALEVIEVHRVGNSKEHLPLPSEGGAVPYVPASFEKKNERNAE
AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFCRR*
729 >lcl|XP_600595.3|Plus11029846..1030775 NW_001494173 olfactory receptor 1362-like LOC522315 __SEG__ Chr23 {Bos taurus} MEKSNDSSEYGFILVGFSDRPKLEMVLFIVNFTLYSVAVLGNSAIILVCILDSRLHTPMYFFLANLSFLDLCFSTSCVPQMLVNLWGPDKTISYAGCVVQLFSFLSVGGV
ECLLLAVMAYDRYAAVCRPLYYTVIMHPQLCLRLVAVAWGSGLVNAIVMSPLTMTLSRCGQRRVNHFLCEMPALIKMACVDARAVEMLGFTFAILIVLLPLTLILVSYGY
IAAAVLRIKSAAGRRKAFNTCSSHLTVVSLFYGSIIYMYMQPGNSSSQDQGKFLTLFYNLVTPMLNPLIYTLRNKEVKGALKKVLGRQQ*
730 >lcl|XP_600839.3|Plus1382407..383351 NW_001494720 putative olfactory receptor 10J1-like LOC522554 __SEG__ Chr3 {Bos taurus} MKRQNQSMITEFILIGFSNLGDLQILLFFIFLLVYLTTLTANATIMTVIHLDRALHTPMYFFLFVLSCSETCYTLVIVPKMLTNLLSTAPTISLSGCVAQLYFFVGLACT
NCFLIAVMGYDRYVAICNPLNYTLIVSRATCTQLVLASSFCGFLISAVVNVLVFSVPFCSSNQINHFFCDISPVIKLGCTDTNLKEMVIFFLSILVLLVPLVLIFISYVF
IVSTILKISSVEGQRKTFATCASHLTVVIVHYGCASFIYLRPTSLYSSDKDRLVAVTYTVITPLLNPLVYTLRNKEVKTALKKVLSRYLLSKTV*
731 >lcl|XP_600845.3|Plus19324..10259 NW_001495359 olfactory receptor Olr1654-like LOC522560 __SEG__ Chr7 {Bos taurus} MVGGNASSVTDFILVGLFPEFQHSIVLNFVVIFIYILAFLGNLLLIVLIWGDSRLHTPMYILLSQLSLTDLTLTSTIVPKTASNFFTGKRTISWIGCGTQSFFYLMLGMS
ECLILTLMAYDRYVAVCIPLRYLTIMSPRFCLHMVAGCWFGGSISSFIHTVYPMHFPICGSREIHHFFCEVPVLIKLSCEDTSVYQLVVVVTSIVLLVVPFSLIIASYTL
IFLTVLHVNSVKGRKKALATCSSHLTVVSLFFGPNIFIYMTFTSSHSPEQDQALSLFSNILTPMLNPLIYSLRNKEVVAALMKLMGRCGVS*
732 >lcl|XP_600867.4|Plus1complement(2390692..2391621) NW_001493662 olfactory receptor, family 1, subfamily A, member 1-like LOC522582 __SEG__ Chr19 {Bos taurus} MREDNQSSTLDFILLGVSGQQEEEDVFFILFLFIYPITLIGNLLIILAIRFDVRLHNPMYFLLASLSFVDIFFSSVTIPKALANHLLGTKAISFGGCLTQMCFMLALGNT
DSYILAAMAFDRAVAITRPLHYTTIMSPRTCVLLVIGSWVIGNVNAFPHTLLTASLSFCGNQEVANFYCDIASLLKLSCSDTHFNVKMMYLGAAVFSVPLLCIIISYVRV
FSTVLRVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVITVMYIAVTPMLNPFIYSLRNRDMKAALGKLFSRRIFS*
733 >lcl|XP_600893.2|Plus1495328..496275 NW_001492801 odorant receptor MOR10-like LOC522609 __SEG__ Chr10 {Bos taurus} MEEAVLLNQTTVVTCFRLRGLSINQNVQMAAFAMFLVFYVLTLIGNILIVITIIDDHHLHTPMYFFLSNLSFIDVCHSTVTVPKMLIDTWSEEKLISFDACVTQMFFLHL
FACTEIFLLTVMAYDRYVAICKPLQYMTVMSWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCDPDEIDNFFCDVPQVIKLACTDTHIIEILIVSNSGLISVVCFVVLVV
SYAVILVSLRQQISEGRRKALSTCAAHLTMVTLFLGHCIFIYSRPSTSLPEDKVVSVFFTAVTPLLNPIIYTLRNEDMKNALNKLMGRVKGREKK*
734 >lcl|XP_601035.3|Plus1128642..129646 NW_001493042 G-protein coupled receptor 12-like GPR12 __SEG__ Chr12 {Bos taurus} MNEDPKVNVSGLPPEFVDAGASGNISAEVSSQVPVLQPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLIVNFVFAYLLQSE
ATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLFMLWGTSICLGLLPVLGWNCLRDESTCSVVRPLTKNNAAILSVSFLFTFALMLQLYIQI
CKIVMRHAHQIALQHHFLATSHYVTTRKGISTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLVCCGCVPPSLSQRARS
PSDV*
735 >lcl|XP_601063.4|Plus1300442..301389 NW_001501890 hypothetical protein LOC522775 __SEG__ Chr15 {Bos taurus} MAPGNHTHVTEFILMGVSDHPELQIPFFCVFLIIYGLTLAGNLGIVILTSVDSQLQTPMYFFLKHLAIINLGNSSVIAPKMLVNFLVTKKTISYYGCAIQLGGFLVFIVA
EIFVLAAMACDRYVAICSPLLYQVVVSPRICLLLAALIYIYSLTTALTVSSCVFSMSYCSSNAINHFYCDNVPLLALSCSDTYIPETAVFTFSGTNLFFSMIIVLISYFN
IILAILRIRSSEGRQKAFSTCASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPVLNPFIYSLRNKDVKDALKRFLDNPCQSFKSV*
736 >lcl|XP_601243.3|Plus1complement(752036..752992) NW_001495357 olfactory receptor Olr1654-like LOC522954 __SEG__ Chr7 {Bos taurus} MMEIANVSFPEVFILLGFSERPSLEPILFIFVLGIYVVTVLGNGVIIVVSCMDVHLHTPMYFFLVNLSFLDISFTTSIVPQLLVNLWGPQKTISYGGCVIQFYISHWLGA
TECVLLAVMSYDRYAAICRPLHYTVIMHPKLCRSLAFASWLGGLTTSMVGSTLTMLLPLCGNNRIDHFFCEMPLIMQLACVDTSFNEVEMYVASFIFVVLPLGLILVSYS
RIAWAVLTIRSAEGWRKAFNTCSSHVAVVALFYGSIIFMYLQPAKRNSHEEGKLVALFYTVVTPMLNPLIYTLRNKTVKKALRHIVLENCGFGGTHIF*
737 >lcl|XP_601354.4|Plus1246166..247083 NW_001493369 olfactory receptor 1239-like LOC523060 __SEG__ Chr15 {Bos taurus} MEQRINVTEFVLLGLTQSPQGQKILFVIFLLIYLVTMVGNLLIVLTVVSSPTLHVPMYFFLGNLSFMDAVYSTTVTPNMIIDLFYVKKTISFQACMIQLFTEHLFGGAEI
LLLVVMAYDRYVAICKPLHYMTIMNQWVCTLLLLLAWTGGFLHAIIHILFVYNLPFCGPNVIDHFGCDMYPLLKLACTDIHIIGFSVLANDGAICVVLFTLLLVSYGVIL
RSLKNLSQEGRRKALSTCGSHVTVVVLFFVPCVFLYVRPPSTLPTDKSLAVFYTIVTPMLNPLIYTLRNEEMQNAMKKLWIRRRK*
738 >lcl|XP_601356.4|Plus12538246..2539187 NW_001492801 Olfactory receptor 4Q2-like LOC523062 __SEG__ Chr10 {Bos taurus} MDENQTKVVREFILAGFSQTQSIETGLFVLFLLFYVSTWVGNVLIMVTVVYDNHLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFLDNEKLIPYDQCIVQLFFLHVVGA
AEMFLLTVMAYDRYVAICRPLHYTTIMSQGLCCVLVTASWMGGFVHSTVQTILTVRLPFCGPNQVDNFFCDVPPVIKLACADTFVIELLMVSNSGLISTSSFVVLVSSYA
TILVKIRSKEGRRKALSTCGSHLMVVTLFFGPCIFIYARPFSTFSVDKMVSVLYNVITPMLNPLIYTLRNKEVKSAMRKLWDGSGLTWKKQET*
739 >lcl|XP_601377.4|Plus1complement(78224..79183) NW_001495460 olfactory receptor 159-like LOC523083 __SEG__ Chr8 {Bos taurus} MESANQTASVTEFILLGLSAHPTLEKTLFVLILLMYLVILLGNGVLILVTIFDSHLHTPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTIPFSACAVQMFLSFAMGA
MECVLLGMMAFDRYMAICNPLRYPIVMSKAVYVPMAAGSWAAGWAASMVQTSLAMRLPFCGDNVINHFTCEILAVLRLACADISINVVSMGVTNVIFLGVPVLLIFVSYI
FILTTILRIPSAEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKSKDPLGADKQDLSNKLTSLFYGVMTPMLNPIIYSLRNKDVKAAVRNLVSQKCFIW*
740 >lcl|XP_601434.4|Plus1complement(119728..120666) NW_001493320 olfactory receptor 480-like LOC523139 __SEG__ Chr15 {Bos taurus} MEAANHTRVPEFIILGLTDNVTLCAIFFVTFLGVYVVTIVGNISIITLIRSSPQLHTPMYLFLSHLAFVDIGYSTSVTPVMLMSFLKERTAIPITGCIVQLASDVAFGTT
ECFLLATMAYDRYVAICSPLLYSTQMSPVVCFFLLGASYLGGCMNASSFTGCLMNLSFCGPNKINHFFCDLFPLLKLSCGHVYIAEISPAISSASVLISTLFTIIVSYSY
ILHSILKMRSTEGRKKAFSTCTSHLTAVTLFYGAVLFVYVMPKSNYSADQVKVASVIYTVVVPMLNPLIYSLRNKEVKEAMRKLVARVHWFF*
741 >lcl|XP_601686.4|Plus1390389..391348 NW_001494175 olfactory receptor, family 11, subfamily A, member 1-like LOC523389 __SEG__ Chr23 {Bos taurus} METVSIGNQTITEFVLLGFYVKAELHLLLFIVFTVIYASIILGNMLIIVAVVSSQRLHTPMYFFLANLSFLEILYTSSVVPKMLEGFLQEAAISVAGCLLQFFIFGSLAT
AECFLLAVMAYDRYLAICYPLRYPLLMGPRWCLGLVVIAWLSGFMVDGLVVALMAQLRFCGRNHIDHFYCDFMPLMSLACSDPSVAQMTTFILSVVCLTVPFGLILTSYG
RIVVAVLRVPAGASRRKAFSTCSSHLAVVSTFYGSLMVLYIAPSAVHSQLLTKVFALLYTVVTPVFNPVIYTLRNKEVQQALWRLLYVKQTETIEGGWW*
742 >lcl|XP_601936.4|Plus13521879..3522820 NW_001494955 olfactory receptor 450-like LOC523634 __SEG__ Chr4 {Bos taurus} MGQGNKTQTWVSEFILLGLSSDWGTQVSLFVLFLAMYLVTIVGNALILLLIRLDSRLHTPMYFFLSVLSLVDLCYSSSIVPQMLVHLLSVQKSIPFYSCLIQLSTSLALA
ASEFLLLGAMAYDRYVAVCYPLHYTVIMHGVLCLGLAVGCLGAGLTNSLLETVITFRLPLCHSVMNHFACETLAVLRLACVDISFNKVMVAISGFLVIMLPFFLVLFSYG
RIVAAILHIHSAQGRSKAFGTCASHLTVVSMCFGAAIFTYLGPRSAYSVDGEKMVALFYAVVAPMLNPLIYSLRNKEVMAALSKLLDKFRDKG*
743 >lcl|XP_601982.4|Plus1134328..135263 NW_001494524 olfactory receptor 959-like LOC523680 __SEG__ Chr29 {Bos taurus} MRNASVVTEFILLGIPHTEDLETMLFVLFLSFYIFTLMGNLLILLAIVSSAPLHTPMYFFLCKLSVCDMFFPSVSSPKMLFYLSGNSRAISYAGCVSQLFFYHFLGCTEC
FLYTVMAYDRFVAICYPLRYTIIMSHRACAILATGTSFFGCIQATFLTTLTFQLPYCGPNEVDYFFCDIPVMLKLACADTSALEMVGFISVGLMPLSCFLLILTSYSRIV
CSILQIRSADGRKRAFSTCSAHLTAILLFYMPVVLIYLRPTPSPWMDATVQILNNLVTPMLNPLIYSLRNKEVKSSLRKVLYQLDILPEQR*
744 >lcl|XP_602480.4|Plus12301784..2302758 NW_001495357 hCG2044579-like LOC524160 __SEG__ Chr7 {Bos taurus} MYSENQTSQNQTLNTDFILVGLFGETKHAFLLYTATLIFFLMALAGNALLIILVHMEPRLHTPMYFFISQLSLMDLMYISVTVPKMLLGQVTGDHTISPSGCGIQMFFYL
TLAGAEFFLLSAMAYDRYAAMCRPLHYALLMNQRVCECLVSGCWFLGMVDGLLLTPIAMSFPFCHSRKILSFFCEAPALMKLSCSDISLYKMVMYLCCVLMLLIPTVVIS
SSYALILHLIHRMSSSESRRKAFATCSSHMIVVLLFFGAAIYTYMLPSFYHTAKQDMMVSAFYTIITPVLNTLIYSLRNKDVTGALRSKMQSGLSLRKVVKKKT*
745 >lcl|XP_602612.3|Plus11150401..1151372 NW_001495357 olfactory receptor, family 2, subfamily W, member 1-like LOC524290 __SEG__ Chr7 {Bos taurus} MDGTNESNQGNFILLGFSDRPHLERILFVVILIAYLLILVGNTTIILVSWLDPHLHTPMYFFLAHLSFLDLSFTTSSIPQLLYNLSGSDKTISYTGCAIQLFLFLGLGGV
ECLLLAVMAYDRFVAVCKPLHYMVIMNPRLCLGLVLIAWGCGVANSLAMSPVTLRLPCCGRHSVDHFLCEMPALIRMACVNTAAIEGTVFVLAVGIVLSPLVFILVSYGY
IVRAVLQIQSASGRQKAFNTCGSHLTVVSLFYGNIIYMYMQPGNSSSQDQGKFLTLFYNIVTPLLNPLIYTLRNKEVKGALRRLLLHDREKKRVRVKGPDRHL*
746 >lcl|XP_602626.4|Plus1complement(32791..33735) NW_001493371 olfactory receptor, family 9, subfamily I, member 1-like LOC524304 __SEG__ Chr15 {Bos taurus} MAKNNLTIVTEFILMGFPDYPELEIPLFMAFLSFYLVTLLGNLGMIILIHEDVRLHTPMYFFLSHLSLLDTCYTSVITPQVLATLAAGRTVISYGQCAAQFFFFTICAGT
ECFLLSVMALDRYVAVSSPLLYIVTMPPRICWALVLGAYICGLTGSILRTSCTFTLSFCDDNQINFFFCDLPPLLKLACSDTKDVEIVIVFFGNFVILVNALVILISYLL
IIKAVLKVSSSEGRAKAVSTCASHLTAVALFFGTLAFMYLRSASGTSLEEYKAVSVFYTVVIPMLNPLIYSLRNTDVKAAFRKVAGRFQVSQSM*
747 >lcl|XP_602886.2|Plus1complement(4096110..4097066) NW_001493118 olfactory receptor, family 10, subfamily H, member 1-like LOC524560 __SEG__ Chr13 {Bos taurus} MAAILRLNYTSVTEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATIWKEDSLHTPMYLFLCALSISEVLYTFAIIPRMLADLLSTDRSISFTACASQMFFSFTP
GFTHSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGLVVGLVVTSSIFQLTFCGSNEIHYFGCHVPPLLKLACGTEVQVVAKGVGLVCIAALLGCGLLILL
SYAFIVAAILRIPSAEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKEAMKKTFLSKLYTSSI*
748 >lcl|XP_602992.1|Plus1complement(4896190..4897122) NW_001494824 olfactory receptor 1337-like LOC524662 __SEG__ Chr3 {Bos taurus} MWMPPGQNQSWVSEFILLGFSSDPMTNRTLFSAFLLLFLSSVLGNGLIITLICLDTHLHTPMYFFLCILSLLDMGYVTTTVPQMLVHLLSQSQTISFAACWLQMYVFGAV
GLTECILFVVMAFDRYVAICYPLHYTVILSWGLCTRLSAGTWACGFFFSLIHTFFTMRLPYCGPNMVNHYFCEGPSVRNLACMDTHVIEMVDLVISVFMVVAPLLIIVAS
YIRIAQAILKLKSMQARCKAFSTCASHLTVITFFYAPATYLYMRPNSSYSPEQDKQVSLFYNVFTALLNPVVYSLRNKDMKRAFLKVMGR*
749 >lcl|XP_604324.3|Plus1546392..547321 NW_001494525 olfactory receptor 900-like LOC525964 __SEG__ Chr29 {Bos taurus} MVVGNDSSVTEFILVGFTDLTQLQLPLFLLFFVNYMLTVVGNVSLINLIYLNAHLHTPMYFFIFNLSFIDLCHSLVITPKLLMSFVSENTISFEGCMAQLFFFCFFVHSE
CYVLTAMAYDRYVAICKPLWYTVTMSPQVCSLLMFGSYAMGFAGAMVHTGDMVRLSFCDSSIINHYMCDIFPLLQLSCTRTDASELVDSIVVSTVVIISSFIIFVSYALI
LSNILHISSAQGWSKAFSTCGSHIITIALFYGSGLCTHLKTSSDGSIGQRKFLSVFYTNIVPMLNPLIYSLRNKDVRLAVNKTLRRVAN*
750 >lcl|XP_604539.3|Plus12702555..2703499 NW_001494714 olfactory receptor 433-like LOC526177 __SEG__ Chr3 {Bos taurus} MDLVNHTWTQSFLLAGFTTTGALQPLAFLGTLCIYLLTLAGNLFIIVLVQADSRLSTPMYFFISALSFLELWYVSTTVPTLLHTLLHGRSPISPTVCFVQLYVFHSLGMT
ECYLLSVMALDRYLAICRPLHYHALMSRQVQLWLAGATWAAGFSAALVPARLTATLPFCLKEVAHYFCDLAPLMRLACVDTGWHAQVHIAVIGIINACNLVLILGLYGGI
LRAVLKLPSAASRAKAFSTCSSHITVVVLFFASAFIVYVGPPESLPEGTDKLLALVYTFLTPFLNPIIYTFRNKEVREAVRRVTQSIRAMMKRP*
751 >lcl|XP_604658.3|Plus1complement(2619733..2620677) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC526294 __SEG__ Chr19 {Bos taurus} MTRRNQTIVSEFLLLGLPIKSEHQNLFYALFLAMYVTTVLGNLLILVLICLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQDLSIPYAGCLIQMYFFLFYGDL
ESFLLVVMAYDRYVAICFPLHYTTIMSPRLCLFLVLLSWVLTMFHAMLHTLLMARLHFCEDNVIPHFFCDMSALLKLSCSDTRVNDLVIFITGGLILVIPFLLIITSYAR
IVSSILKVPSARGIRKAFSTCGSHLTVVSLFYGTIIGLYLCPSAHNSTVKETVMSTMYTVVAPMLNPFIYSLRNRDMKGALGRVFWRKKTPFSL*
752 >lcl|XP_604679.3|Plus1320696..321658 NW_003101172 olfactory receptor Olr115 (predicted)-like LOC526311 __SEG__ Chr15 {Bos taurus} MADNATHHYISSFFLVGIPGLQDFHCWIGIPVCLLFSLTLLGNSIIIITIKLEPSLHQPMYFFLGMLAMNDMALASSTAPKMLGIFWLDAHWIDFDICLAQLYFIHTFCI
IESALLVAMAFDRYVAICIPLQYTTLLTTTMVMKMGLASVVRAIFLVLPGPFLIRRLPYYTKYVINHAYCEHMAVVKLASANTHVNRTYGISVAFSVMVLDLGLIATSYL
KILQAVFRLSSQHARSKALGTCAAHVCTILVSYTPALFSFLTHRIGKKVPPSVHIIFASLYLLVPPTVNPLVYGVKTKQIRDRVTGLFFPNKKVSENENL*
753 >lcl|XP_604681.3|Plus164719..65711 NW_001508680 testis expressed sequence 13A LOC526313 __SEG__ ChrX {Bos taurus} MALDGEDPRSGFRHRDVVTFINQEVLGNGGGPDFYMTYRSRPWNEIEDELQSVLADIHVPLNLKRACAWSALALSVRVATRQREQQARRVQRLQEQVEERETATWALASQ
LQRLREERKQVVMQLRRTRQDLQQALSEREALRGQLLQAQRAVSSRSPQLRADTWPVTAEERNKLLVATSQRRRLEAQREEAQYALAGGVQYVQGAQGPWAQVAQPPAPM
PCPRHTPYPMPFPYPPPPPPRVLSEAEGAAATAAACAAPQMPAPVMCAPAMWPVVVSQEEVALPWYQRVEGRGEGPHFGNPEGHFQVDPMYQHSQDRMPRTPDGKKAFEP
*
754 >lcl|XP_604782.4|Plus1622206..623150 NW_003101172 olfactory receptor, family 51, subfamily E, member 2-like LOC526411 __SEG__ Chr15 {Bos taurus} MPPLNTSHPSPVTFSLMGIPGLEHLHVWIGIPFCSMYVVAVVGNVTILAVVRAERSLHEPMFLFLCMLSVTDLVLSTSTLPRMLCLFWLGAHDIAFDACLTQMFFIHSFT
TMESGFFLTMAIDRYVAICHPLRHTTILTHTRITIMGIIVVIRGVAFFSPHPILLKQLPYCRTRIIAHTYCEFMAVLKLACVDTGATSRYSLSVASIIGSCDAILTAVSY
VFILQSVFRLPSREAGFKALGTCGSHVCVILVFYSTTGFSIFTHRFGKNIPAHIHIFIANMYLLAPPFLNPIVYGVRTKKIREHVIKALSVKVA*
755 >lcl|XP_604783.4|Plus1631670..632623 NW_003101172 olfactory receptor, family 51, subfamily E, member 2-like LOC526412 __SEG__ Chr15 {Bos taurus} MGPANKSQTSADTFLLMGIPGLEHLHVWIGIPFCSMYVVAVVGNMTILAVVRTERSLHEPMFLFLCMLSVTDLVLSTSTLPRMLCLFWLGAQDIAFDACLTQMFFIHSFT
AMESGFFLSMAIDRYVAICHPLRHTTILTHTRIAKMGASVVLRGVAFFSPHPVLLRQLPYCRTRIIAHTYCEFMAVVKLACVDTGPTKRYSLSVASFIGSCDGLFIAVSY
VLILRAVFHLPSREASLKALGTCGSHVCVILVFYSTAVFTFLTHRFGHSVAPHIHIFIANIYLLVPPFLNPIVYGIRTKKIQDRVLSSLRVKVARLY*
756 >lcl|XP_604994.2|Plus1117196..118158 NW_001493327 olfactory receptor Olr60 (predicted)-like LOC526621 __SEG__ Chr15 {Bos taurus} MIPSQSFNNISFFQPPAFLMIGIPGLEAIHGWISIPFSSMYTVALAGNCLILLAVRRTSSLHQPMYYFLSMLALTDMGLTLATMPTTLAVLWFDHRLISFNACLVQMFFL
HYFSVVESSVLLAMSFDRFVAISNPLRYASVLTNNVIIRIGVGIVARATLSLFPVPFLLKRLNFCPNKTILSHSFCFHPDVMRRACADITINILYGLYVVVSTAGIDSLL
IVLSYTFILCTVLGLASPRERIRALNTCVSHILAVLVFFIPVIGVSMIHRFGRHLPPIVHALVAYVYLGVPPVLNPVIYSVKSKPIREAMLWVLRRKCQS*
757 >lcl|XP_604996.1|Plus1complement(132804..133757) NW_001493327 Olfactory receptor 51E1-like LOC526623 __SEG__ Chr15 {Bos taurus} MVGPNGNESSATYFILIGLPGLEEAQFWLAFPLCSLYLIAVLGNLTIIYIVRTEHSLHEPMYIFLCMLSGLDVLISTSSMPKMMAIFWFNSTTIQFDACLLQMFAIHSLS
GMESTVLLAMAFDRYVAICHPLRHATVLTLPRVTKIGMAAVVRGVALMAPLPVFIKRLPFCRSNILSHSYCLHQDVMKLACADIHVNIIYGLIVIISAIGLDSLLISLSY
LLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFGKQHDSLLPVILANTYLLVPPVLNPIVYGVKTKEIRQRILRLFHVTTHTLDP*
758 >lcl|XP_605040.3|Plus1complement(2028248..2029210) NW_001492801 Olfr736 protein-like LOC526667 __SEG__ Chr10 {Bos taurus} MHISEASNSSGSVSEFILLGFPSRREIQILLCVMFSLIYLLTLLGNAAIICAVWSSRKLHTPMYILLANFSFLEICYVSSDVPKMLANIISQTKSISYAGCLLQFYFFFS
MCAAEGYFLSAMSFDRFLAICRPLHYPTIMTYQLCARLVVFCWAGGFLSILMPAVLMSRVPFCGPNVIDHFFCDLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILG
SYTLVLRAVLRVPAGSGRNKAFSTCASHFLVVSLFYGSVMVMYVSPGSRSHPGTQKFVTLFYCMATPFFNPLIYSLRNKDMKDALKKVLCASEISKNTEK*
759 >lcl|XP_605072.4|Plus1complement(128974..129948) NW_001492803 olfactory receptor 49-like LOC526699 __SEG__ Chr10 {Bos taurus} MLHTADWAFPAEARGATGNHTTVTEFILLGLSEACELQMLLFLGLLLTYLLTLLGNLLIVVLTLMDRRLHSPMYYFLRNFAVLEIWFTSVIFPKMLTNILTGNRTISLEG
CFLQSFLCFFLGTTEFFLLAVMSFDRYVAICNPLRYVTIMSKRVCVQLVLSSWVTGFFIIIIPTFLTFQQPFCGPNIIDHFFCDSFPLLELVCADTSLIELLGFILANVS
LLGTLSVTATCYGHILHTILRLPAAKERWKAFSTCSSHITVVSLVYGSCIFMYVRSGKGGQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQLNKLF*
760 >lcl|XP_605086.4|Plus1complement(68925..69860) NW_001501883 olfactory receptor 49-like LOC526713 __SEG__ Chr5 {Bos taurus} MKNHSAITTFILLGLTDDPRLQVFLSVFLFLTYTSTVAGNLVIILVTLVSSRLKTPMYFFLRNFSILEIIFTTVCVPRFLYSMTTGDKRVTYNACAIQLFFVILIGATEF
FLLTAMSYDRYVAICKPLHYSTIMSEKVCTILVLCSWLIGLIVILPPLSLGVQLDFCNSNLIDHFGCDASPLLKIVCSDTQFIEQLVLIMAVLTLILTLVCVIVSYTYII
KTILRLPLAQQRKKAFSTCSSHMIVVSITYGSCIFIYIKPAKEGVAINKVVSLLNTSIIPLMNPFIYTLRNKQVKQAFRDSIKKMAFLSKN*
761 >lcl|XP_605139.4|Plus11176951..1177913 NW_001495357 olfactory receptor, family 2, subfamily W, member 1-like LOC526765 __SEG__ Chr7 {Bos taurus} MDVTNESTQGNFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDRYLHTPMYFFLTHLSLLDLSFTTSSIPQLLYNLNGHDKTISYTGCAIQLFLFLGLGGV
ECLLLAVMAYDRFVAVCKPLHYMVIMNPQLCLGLVSLAWGCGVANSLIMSPMTLWLPRCGYQKVDHFLCEMPALIRMACVNTAAVEGIAFILAIGIVLSPLVFILISYGY
IVRAVLSIQSSSGRHKAFNTCGSHLTVVSLFYGNIIYMYMQPGASSSKDQGKFLTLFYNIVTPLLNPLIYTLRNKEVKGALRRLTLVNLSLGRNYNKRQC*
762 >lcl|XP_605234.4|Plus1complement(63782..64735) NW_001501889 hypothetical protein LOC526857 __SEG__ Chr15 {Bos taurus} MPFMENSTEVNEFRLLGLTDAPELQVPLFIIFTFIYLITLTGNLGMITLILLDSRLHTPMYFLLSNLSLVDCVYSSAVTPKVMAGLLTGDKVISYGGCVAQMFFFVAFAS
VDCLLLAVMAYDRHAAVCKPLHYASTVTPCVCAQTVTACYVWGFAESAIHTGFTFCLSFCHSNVVHHFFCDIPPILALSCSDIYVNEMVLFILAAFNVFFALMVIVSSYL
FIFFAILRMRSAEGRKKAFSTCSSHLTAVTIFYGTVIFMYLQPSSNHSMDTDQMASVFYTIIVPMLNPLVYSLRNKEVSNAFRRAIEKMKLLFSTQI*
763 >lcl|XP_605374.3|Plus1901052..901999 NW_001494173 olfactory receptor Olr1654-like LOC526989 __SEG__ Chr23 {Bos taurus} MEQKNESSFVGFILLGFSDRLQLEPVLFVVLLIFYVFTLLGNTTIIALSYLDPRLHTPMYFFLSNLSFLDMCYTTSIVPQFLFNLSGEDKSISFGGCIVQMYISLALGGT
ECILLGVMAFDRYAAVCRPLHYTVIMHPRLCALMASASWVTGFANSFLQTVLVFLLPRCGRNKLAHFFCEIPPFLKLVCVDTTMNVYATFFASVIMLLTPVSLIMFSYGR
IVKEVLRIKSTGGQRKAFGTCGSHLTVVSLFFGTAIYVYTQPSSSDSQDQDKFMSLFYTVIIPMTNPLIYTLRNRDVNGAIKKVLWKRLLTPDDG*
764 >lcl|XP_605449.3|Plus167080..68069 NW_001495313 olfactory receptor, family 10, subfamily H, member 2-like LOC527062 __SEG__ Chr7 {Bos taurus} MLGLNYTSVSEFILIGFSTFPQHLLPVFFLLFLLMYLFTLLGNLLIMATIWSERSLHTPMYLLLCALSISEVLYTFAIIPRMLADLLSTDRSISFTACASQMFFSFTFGF
THSFLLTVMGYDRYVAICHPLHYNVLMSPRGCACLVAWSWAGGSVMGLLVTSAVFHLPFCGLSEVHHFFCHVPPLMKLACGNNVLGVALGVGLVCSMVLLGCFLLILLSY
AFIVAAILRIPSAEGRHKAFSTCASHLTVVVVHYSFASVIYVKLTGLHSQQGNILIAITYTVLTPFLSPIIFSLRNKELKNAMKKTFLSKLSFQRLSGPCGGGQNMVER*
765 >lcl|XP_605465.3|Plus1340574..341515 NW_001493372 olfactory receptor 1417-like LOC527077 __SEG__ Chr15 {Bos taurus} MEDANGTGTMIHFHFRPFSKLPEVQTLIFVAFLIMYLVSVSGNISILLIVWTHRSLHTPMYFFLANLAALETCYSSAIAPLTLASTLSAGRTLVSLAGCGAQMFFFIFLG
SADCILLAVMAYDRFVAICHPLRYSLMMSWRLCARLALGSLVLGFILAMQLTVLIFRLPFCSSKEIGMFYCDVLPVMRLACADTRVHEATLFVVSVTVLTLPFLLITLSY
VFISAAILKIRSAEGRHKAFSTCSSHMTVVLLQYGGTSLIYLCPSSSYSPERAQVVSVVYTFITPMLNPLIYSMRNRELKHALKRAAMRFLSS*
766 >lcl|XP_605550.1|Plus1616994..618370 NW_001492789 kelch-like 12-like LOC527160 __SEG__ Chr10 {Bos taurus} MPQGPETLVQVWVGSQLFQADRALLVEHCGFFRGLFRSGMREARAAEVHLGALSPDGFHTTLRVLRGERPALAAADELLQAVECAAFLQAPALARFLEHSLTSENCALLC
DAAAAFGLHDVFHSAALFIRDGARELAAELALPEARTYVAELRPSSYVAVSTHAPAPGFLEDPSRTMCYLDEEEDTWRTLAALPLEASTLLAGVATLGNKLYIVGGVRGP
NKEVVDLGFCYDPDGGTWREFPSPHQPRYDTALAGFEGHLYAIGGEFQRTAMSSVERYDPASGCWSFMADLPQPAAGVPCAHARGRLFVCLWQPAETTAVVEYAVRADEW
LPVAELRRPQSYGHCMVAHRDSLYVVRNGPKDDFLHCAIDCLNLATGQWTALPGQFVNSKGALFTAVVRGDTVYTVNRVFTLLYAIEGGSWRLLREKAGFPRPGSLQTFL
LRLPPGAQGPVASTTPEL*
767 >lcl|XP_605585.3|Plus1451740..452675 NW_001494173 olfactory receptor Olr1654-like LOC527195 __SEG__ Chr23 {Bos taurus} MNESFPEDFILMGFTKYPWLDVPFFFALLTSYMFTLLGNIAIILVSQLDSQLQSPMYFFLTSLSFLDLCFTTTTVPQMLFNLGGPNKNITYIGCMTQAYVFHWLGCTECV
LLGTMALDRYVAVCKPLRYPVIMNHKLCRQLSSTAWLIGLANSLLQSTLTVQLPLCGKQELDHFFCELPGLIKMACVDTTVNELTLAVVATFLIMGPLSMILVSYSYIAQ
AVFRIPSAGGRLKAFNTCSSHLLVVSLFYGPGIYIYMQPSGDSPQDLIKVLTLFYCVITPMANPFIYTLRNKDVKGALRRLLRRAILSKKI*
768 >lcl|XP_605638.3|Plus135550..36494 NW_001503807 olfactory receptor 414-like LOC527248 __SEG__ Chr11 {Bos taurus} MKPGNHTFSVSEFLLLGLSEHQTQQPLLFGIFLSVYLITVVGNIAISLAIVSDPHLHTPMYFFLAHFSLTDLGLSSTTVPRMLVNIQAHRHTITYAGCLSQIYFFLWFIG
LDVFLLAVMAYDRLVAICHPLHYTLVMSPRCCILLVVMPLILAQAYSLTHTLLLAQISFCTDNIIPHFFCELLPLLKLSCSDTYANRCVLTYWGGALTILIPLLIVISYA
RIVAAIVHIPSASGKWKAFSTCSSHLSAICLFYVSAIGVYFIPSSADSASKDRIAAVMYAVVTPMLNPFIYSLRNRDMKSALKRFLSRRALQSP*
769 >lcl|XP_606178.3|Plus13501567..3502502 NW_001494955 olfactory receptor Olr1654-like LOC527779 __SEG__ Chr4 {Bos taurus} MGRENQTGMSEFILLGLSSLWETQVSLFVLFLAMYLVTVLGNFLIILLIRLDSRLNTPMYFFLSVLSFVDVCYTNSTVPQMLVHFLSARKSIPFYSCVLQLLISLAMGST
EFFLLGAMAYDRYVAVCHPLHYTVIMHGELCLGLAAGCLAAGFMNSLMQTVITFQLPLCHKVVNHFACEMLAMLKLACVDTSFNKVMVAVSGFLVIMLPCFLVLFSYGHI
VATILRIRSAQGRRKAFGTCASHLTVVFMCFGTAIFTYLRPTAGSSAEQEKKVALFYAVVTPMLNPLIYSLRNKEVMSAFRRVLGKFSEKR*
770 >lcl|XP_606460.4|Plus1complement(41446..42399) NW_001501889 olfactory receptor 480-like LOC528051 __SEG__ Chr15 {Bos taurus} MENNAEVTGFILLGPSSAPELRSLLCIMLTLIYLVTLVGNLGMITLILLGSHLHTPMYFFLSNLSLVDFGYSSAVTPKAVAGLLIGDKFISYNACAAQMFFFVAFATVEN
YLLASMAYDRYAAVCRPLHYTTTMTTSVCAHLAIGSYICGFLNACFHVGDIFSLTFCKSNTVHHFFCDVPAVLALSCSEKHVSEVVLVFMSSFNVSFALLVILISYLFIF
VNILKMHSAQSHQKALSTCASHFTAVSIFYGTLIFMYLQPSSRHSMDTDKVASVFYAMVIPMLNPVVYSLRNKEVKSAFKKVVEKTDISIGLGLLTL*
771 >lcl|XP_606517.4|Plus142646..43644 NW_001508689 olfactory receptor 1324-like LOC528106 __SEG__ ChrX {Bos taurus} MLPFYNKVTFFSLFRHRRIMLQGNQTISAFFLLGLTAVSEQQQHIFVLFLCMYLVTMVGNLLIILAIVNDAHLHSPMYFFLASLSFTDICFTSTTVPKMLADIQSQSPVI
SFAGCLTQMYFFMLLVDLDNFLLAAMAYDRYVAICYPLHYAALLSLKRCALLVVTPWVVCNLLSVLHIGLLGLLNFCDQREIPHFFCDLEPILRLACSDTQINDLTILVI
GGAVIFIPFTFICVSYFLIGCTVLRIPSAKGKWKTFSTCGSHFLAVSLFYGSISGVYFLPSSAYSAERDKVAAVMYTVVTPMMNPFIYSLRNKDLKGAVRRLLIRKTYFC
RW*
772 >lcl|XP_606763.3|Plus1163706..164644 NW_001494174 olfactory receptor 134-like LOC528343 __SEG__ Chr23 {Bos taurus} MELINKSHPEEFILLGFADRPWLELPLFIILLITYPMAMMGNIAIILVSKLDTRLHSPMYFFLTNLSFLDMCYTTSIVPQMLFNLGTSKKTISYVGCAVQLYFFHIMGGT
ECLLLAVMSFDRYVAICKPLHYTLIMNQRVCILLVATVWLSGMTYAVSEATVTLQLPLCGHNTLDHLVCEIPVLIKTACGEKGANELTLSVVCIFFLAVPLCLILIFYAC
IGHAVFKIRSLEGRKKAFGTCSSHLIVVFLFYGPAISMYLQPPSSISRGQPKFMALFYGVVTPTLNPFIYTLRNKDVKGALGNLMRSVFTCK*
773 >lcl|XP_606795.4|Plus1990842..991783 NW_001494173 olfactory receptor 1361-like LOC528373 __SEG__ Chr23 {Bos taurus} MENDSTSAFEGFILVGFSARPHLELILFVVVLTFYLLTLLGNMTIILLSVVDSRLHTPMYFFLANLSFLDMCFTTGSIPQMLYNLRGADKTISYLGCAIQLYFVLALGGV
ECVLLAVMAYDRYAAVCKPLHYTVIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRVDHFLCEMPALIGMACVDTMTLEALAFALAIFIILAPLILILVSYGY
IAQAVLRIKSAAGRKKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYTIVTPSVNPLIYTLRNKDVKEAMKKVLGKGEAKVE*
774 >lcl|XP_606796.4|Plus11003852..1004793 NW_001494173 olfactory receptor, family 2, subfamily B, member 2-like LOC528374 __SEG__ Chr23 {Bos taurus} MIAVNESIPLEFILLGFSDRPWLEFPLFVVFFISYMVTIFGNLTIILVSRLDSRLQTPMYFFLTNLSLLDLCYTTSTVPQLLVNLHSTRKVISYGGCVAQLFIFLALGAT
ECVLMPVMCFDRFVAICRPLHYSVIMHQRLCLQLAAASWITGFSNALWFSILALQLPLCGPFVLDHFLCEVPALFKLSCVDTIANEAELFFLSMLFHLVPFTLIVISYAF
IARAVLRIQSAEGRQKAFGTCGSHLLVVSLFYGTAISMYMQPPSPTSKDRGKTVSLFYGIVAPMLNPLIYALRNKEVKEAFKRLVARVFSIRK*
775 >lcl|XP_606845.4|Plus11155922..1156911 NW_001494342 olfactory receptor Olr315-like LOC528422 __SEG__ Chr26 {Bos taurus} MEQGLGAAPGWATRSNETLMIEFVLQGFSELPRLRLPLFCCFFSLYTVALMGNAVIIAVGSHSASLQSPMYFFLCNLAAMDIVCTSSVLPKALVGLAFEENTISFPGCMA
QLFFLTWSASSELLLLTAMAYDRYVAICRPLHYSSRMSPRLCRSLAVGVWALCALNGSLHAGLMTRLSFCGPNVIAHFFCEIPPLLLLSCSPTLVNSIMTVLADAFYGVL
NFLLTLVSYGCIVASILRMRSAAGRRRAFSTCSSHLLVVSVYYSAVFCAYISPASSYSPERSKVSAVLYTMLSPTLNPIVYSLRNTEIKHALGRLVQALLCPEVRGLPP*
776 >lcl|XP_606925.4|Plus13052005..3052958 NW_001494714 olfactory receptor 414-like LOC528499 __SEG__ Chr3 {Bos taurus} MRNLSGDHTVEFVLVDFPTSPPLQLLLFALFLVIFLLTLLENALIVSTIWLTPSLHRPMFFFLGHLSFLELWYINVTVPRLLGAFLTQEHRVSYVGCMTQLYFFIALACT
ECVLLAVMAYDRYLAICEPLRYPSLMPFSMATRLAASSWGSGFFSSMMKLLFISRLSYCGSNIINHFFCDISPLLNLTCSNKEQAELVDFLLALVMILLPLMAVVSSYAA
IIATILRIPTAQGRHKAFSTCASHMAVVVIYYSSTLFTYARPRAIYTFNHNKVISVLYTVIVPFLNPAIYCLRNKEVKDALRKTVLGRCPCSRDIPD*
777 >lcl|XP_606928.3|Plus141279..42220 NW_001502164 olfactory receptor 73-like LOC528502 __SEG__ Chr15 {Bos taurus} MDKQNQTVPGEFILMRITDRPELQAAFFVLFLTIYAVSAVGNLGMVVLTKVDSKLQTPMYFFLRNLAFIDLGYSTSVGPKMLVAFVTDQNTISYHWCATQLTFFILFIIS
ELFILSAMAYDRFVAICNPLLYTVVMSPKVCWVLVTVPYVYSASVSLITTIQIFISSFCGYNIISHFYCDSLPLLTLLCSSTWEIELFILICSVFNLVSSFLIVLVSYIL
ILKAILKMNTAQGRQKAFSTCGSHLTVVAVLYATLAFMNMQPRSSHSFDTDKMASVFFTLVIPMLNPMIYSLRNKEVKGALHRMWENLCKIPI*
778 >lcl|XP_606941.3|Plus1complement(742921..743859) NW_003101172 olfactory receptor 52E1-like LOC528515 __SEG__ Chr15 {Bos taurus} MVPPNDTQFHPYFFLLLGIPGLEDVHMWIGFPFCIVYMTALLGNITTLYVIQTEHSLHQPMFYFLAILSSIDLGLSTSTIPKMLGIFWFNLREISFEGCLAQMFFIHLCT
GMESAVLVAMAYDRYVAICNPLHYTLVLTNKAVLVIALLILLRPLAIAIPFVLLILRLPFCGHQIIHHTYCEHMGIARLSCASIKVNIIYGLCAISILVFDIIAIVISYV
HILRAVFCLPSRSARLKALSTCGSHVCVILAFYTPAFFSFMTHRFGRNVPQYIHILLANFYVVIPPALNPVIYGVRTKQIRETVIRTFRNRL*
779 >lcl|XP_606988.2|Plus1complement(109444..111918) NW_001495065 platelet glycoprotein V-like ELFN2 __SEG__ Chr5 {Bos taurus} MLRLGLCAAALLCVCRPGTVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDLRLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQL
GYNKLSNLTEGMLRGMGRLQFLFVQHNLIEVVTPAAFSECPSLISIDLSSNRLSRLDGATFASLASLMVCELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPRE
FAGYPLLVPRPYHSLNAITVLQAKCRNGSLPARPASHPTPYSTDTQREPDENSGFSPDEILSVEPPASSTTDASAGPAIKLHQVTFTSATLVVIIPHPYSKMYVLVQYNN
SYFSDVMTLKNKKEIVTLDKLRAHTEYTFCVTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLRKRRMQEEKQKSVKVKKTILE
MRYGADVDAGSVVHATQKLGEPPVLPVSRMSSIPSMIGEKLPTTSKGLEAGLDTPKVATKGNYIEVRTGTGSEGLARPEDDLPELENGQGSAAEISTIAKEVDKVNQIIN
NCIDALKLDSASFLGSGSGGGDPEMAFECQSLPAASTTSSTATPVPGVLERPSFLSPPYKEGSHHPLQRQLSADAAVARKTCSVSSSGSIKSAKVFSLDVPDHPATPGLA
KGDSKYIEKGSPLNSPLDRLPLVPASSSGSSGGGGGAVHHLEVKPAYHCSEHRHSFPALYYEEGTDSLSQRVSFLKPLTRTKRDSTYSQLSPRHYYSGYSSSPEYSSEST
HKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL*
780 >lcl|XP_607003.4|Plus178984..79925 NW_001502164 olfactory receptor 1090-like LOC528577 __SEG__ Chr15 {Bos taurus} MKTQNLTVPNEFILMGITDRPELQAPLFGLFLIIYVTSAVGNLGMVILTKVDSRLQTPMYFLLRHLALTDLGYSTAVGPKMLANFILSQNSISYYMCATQLALFIMFIIS
EFFILAVMSYDRYVAICQPLLYTVIMSQRVCWILVAIPYIYSTFVSLIITVKIFNLSFCGYNVIKHFYCDCLPLISLVCSNTQEIELIILIFAGVNVILSLPIILMSYLL
ILVAILRMNSAEGRHKAFSTCGSHLTVVTVFFGALIFMYAQPESRHSFDTDKTASIFYTLVIPMLNPLIYSLRNKDVKYALQNVWNKLCNISS*
781 >lcl|XP_607153.3|Plus1335569..336519 NW_001493369 olfactory receptor 73-like LOC528722 __SEG__ Chr15 {Bos taurus} MVRNEGNQSSVSMFILLGFSEYPRLQAPLFLVFLTIYTITLMGNLGIIVVIRTSPKLHTPMYFFLSHLSILDISSSSVFTPKLLGILVVEDRVISFKGCMAQFFFGCAFV
ITEMSMLAVMAYDRFVAVCNPLLYTVAVSPKLCSLLVAGTYMWGGMCSLTITWSLLELSFCDSNVIHHFGCEYSAIISTSCSDTHFSQLTCFIISTLNEVGSLLIILTSY
AFIVVTIIKMPSAGGLRKAFSTCASHLTAITIFHGTVLLLYCVPNSKSSWLLIKVATVFFTVMIPMLNPLIYSLRNKDVKETVRRLITMKLLCPSI*
782 >lcl|XP_607350.3|Plus1complement(753892..754833) NW_001494173 Olfactory receptor 1F12-like LOC528914 __SEG__ Chr23 {Bos taurus} MERENQTSISEFLLLGFSSWPEQQELLFALFLCLYLAGLFGNIFILLAISSDHRLHTPMYFFLATLSVVDLCLPSSTVPKMLLDIQTQTQSISYPGCLVQMYFCMMFANM
DNFLLTVMAYDRYVAICHPLRYSTIMTQHLCISLVGGPWVIAFLNPLLHTLMMTRLHFCSNNVIHHFFCDINALLPLSCSDTSLNQFLVLAVVGLIFVVPSVCILASYSL
IISAVMKIPSVKGKFKVFSTCGSHLALVILFYGAITGVYMSSSSNSSTEKDTAASIIFMVIVPVVNPFIYSLRNNELKGALKKILGQSKIFSQ*
783 >lcl|XP_607415.3|Plus1231590..236395 NW_001493552 hypothetical protein LOC528977 __SEG__ Chr17 {Bos taurus} MSKDSPSPADGGRAASQKPATPGPAAAALEEQRRELEKLRAELEAERARGRAERRRFSAGARQLREEAERERQQLADHLRSQWEAQRSRELRQLREDVLREREAEIRQLL
RWKDAEMRQLQQVLRRERDGVARQARELQRQLAEELLSRGYGGGRAGPPEDAGARCRCRLQEVLSQLRWETHGEQASRIRHLEAALDVERRLFLKYILEHFHWHPALPSA
PDAPLPLGEPTREAAAKARDGRSAGVRARSRSLDRVPAARARSPDSPLPTRASSLDSLAPAGPRPSLDGSPSHPRAPESSSPDASLSGSLRPLPPPPSPPPSERQIPSHL
REGEEAGSRPCEALSPPPPGPDHCELLRRNSELSEALQELARRRCGLREENVRLRRLGLPDEADEKAKRLKGKRAELTGLARRLEDRARKLQEANLRAVSAPVPGESRPG
LELCQALAHQRARDLSEQASALLAKDKQIEELRQERHLLRARVASGLGPLPGEGAASAQWLSIGDLDRLQRESQREVLRLQWQLTLQQAAGGARAEAGGQSAPCEAARRQ
VRALERELSARRQECEELGAQAAAAQRRGREAEAQLQVALREGAWLAKENARLQAQADWTRKVAAENEDVRGQLGRACQQRDSASLLAEQLLQQAAQRQDWQQQLQHDLQ
KVLCDLQAARDEMWALQCQPAHPPQDNRGTEPQLGPANPASPVPSRDKQGRKEDLLLESPAALGQPAWAPQAPDSSGQPLDSRPQPQRTGSQSNSSSEVESAWATVPSCP
ILDADTGSEAEDLEPDSLPSTLEAGDLEVSVATPKLKIFLARYSYNPFEEPSEHPESELPLTPGDHVYIFSDMDEDGFYEGALADGRQGLVPSNLVEQIPDGDIRGCLPT
ESPDRGPTWLPAARQGQAWKDDPSPGFLPGQAQAAVDRGPCPVARVGSRMEVATEVSDTKTEAGRLGSQESRDRQGSANAPPGNNRSPRMAPTHLHLRSVAATSAEVAWV
GGSHAHAVYLDGREHALTSMGVSSYTFRHLQPGTRYQVRVEVRPPGDSLQACREKTSSAVTFETPLAGPPHPPLDVLVERHPSPGLLVVSWLPVTIDAAGSSNGVPVTGY
AVYADGLKVADVAEATAGSTLLELSQLPWPETCQKISVRTTSLCGESLDSVPAQIPHDCFTCLHWPEMSPFGYTCRDPSAISGSFPVCPRRLGPTPLSAKACPHAPRSCE
EPRARCLEAFPEEPPRRWSPEPKLISEGGGPSSGSGSQAQGPAEARKPPRKDQLFEKRPWNHRPPLPRGQPGREGTQDRRMLTVPTPAAGVSHLSPEPAPGEELRQEKPA
SGKVLRQKADALVSTPPELGSSQQSASVFSGARQEDGRGAEGRERRRALRGRSTQGQALGARAGGRLRGPSSAPCPARRSKALGTPRGAAPPPGTRVGPRAGIFVTLPNY
EPLAVSATSEAAGGELALQKGQPQSAGGSQDPHGFCRGECSGPVGSITSHLVAEVDAGTECTDGHGRWHLPGHLDDSEGLTGPQGSSPLPQGSPGRPSSSLWAPKTMMAA
LDYDPQDWLARGPVKGQLSLRAGDVVTVHGPVDDKGFYSGEVGGHRGLVPAHLLGHMSLQE*
784 >lcl|XP_607748.3|Plus1complement(139725..140660) NW_001501883 olfactory receptor Olr879-like LOC529303 __SEG__ Chr5 {Bos taurus} MKNYTAITTFILVGLTDDPNLKILLFIFLLLTYLLSVAGNLIIITLTLVDPHLKTPMYFFLRNFSILEVSFTTVCIPRFLYTMASGDNTVTYNACATQLFFVVILAVTEF
FILTAMSYDRYMAICKPLHYTTIMNNTVCIKFLIGCYMIALIIVLPPFGMGFELEFCDSNVIDHFGCDAAPILKITCSDTEFLERFVFVLAVLTLLFTLVCVIMSYTYII
RTILRFPSVQQRKRAFSTCSSHLIVVSITYGTCIFIYIKPHAKEGVAINKVVSVLTTSVAPVMNPFIYTLRNKQVVQAFKDMIKRVASYFK*
785 >lcl|XP_607753.2|Plus1426956..427885 NW_001501922 olfactory receptor 478-like LOC529308 __SEG__ Chr15 {Bos taurus} MDSLGHGNSTAMTGFMLLGLTNDPVLRIILFMIILCIYLVTICGNLSTIILIRISSQLHHPMYFFLSHLAFADIGYSSSVTPNMLVNFLVETNTISYPGCAVQLGSVVFF
GSSECFLLAAMAYDRFVAICSPLLYSTKMSTQVYVQLLTVAYVAGFLNACSVTICFYFLLFCGPNQINHFFCDFAPLVELSCSDISIPAAVPSFTAGSIVVITVTVIAVS
YTYILITVLRMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYMVVIPMLNPLIYSLRNNEIKGALKRQLC*
786 >lcl|XP_607863.4|Plus1complement(2078556..2080505) NW_001493100 fibronectin leucine rich transmembrane protein 3 isoform 2 FLRT3 __SEG__ Chr13 {Bos taurus} MISPAWSIFLIGTKIGLFLQVAPLSVMAKPCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELH
LQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKV
FFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVR
GLMCQAPEKVRGMAIKDLNAELFDCKDNPVVSTIQITTGTPNTVHPAQGQWPAPVTKQPDTKNPKLTKDQRTTGIPSRKTITITVKSVTSDTIHISWKLVLPMTALRLSW
LKLDHSPAFGSITETIVTGERSEYLVTALEPDSPYRVCMVPMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALVTIALLALVCW
YVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPISNEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS*
787 >lcl|XP_607967.1|Plus1801191..802129 NW_001494173 olfactory receptor Olr1654-like LOC529518 __SEG__ Chr23 {Bos taurus} MEQKNGSSFTGFILLGFSDRPQLELVLFVVLLIFYVFTLLGNTTIIALSYLDPRLHTPMYFFLSNLSFLDMCYTTSIVPQFLFNLSGEDKSISFGGCVVQMYISLALGCT
ECILLGVMAFDRYAAVCRPLHYTVIMHPRLCALMASASWVTGFAISLLQTVLIFLLPLCGRNKLAHFFCEIPPFLKLACVDTTMNVYATFFASIIILLTPVSLIMFSYGR
IVRAVLRIKSTTGRRKAFGTCGSHFTVVSLFFGTAIYVYFQPSSSDNQDQEKFMSLFYTVIIPMTNPLIYTLRNRDVKGAMKKVLWKDPDSR*
788 >lcl|XP_608618.3|Plus1complement(308613..309557) NW_001494734 olfactory receptor 157-like LOC530153 __SEG__ Chr3 {Bos taurus} MNNQTDVTEFIFLGFSNHPNLQSLFFLVFLVIYLTTLFGNTLIIMATRVSPALHIPMYYFLSNLSFLDICYSSTTIPGMLVNFFQEKKTISYEGCLSQIFFLVTCAGTEG
VLLAAMAYDRYVAICHPLQYPVFMSVKVCVCLVSGSWLCGLVNSMTHTVLATTLTLCGPNQISHFLCDIPFLLKLSCSDTSLNEFMLHVASATIGLSPCLFTAVSYILII
SAILRIPSVQGRSKAFSTCASHLTVVVIFFGTANFNYDRPSVGYNLDMDILVSVLFCVGTPMFNPIIYSLRSKEIKGVLRKLANECWFSSEIRG*
789 >lcl|XP_608636.3|Plus1complement(2066076..2068466) NW_001494707 Kelch domain-containing protein 7A-like KLHDC7A __SEG__ Chr2 {Bos taurus} MLPRGGGAEAQDWHLDMQLTGQLVLSAAALLLLTAAYKLYKSRPAQALPRGADAKAEAEAEGGGSGQPAAQEAVPGAPWWDLRRRRGSKGTTGPPGCSWERTEASRVPAT
GASSATSEAGEAGKAGRKHAGEEHAGQCPDSDLPAPRCGDQEAGTAVDGKPELPHRPHQCSEPPSPPAGLPAMESGRVGGELTPRQDSGPPKHPGSGEQESPHEGEVAHR
EGQCDMNNTWVFTHASGVHREEAAALQAASDLGLALRQREGASDASYTFSSMARVRVEENFIPEKVEGIRPRLKGKVYDYHVEYTSQATSRSRLAPGTAASAGAPAPESV
SGPLGTRIASGRPAGDGEGRQETAASPGSDPSGSTRGFSRKESLLQILENPEFQLQLDSFGDAAPSCPDQRAAPTRPTSQDSPESSSAGSRGKPHVHSVAGTSFFHPPLS
PGSALEVHLDLGNCYQALAFAKRKKLEPLKEAAYKVMRDNYLQVLRSPDIYGRLSGAERELVLQRRLRGREHLVVADVCPQDGSGRLCCYDDERDAWRPLARLPPEAVSR
GCAICSLFNYLFLVSGCQGSGLQPSNRVFCYNPLTDIWSEVCPLNQARPHCRLVALDGQLYAVGGECLNTVERYDPRLDRWTFAPPLPKDTFALAHTAAASGGELFVTGG
SLRYLLLRFSVREQRWRAAPTGGGRDRTAEMVAVRGFLYRFDLNRSLGISVYRCSASARLWYECATYRTPYPEAFQCAVVDELVYCVGRRRTLRFLADSISPRFVPEMRQ
AFPSPQGTLLPTVLTLPGPDVPQTRV*
790 >lcl|XP_608638.2|Plus11354338..1355783 NW_001493113 hCG2019360-like OTUD1 __SEG__ Chr13 {Bos taurus} MQLYSSVCTHYPAGGQGPTAATAAPPAAATATSFKVSLQPPGPAGGAPEPETGECQPAAAAEPREAAAAPAAKMPAFSSCFEMVSGAAAPASAAAAGPPGGSCKPPLPPH
YTSTAQITVRALGADRLLLRGPEPGAAAPAAPRGRCLLLAPAAGAPIPPRRGSSAWLLEELLRPDGPEPAGLDATREGPDRNFRLSEHRQALAAAKHRGPAPPPGSPEPG
PGPWAEERPAERNLRGWDRAGDRRDAPGAEEPGRPDPEAEAAPARSGEAAPGGATEAVIVSRSDPRDEKLALYLAEVERQDKYLRQRNKYRFHIIPDGNCLYRAVSKAVY
GDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFDHSY
PNPEYDTWCRQTQVQRKRDEELAKSMAISLSKMYIEQNACS*
791 >lcl|XP_608696.4|Plus1complement(21177..22109) NW_001495357 olfactory receptor 1394-like LOC530231 __SEG__ Chr7 {Bos taurus} MDVWNHTSLSDFILLGLFSYSPYDFFLFSLVLLASATALAGNILFLLLIQADRCLHTPMYFFLSQVSIMDLIMMGTVVPKMAANFLSGSKFISRGGCATQVFLVVMVGSA
ECSLLAVMAYDRYVAVCHPLRYPVLMNWKACCLMAFASWMVGVTDSVIYVGMVFSFPYCGSLQVDHFFCEVPTLLRLSCADTSLFQDLIYACCVVMMLLPLGVIVASYAR
ILMAVINMPSTEGKQKALTTCSSHLTVVGLYYGGGLFNYMQKASARTPAEDRAISTFYTIVAPMLNPLIYSLRNREVMRAFKKVLGTWRV*
792 >lcl|XP_608945.3|Plus1complement(29950..31107) NW_001494035 relaxin/insulin-like family peptide receptor 3-like LOC530472 __SEG__ Chr21 {Bos taurus} MESARGSCRMARAFGAVLPLNWFGDASSRQPSNSSVGNGSESTRPTWGPRSLDGLEGVAEAGAALALRALIAGAYLALCAVGLVGNVLVLVLVRSQQRRRHSLLNCFLLN
LAATDLQFVLTLPFWAVDMVRDFSWPFGGAMCKVVLTLTVLNMYASGFFLSAMSVARYYAVARALRPRRPGTLWAVCVCSLLWATAVLATAPTALFATAASIGGERLCLL
RFPDGGPDWLAFYHLQKITVAFVLPLVTLGTCSLLLLRFLRRQRVRWSSGVRHRRRSRVTRALACVLLVFVLCWLPNQALTFWRVLIKLNAVPWDRAYFLVQAYLFPVSI
CLAHSNSCLNPLLYCLLRRDFRQGLQELCGRAKHPADLRPGCPIDSRAPATGLSD*
793 >lcl|XP_609075.3|Plus1complement(2176224..2177153) NW_001494714 olfactory receptor 16-like LOC530601 __SEG__ Chr3 {Bos taurus} MKKKNHTLVNEFTLQGFSSFCEHQFTLFIVFFALYMLTLAGNIITVAIISLDRRLHTPMYFFLGMLSASETVYTVIIIPKMLCNLVGLSQSISLAGCAAQMFFFITLAIN
NCFLLTVMGYDRYVAICHPLRYTVIMNRRVCIQLVWGACSIGLIVAMTQVTSVFRLPFCATKVAHFFCDIWPVMKLSCIDTTVNEILTLIISVLVILVPMGLVFISYILI
ISTILKIASAEGRKKAFATCASHLTVVIVHYGCASIAYLKPKSENSKDEDQLISVTYTVVTPLLNPVVYTLRNKEAKDALLRAIGRKLS*
794 >lcl|XP_609302.3|Plus1complement(711719..712690) NW_001493332 olfactory receptor 226-like LOC530824 __SEG__ Chr15 {Bos taurus} MEATTCNGSVGGSPVFYLVGIPSLPESLFLPVFLIFLLFYLLILMGNALILVAVVAESSLHKPMYFFLINLSALDILFTTTTVPKMLSLFLFGDHFLSFTSCLLQMYLFQ
SFTCSEAFILVAMAYDRYVAICRPLHYTALMTPQTNAALAASAWLTALLLPIPAVVQTSQMAYDNIARIYHCFCDHLALVQASCSDTTPQTLMGFCIAMVVSFLPLLLVL
LSYAHILASVLRIGSREGRSKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIVGNVVYAILTPVLNPLIYTLRNKDVKAAITKVTHLKTQAGIGALDL*
795 >lcl|XP_609417.2|Plus1complement(508130..510643) NW_001508705 slit homolog 3-like SLITRK4 __SEG__ ChrX {Bos taurus} MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLQLGNNKLQNIEGGAFLGLSALK
QLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCD
LLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKAPKTTNPSKISGIVAGKALSNRNLSQIV
SYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPSNAKKLHVNGNSIKDVDISDFTEFEGLDLLHLGSNQITAIKGDVFRNLTNLRRLYLNGNQIERL
YPEMFSGLHNLQYLYLEYNLIKEILAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQALTQIDLEGNPWDCTCDLVALKLWLEKLN
DGIVMKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPE
CGSMQLQLRKHDHKTNKKDGLGTEAFIPQTIEQMSKSHTCSLKDSETGFMFSDPPGQKVMMRNVTDKEKDVLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYN
SIGVSGFEIRYPEKQDKKTKKSLIGGNHSKIVVEQRKSSEYFELKAKLQSSPDYLQVLEEQTALNKI*
796 >lcl|XP_609575.3|Plus1complement(4942469..4943416) NW_001494824 olfactory receptor 1337-like LOC531090 __SEG__ Chr3 {Bos taurus} MWMPPGQNQSWVSEFILRGFSSDPTTNRALFSAFLLLFLSSVLGNGLIITLICLDTHLHTPMYFFLCILSLLDMGCVTTTVPQMLVHLLSRSQTISFAGCWLQMCIFGAV
GLTECILFVVMAFDRYVAICYPLRYTVILSWGLCTRLSAGTWACGFFFSLIHTFFTMRLPYCGPNMVNHYFCEGPSVRNLACVDTHVIEMVDSVISVFMVVAPLSLILAS
YICISQAIFKIKSMQARCKAFSTCASHLTVITFFYAPAIYIYMKPNSRYSPERDKQISLFYNVFSALLNPVVYSLRNKNIKGAFLKVMGKSRVIC*
797 >lcl|XP_609582.3|Plus1208474..209400 NW_001493369 olfactory receptor MOR235-2-like LOC531097 __SEG__ Chr15 {Bos taurus} MDFFRLPNNVTEFVLLGLTQNPYLQKVLFVVFLFIFLFTVLANHFIVITVSLSPTLSTPMYFFLTHLSLLDASLTSVSTAKMTFDLLHHRRTISWGGCLTQLFMEHFLGA
SEVIVLTVMAYDHYVAICKPLHYMTIMRQGLCQLLVVVAWIGGILHASVQILFTTNLTFCGPNVIDHFMCDFFSLLEISCSDTYRLGMVVAANTGGMALLIFLLLLISYI
VILSSLKSHSSEGRRKALSTCGSHFTVVVLFFGPCIFTYTRPVATYPADKLVTVFYGILTPLLNPIIYTVRNTEVKNAMRSLLKKRVT*
798 >lcl|XP_610281.5|Plus1complement(25339..26301) NW_001493320 olfactory receptor 478-like LOC531779 __SEG__ Chr15 {Bos taurus} MDSLWQRNGTTMTGFILLGLTNDPVLRIILFMIILCIYLVTICGNLSTIILIRISSQLHHPMYFFLSHLAIADVGYSSSVTPNMLVNFLVEKNTISYPGCAIQLGSAVFF
GSTECILLAAMAYDRFIAICSPLLYSTKMSTQICVQLLILAYIGGFFNASSFTISFYFLHFCGPNRVNHFFCDFAPLVELSCSDISIPAAVPSFMAGSIVVITVTVIAVS
YIYILITILKMHSTEGSHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYVVVIPMLNPLIYSLRNNEIKGALKRACQKNTFLVKSVIS*
799 >lcl|XP_610318.3|Plus1complement(333948..334877) NW_001494524 olfactory receptor Olr1242-like LOC531816 __SEG__ Chr29 {Bos taurus} MAPGNDSFTTQFILVGLTDQSVLQLPLFFLFLVMYMVTVMGNLSLIILIGLSSHLHTPMYFFLFNLSFIDLCYSTVFTLKMLINIISKKKIISYMGCMTQLYFFTFFGIS
ECYVPTSMAYDRYVAICNPLLYKIAMSPKVCSSFMLGSYLMAFLDAMILIGGMLRLNFCDANTINHYLCDTYPLLQLSCTSTYILELEVIIVSGINIILPSLTIFVSDGL
ILSNILHISSTEGRSKAFRTCSSHIIAVSLFFGSSAFVYLKPSSMPMNKGKVLSVFYTNVVPMMNPLIYSLRNKDVKLALRKVLRMVKF*
800 >lcl|XP_610381.4|Plus1163913..164857 NW_001492991 olfactory receptor, family 1, subfamily F, member 1-like LOC531878 __SEG__ Chr11 {Bos taurus} MERLNQTSSVSEFILLGLSSRPEDQKPLFILFLIIYLVTITGNLLIILAICSDPQLHTPMYFFLSFLSFTDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFIYALGNT
DSWLLVVMAFDRYVAICDPFHYVTIMSHRRCVLLVAFSCSLPHFHSLLHTLLLNHLTFCDSNIIHHFLCDLSPLMKLSCSSTFVNEIVLMTEASAFLVTPFLCIAFSYIR
ILITVLKIPSAAGKHKAFSTCGSHLTVVTLFYGSIFYVYLQPVSTYTVRDHVATIVYTVLSSMLNPFIYSLRNKDLKQGLRKLVGRRKPQAAPP*
801 >lcl|XP_610538.4|Plus11116420..1117334 NW_001494342 olfactory receptor Olr292-like LOC532031 __SEG__ Chr26 {Bos taurus} MNQTLVTEFFILGFSETPGLRTLLFSAFLLLYTVALSGNLLIVVVINSSPALHTPMYFFLVNLAVVDILCTSTILPELLVGMVASKTISYGGCMAQLFFFTWSMGAELLL
FSAMAYDRYVAICRPLHYSALMGPRVCALLAGVVWTVSLINTGVHTGLMLRLPFCRSNVVEHFFCEIPPLLKLSCAPTQLNETMAFTADIFLAVGNFSVITLSYGCIIGS
ILRMRSAVGKRRAFSTCSSHLLVVTLYYSTVIYTYIRPASSYSLDKDKLVSVIYTSVAPSLNPLIYSLRNMEVKAALRRLLSCS*
802 >lcl|XP_610585.2|Plus1928556..929503 NW_001495357 olfactory receptor MOR254-1-like LOC532075 __SEG__ Chr7 {Bos taurus} MGICNQTTVTQFILIGLSDSPEVRYPLFVVFTIIYQVTLVGNGIILLAIGTEKKLHTPMYYFLANLSLLDILCPSVTVPKMLENLLTEKHSISYIGCALQLYFLVALVGT
EVFLLSVMAYDRYVAICFPLRYTLIITKVRCVQLTAGTWVAGFLNSLLHTVSTFRLSFCKSNQVNQYYCDIPPVVALSCSSTYVAEMLILVEAGILGSSAFLVIFISYFY
IISTILKIQSAEGKRKAFSTCASHLLVVCLFGGTTIFTYVRPFSNQHSPARDRLISMLYGIITPMLNPMIYSMRNTEVKGAIRRLLYQKACLQQV*
803 >lcl|XP_610610.4|Plus14741164..4742111 NW_001494824 olfactory receptor MOR258-5-like LOC532100 __SEG__ Chr3 {Bos taurus} MQDFLLGNHSSLTEFILLGFSGNTKINVILFSVFLFLYLVTLLGNGLIITLIRKDSRLHTPMYFFLSVLSILDMGYVTTTVPQMLVHLVSKKKTISYVGCVAQMYIFLML
GITESWLFAIMAYDRYVAICHSLRYNVIMSPLLCGLMVAFCGFWGTSCALIYTVSAMILPYCGPNEINHFFCEVPAVLKLACADTSLNDQVDFILGFILLLVPLSLIIIV
YINIFAAILRIRSSQGRLKAFSTCASHITVVTMFSIPCMVMYMRPGSKASPEEDKKLALFYNVISAFLNPIIYSLRNKDVKRAFLKVTGWGNAPK*
804 >lcl|XP_610718.1|Plus1complement(3125752..3126693) NW_001494955 olfactory receptor 71-like LOC532208 __SEG__ Chr4 {Bos taurus} MGRDNLTWVSEFVLLGLSGDRQTQAGLFVLFGATYLLTLLGNGLILVLVWLDPRLQLPMYFFLGNLSVVDICYTSSGVPQMLAHFLLEKKTISSARCGTQHFFSLALGGT
EFLLLAAMAYDRYVAVCDPLRYAAVMGPRLCAGLAGVSWLVGLANAAVETAVTVRLPTCGRHVLNHMACETLALVSLACVDVTLNQAVILASSVVVLLVPCCLVALSYAR
IVAAILRIRSSGGRRKAFGTCTSHLTVVSMSYGMALVTYMQPRSTASAEQDKVVVLFYAVVTPMLNPLIYSLRNKEIKAALTRVLTRSSESKR*
805 >lcl|XP_610748.2|Plus1complement(2379162..2380100) NW_001493662 olfactory receptor, family 1, subfamily A, member 1-like LOC532238 __SEG__ Chr19 {Bos taurus} MRDENQSSVLDFFLLGVSSHQEQEDFFFVLFLFIYPITLIGNLLIILAIHSDIRLHNPMYFLLANLSFVDIFFSSVTIPKALANHLLGSKAISFGGCLTQMYFMIALGNT
DSYILAAMAYDRAVAITRPLHYTIIMSPWTCVLLVIGSWVVGNGNALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFNVKMMYLGVGVFSMPLLCIIISYVRV
FSTVLRVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGMYFRPLTSYSLKDAVITVMYIAVTPVLNPFIYTLRNRVMKDALEKLFSKRTSSHPT*
806 >lcl|XP_610803.1|Plus1780054..780992 NW_001494173 olfactory receptor Olr1654-like LOC532291 __SEG__ Chr23 {Bos taurus} MEQKNESSFAGFILLGFSDRLQLELILFVVLLIFYIFTLLGNTTIIALSYLDPRLHTPMYFFLSNLSFLDMCYTTSIVPQFLFNLSRADKSISFGGCVVQMYISLALGCT
ECILLGVMAFDRYAAVCRPLHYTVIMHPRLCALMASASWVTGFVNSLLQTVLIFLLPRCGRNKLAHFFCEIPPFLKLACVDTTMNVYVTFFGSVIILLTPVSLIMFSYGR
IVRAVLRIKSTAGQRKAFGTCGSHLTVVSLFFGTAIYVYFQPSSSDSQDQDKFMSLFYTVIIPMTNPLIYTLRNRDVKGAMKKMLWKNSYSG*
807 >lcl|XP_610836.1|Plus1565951..567906 NW_001493409 choroideremia CHML __SEG__ Chr16 {Bos taurus} MANSLPTEFDVIVMGTGLPESILAAACSRSGQRVLHLDSRSYYGGNWASFSFPGLLSWLKEHQQNSDTGEESPAAWQDMIHETEEAIPLCKKDETIQHAEVFCYASQGMD
GNIEELGALQKNPSCVASSTLIKPLDSACLSEETHSSHITSYEVPTQDTPKNNEEITDTAETSVKEEYCGYDTYKHTVSDGTKDEIKPVLEDNSVPPKRKRIAYSQIVKE
GRRFNIDLSSKLLYSQGLLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKFLTFCLDYEQHPEEYQAFTQCSFSEYLKTKNLTPSL
QHFILHSIAMMSESSCTTVDGLKATKTFLQCLGRFGNTPFLFPLYGQGEIPQCFCRMCAVFGGIYCLRHKVQCLVVDRESGRCKAIIDHLGQRINAKYFIVEDSYLSEET
CSSVQYKQISRAVLITDQSVLKTDSDQQISILIVPPVEPGAHAVRIIELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYSETEVDNEELPKPGLLWALYFN
MRDSSGVSRSSYNGLPPNVYVCTGPDSGLGSEHAVKQAETLFHEIFPSEEFCPPPPNPEDIFFDGDEKPSEPLGTNNIVMAKLESSEGSKNLESSGKHLQN*
808 >lcl|XP_610920.2|Plus1complement(87507..88463) NW_001495460 olfactory receptor 157-like LOC532403 __SEG__ Chr8 {Bos taurus} MKLANQSTVAGFVLLGLSDQPKLEKMFFVLILLMYLVILLGNGVLILVTILDSCLHTPMYFFLGNLSFLDICYTTSSIPLVLDGFLTPRKTISFSACAIQMFLSFAMGAT
ECVLLGMMAFDRYVAICNPLRYPVVMRKAVYVSMAASSWLAGGANSLVQISLAVQLPFCGDNVINHFTCEILAVLKLACADISINVVSMGVANVIFLGVPVLFILVSYIF
ILTTILRIPSVEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKSKDSLGADNQDVSDKLISLFYGVLIPMLNPIIYSLRNKDVKVTVKNLVSQKCFPR*
809 >lcl|XP_610928.3|Plus118879..19811 NW_001493368 olfactory receptor 1019-like LOC532411 __SEG__ Chr15 {Bos taurus} MDKENHSMVTEFIFMGITQDPQLQIIFFVIFLLVYLVNVVGNAGMIILIITDTQLHTPMYFFLCNLSFVDLGYSSAIAPRMLADFLTKHKVISFSSCATQFAFFVGFVDA
ECYVLAAMAYDRFVAICRPLHYSALMSKRVCLALMLGSYLAGLVSLVAHTALTFSLSYCGSNILNHFFCEIPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAF
ILIAIIRMRSAEGRLKAFSTCGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAALKKIIGKKPQ*
810 >lcl|XP_610944.4|Plus11301720..1302655 NW_001493648 olfactory receptor Olr1522-like LOC532426 __SEG__ Chr19 {Bos taurus} MDSGNLTWVSEFVFLGFSQYQELQLFLFLVFLLVYTTTVVGNLLIMVTVTSDSRLHTPMYFLLRNLAVIDVCFSSVTAPKMLVDILAEKKTISYQGCMAQIFFFHFLGGG
TLLFLSVMAYDRYIAISRPLHYVTIMNTRVCVGLVVAAWVGGFVHSVAQLILMLPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTV
ILVMLRSHSGQARRKAASTCTIHIIVVSMVFIPCIYIYARPFTSFPIDKAVSISQTVITPMLNPMIYTLRNQEMQAAVKRLGKRLVISRRE*
811 >lcl|XP_610960.2|Plus1complement(181642..182592) NW_001495313 olfactory receptor, family 10, subfamily H, member 2-like LOC532441 __SEG__ Chr7 {Bos taurus} MLGLNYTSVSEFILIGFSTFPQHLLPVFFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLLLCALSISEVLYTFTIIPRMLADLLSTDRSISFTACASQMFFSFTPGF
THSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGLFIGLLVTSAIFHLPFCGLSEVHHFLCHVPPLLKLACGNNVPGVALGVGVVCITALLGCFLLILLSY
AFIVSTILRIPSTEGRHKAFSTCASHLTVVVVHYSFASVIYLKPKGLYSEEGNTLMAITYTVLTPFLSPIIFSLRNKELKIAIKKTFLRIWQDDQQ*
812 >lcl|XP_610975.4|Plus1complement(2499256..>2500227) NW_001493662 olfactory receptor, family 3, subfamily A, member 1-like LOC532454 __SEG__ Chr19 {Bos taurus} LDISLQELMQPKPRANGTAVTEFILLGLVETPGLWPAVFVLFLFAYLVTVGGNLSILAAILVEPKLHTPMYFFLGNLSVLDIGCITVTVPLMLGRLLSHKRTVPYAACLT
QLFFFHLLVGVDCFLLTAMAYDRFLAICRPLTYSTRMSQTVQRILVAVSWACAFSNALTHTVAISTLNFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFGVGFIMAGT
PLALVVTSYIHVAAAVLGIRSVEGRKKAFSTCGSHLTVVAIFYGSGIFNYMRLGSAKLSVKDKAVGIFNTVANPMLNPIIYSLRNPDVQGALRRVIKGRWSLE*
813 >lcl|XP_611029.2|Plus1252156..253085 NW_001493367 olfactory receptor 1264-like LOC532501 __SEG__ Chr15 {Bos taurus} MARTNNVTELIISGLFQDPEVQRACFVVFLPMYLATVVGNGLIVLTVRVGKSLHSPMYFLLSHLSLVEISYSSTVVPKFITDLLSKIKTISLEGCVAQIFFFHFFGVTEI
FLLTVMAYDRYVAICKPLHYTTIMSRSLCHQLVAASWLGGFVHSMVQIIITLQLSFCGPNVIDHYFCDLHPLFKLACTDTSVEGVVVLANSGLFSIFSFLLLVSSYVVIL
VNLRNHSAEGRRKALSTCASHITVVVLFFGPTIFLYMRPPSTFTEDKLVAVFYTVVTPMLNPIIYTLRNTEVKIAMRRLWGRKVNSGLQ*
814 >lcl|XP_611046.4|Plus12630609..2631544 NW_001494522 olfactory receptor Olr1334-like LOC532517 __SEG__ Chr29 {Bos taurus} MTNMSLVTMFILTGLPHAPELDTFLFGIFLVIYVLTLVGNLLILLVIIVNPHLHTPMYYFLTNLSFIDMWYSTVTTPKMLMTLVSPEGSPVSFPGCVAQLYSFHFLGSTE
CFLYTVMSYDRFLAISYPLRYASMMSGRTCALLATTTWLSGSLHSAVQTTLTFRLPFCGPNQIQHYICDAPPILKLACADTSTMEMVIFVNIGVVASGCFLLIVLSYMSI
IHSILKIRTSEGRWRAFQTCASHCTVVLCFFGPGVFIYLRPGSKEVVDRIVAVFYTVMTPLLNPVVYTLRNKDVRKALLKLKDKVVHSESK*
815 >lcl|XP_612644.2|Plus1complement(2233959..2234951) NW_001494698 G protein-coupled receptor 3 GPR3 __SEG__ Chr2 {Bos taurus} MMWGAGSPLAWLSAGPGNVNMSSMGSTEGPTGPATPLPSPTAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVMHFAAVFCIGSAVMSL
VLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDARATCGVVYPLSKNHLVVLAVAFFMVFGIMLQLYAQICRIV
CRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKTLFRSRSPSDV
*
816 >lcl|XP_868992.3|Plus12741192..2742130 NW_001494714 Olfactory receptor, family 6, subfamily N, member 1-like isoform 3 LOC517209 __SEG__ Chr3 {Bos taurus} MKPGNWSQVTEFIILGFPHLQGVQAFLFLLLLLIYLTTVLGNLLIFLVVCLDFRLHTPMYLLVSILSLLELGYTAATTPKMLSNLLSEKKTISFSGCLLQIYFFHSLGAT
ECYLLTAMAYDRYLAICQPLHYPTRMTPALCVKIAVGCWLGGLAGPVAEISLVSHLPFCGPNRIQHIFCDFPPVLSLACTDTSINVLVDFVINSCKILANFLLILSSYVQ
IICTVLRIPSAAGKKKAFSTCASHLTVVLIFYGSILFMYVRLKKSYSLDYDRALAVVYSVLTPFLNPFIYSLHNKEIKEAVRRQLKRMGILE*
817 >lcl|XP_869056.1|Plus138358..39287 NW_001495020 olfactory receptor, family 12, subfamily D, member 2-like isoform 3 LOC523258 __SEG__ Chr5 {Bos taurus} MKNLSTIDEFVLLGLSTDPDIQTMLFVLFLGIYLLTLMGNLMMILVIRADPHLHTPMYFFLGHLSFLDICHSSITIPKMLQNFLSQRKTISVWGCITQSFFFIFSGGTES
CLLSAMAYDRYAAICHPLLYTMIMNGPLCTAMVSAAWVMGFLNSLVNNLCTQNLQFCGPNIISHFSCELPSLFPLSCSDTMPNTILLAGSTAFLGLVTLPPILFSYSKII
LAILSISSSKGQGKAFSTCSSHLTVVLSFYGTALFRYISPSSGSVLEQVVSIQYGVITSLINPLIYSFKNQEVKAALQRILRQQICVSG*
818 >lcl|XP_869185.3|Plus1731771..732724 NW_001495357 olfactory receptor 225-like LOC522955 __SEG__ Chr7 {Bos taurus} MERNNESSGGDFILLGFSDRPKLEMVLFFVNMIFYFLAVAGNSTIIFLSLVDPQLHTPMYFFLSNLSLLDLCYTTSSIPQMLVNLWGPYKTITYVGCVIQLFAFLSVGGI
ECILLSVMAYDRFVAVCKPLQYMAIMHPQLCLQLAAFAWLSGIANSILMSPLTMSLGRCGHRHINHFVCEMPAIIRISCVDTSWVEGLGFFLAIPIVLVPLTMILVSYGY
IAAAVLRMQSAAGRQKAFNTCSSHMVVVSLFYSSIIYMYMQPGNTASQDQGKFLTLFYCLVTPTLNPFIYTLRNKDVKWAMRKVLGKDRSLLDAGRH*
819 >lcl|XP_869218.2|Plus1complement(738041..739000) NW_001495357 olfactory receptor Olr1654-like LOC613390 __SEG__ Chr7 {Bos taurus} MMEIANVSFPEVFILLGFSERPSLEPILFIFVLGIYVVSVLGNGVIIVVSCMDVHLHTPMYFFLVNLSFLDISFTTSIVPQLLVNLWGPQKTISYGGCVIQFYISHWLGA
TECVLLAVMSYDRYAAICRPLHYTVIMHPKLCCSLAFASWLGGLTTSMVGSTLTMLLPLCGNNRIDHFFCEMPLIMQLACVDTSFNEVEMYVASFIFVVLPLGLILVSYS
RIAWAVLTIRSAEGWRKAFNTCSSHVAVVTLFYGSIIFMYLQPAKRNSHEEGKLVALFYTVVTPMLNPLIYTLRNKTVKKALRHTVLQNCGSGGTRGDI*
820 >lcl|XP_869226.3|Plus1318439..319377 NW_001492991 olfactory receptor Olfr335-like LOC613397 __SEG__ Chr11 {Bos taurus} MRKENQSSVSEFLLLGLPIRPEQQGVFFALFLGVYLTTVLGNLLIILLIRLDPHLHTAMYFFLSHLAFSDISLSTITVPKMLMNMHTQQQSIPYVECISQMYFFILFGCF
DNFLLAVMAYDRYVAICQPLHYTTVMRQELCISLVAVSWFFCCIHALLHTLLLVQLSFCAENTIPNFFCDLPSLLKMSCSDISINELVIFTEGGMLFILPLSIILGSYVH
IGTIILRVPSIKRLFKAFSTCGSHLFVVSLYYGTLAGAYFFSLLWDSNDKDVIASVMYTVVTPMLNPFIYSLRNRDIKQALEIFVFRGNFFR*
821 >lcl|XP_869290.3|Plus1106973..107932 NW_001495460 olfactory receptor 155-like LOC613441 __SEG__ Chr8 {Bos taurus} MDRSNQTSPLVEFILLGLSAYPTLEKTLFVLIVLTYLVILLGNGVLILVTILDSRLHKPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTVSFSACFGQMFLSFAMGA
TECVLLGMMAFDRYVAICNPLRYPVVMNKVACRPMAIGSWAAGITNSVVQTSQAVRLPFCGDNVINHFTCEILAVLKLACADISINVVSMVVANVIFLGVPVLFIFVSYV
FIIATILRIPSGEGRKKAFSTCSAHLTVVVIFYGTILFMYGKPKNKDPLGADKQDLTDKLTSLFYGVVTPMLNPIIYSLRNKDVKAAVRNLVSQTHLTE*
822 >lcl|XP_869409.1|Plus1complement(607079..607750) NW_001494291 suppressor of cytokine signaling 1 isoform 2 SOCS1 __SEG__ Chr25 {Bos taurus} MVAHNQVAADNAISTAAEPRRRPESSSSSSSSSSSTSSPSSAAPARLRPCPAAAAPAPAPAPGDTHFRTFRSHAEYRRITRASALLDACGFYWGPLSVHGAHERLRAEPV
GTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFP
FQI*
823 >lcl|XP_869509.1|Plus1complement(464829..466154) NW_001495374 ubiquitin associated protein 2-like UBAP2L __SEG__ Chr7 {Bos taurus} MNNRRYGQHSSSLGGLSHNEEIPNTTTTQHSSTLSTQQNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVT
ASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQ
QNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPDISGSVYSKTQQSF
EKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTSHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQKPQTNKSAYNSYSWGA
N*
824 >lcl|XP_869594.1|Plus1complement(374534..375472) NW_001495047 olfactory receptor 790-like LOC613564 __SEG__ Chr5 {Bos taurus} MRNYTEVTEFILLGLTSDPKWQVVLFLFLLVTYMLSVTGNLVIITLTLSDPHLQTPMYFFLRNFSFLEISFTSVCIPRFLVAIMTEDRTISYNGCVAQLFFFIFLGVTEF
YLLAAMSYDRYVAICKPLHYTTIMSSKVCILLVFSSWLAGFLIIFPPIILLLRLDFCGSNIVDHFICDASPILQLSCTSTHFLELMALFLAVVTLMVTLTLVILSYTYII
QTILRIPSTNQRKKAFSTCSSHMIVVSLSYGSCIFMYIKPSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNQQVQQAFKNMVQRIAFSSNK*
825 >lcl|XP_869750.3|Plus1complement(169743..170681) NW_001495047 olfactory receptor, family 6, subfamily C, member 2-like LOC512580 __SEG__ Chr5 {Bos taurus} MKNHTSLPTFILLGLTDDPPMQVLIFIFLFASYTLSVTGNLTIIILTLVDSHLKTAMYFFLKNFSFLETLFTTVCIPRFLYSLSTGDKTISYNACFSQIFFIFVFAATEF
FLLAIMSYDRYVAICKPLQYATIMNSRVCGGLVICCWIAGCLVIFPPASLGLELEFCDSNIIDHFLCDAFPVLKISCSDTWFLEQMVFTVAVLTVIGTFLCVFLSYTYII
KTIIKLPSAQQKMKAFSTCSSHLIVVSITYGSCIFIYVKPSAKDEVAVNKGVLVLTTSVAPMLNPFIYSLRNKQVKQAFADLIKRISLILRK*
826 >lcl|XP_870020.3|Plus163310..64251 NW_001502164 cOR8V11 olfactory receptor family 8 subfamily V-like isoform 1 LOC614985 __SEG__ Chr15 {Bos taurus} MGKHNRTVLSEFILMGITDCPELQAPLFGLFLIIYVISVVGNLGIVILTKRDSRIQTPMYFFLRHLAFTDLGYSTTMGPKMLVNFVADQNKISYYFCATQLSFFLVFIIS
ELFILAAMSYDRYVGICNPLLYPVVMSQRVCQVLVAMPYFYSIFESLLITVKIFDSSFCGYNVIRHFYCDSLPLLSLLCSNASEIGLIILISAGFNLIFSPLIVLVSFLL
ILASILRMSSAESRQKAFSTCGSHLTVVTVIYGTLIFMYVQPESNHSFDTDKMASIFYTVIIPMLNPLIYSLRNKDVKCALQSTWNRICNSFS*
827 >lcl|XP_870025.3|Plus1746348..747301 NW_001493843 olfactory receptor Olr1654-like LOC613799 __SEG__ Chr1 {Bos taurus} MGADNQTWVRGFILLGLSSDWATQVALFVLFSVTYLLTLLGNVLIVLLIRLDSRLHTPMYFFLTNLSLVDVSYATSIVPQMLVHFLAEHKGIPYVSCAAQLFLSLGLGGI
EFVLLAVMAYDRYVAVCDPLRYSVIMHGGLCARLAITSWVSGSVNSLVQTTITFQLPMCTNKYIDHISCELLAVVRLACVDTSSNEVAIMVSSIVLLMTPFCLVLLSYIR
IISTILKIQSTEGRKKAFHTCASHLTVVVLCYGMAIFTYIQPNPSPSVLQEKLISLFYAILTPMLNPMIYSLRNKEVKGAWQKLLGQLSGLTSKLAA*
828 >lcl|XP_870110.2|Plus1431489..433888 NW_001495372 protocadherin beta 14 isoform 1 PCDHB14 __SEG__ Chr7 {Bos taurus} MEVRGALVLRKRQVLILFVLLGLSQARPESVPYSVAEETEIGSSVANLARDLGLGVEELSSREARVVCDDNEKHLHLDLLTGDLLINDKLDREEMCGSTEPCVMHFQMVL
ENPLQFFQAELHIKDINDHSPTFLDNEIVIKISESTTIGTTFLMESAQDLDVGSNSLQNYTVSPNSHFYIKIQDSDDGKIYPELVLHRALDHEEEPELRLTLVALDGGNP
PRSGTTLVLIKVLDINDNAPEFPQRLYEVQVLENAPVGSWIITVSAKDLDAGNYGKILYTFFHASEDIRKTFEINPISGEVHLRSQLDFEVVQSYTINIQATDGGGLSEE
CTLLVKVIDTNDNPPEVIISSITKIIPENAAETLVALFSVRDQDSGENGRIICSIQDDLPFFLKPTFKNFFTLVSDKALDREERAEYNITITVTDMGTPRLKTEHNITVL
VSDVNDNAPAFTQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFRVGATDRGSPALSSQALVRVL
VADANDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDGGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHV
LLVDGFSQPYLPAPEAEAAAAALADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLVDVSGTGTLSQSYQYEVCLMGGPGTNEFKFLKP
IIPNLPVQDTGRHIGENENFRNSFGLNLQ*
829 >lcl|XP_870156.2|Plus1complement(323521..324552) NW_001495589 trace amine associated receptor 8-like LOC613867 __SEG__ Chr9 {Bos taurus} MSSASPSAAAVQLCYEHLNGSCVKTPCSPGPRLILYTVFIFGAVLAVFGNLLVMISILHFKQLHSPTNFLIASLACADFLLGVTVMPFSTVRSVESCWYFGESYCKFHTC
FDGSFCYASIYHLCFISLDRYIAITDPLVYPTRFTESVSGMCIAFSWLFSIIYSFSLLGTGANAARLEGLVSALTCVGGCQIAVNQSWVLVNFLLFFIRTLVMIVLYSKI
FLIAKQQARKIESLNNKTGRCSDSFQDRVAKRERKAARTLGVAVVAFLVSWLPYFLDAIIDAFLGFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKV
LRANSSTVNLFSG*
830 >lcl|XP_870260.3|Plus1269192..270136 NW_001501922 olfactory receptor Olr1654-like LOC613938 __SEG__ Chr15 {Bos taurus} MKRQNQSSVVEFILLGFSNFPELQEQLFVVFLVVYLVTLMGNVIIIVIISLEQSLHVPLYLFLQNLSVVDMGISAVIMPVMLVILSTEKMRIFTAGCFAQMYFILLFGVT
ECFLLGAMAFDRFTAICHPLSYPMIMNKMVFMKLVTFSWVSGITVATMQTTWVFSFPFCGSNEINHLFCETPPVLELACADTFLFEIYAFTGTILTVIVPFSLILLSYVR
ILFAILKMPSTTGRQKSFSTCASHLTSVTLFYGTASMTYLQPKSGYSPETKKLMSLAYTLLAPLLNPLIYSLRNSEMKRALMKLWRRKVDLHTF*
831 >lcl|XP_870294.3|Plus12561855..2563996 NW_001492860 zinc finger and BTB domain containing 1 isoform 2 ZBTB1 __SEG__ Chr10 {Bos taurus} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDIYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDADCSSSKCSSSASSKQNSKMIFGVRMYEDTVARNGSEANRWCAEPSSTVNTPHNREPDEESLQLGNFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQNTRSYHRLVDIRDGKDSNIKAEFGEKDSSKTFSAQTDKYRGDTSQAADDSASTTGSRKSSTVESELASEEKSRAAERKRIIIKME
PEDIPTDELKDFNIIKVTDKDCNESTDNDELEDEAEEPFYRYYVEEDVSIKKSGRKTLKPRMSINADERGGLENMRPPNNSSPVQEDTENASCELCGLTITEEDLSSHYL
AKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNAEEKMDMEENPDEQSEIRDMFVEMLDDFRDNHFQINSIQKKQLFKHSACPFRCPNCGQRFETENLVV
EHMSSCLDQDVFKSAIMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSAG
ETICQVCFQIFPNNEQLEQHMDIHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
832 >lcl|XP_870314.2|Plus1complement(645969..646928) NW_001493314 olfactory receptor, family 51, subfamily E, member 2-like LOC613962 __SEG__ Chr15 {Bos taurus} MLPYSNSSLSTEASEFLLNCFVRSPSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHEPMYYLLSLLSLLDMVLCLTVIPKVLAIFWFDLRTISFSACFLQMFIMNN
FLSMESCTFLVMAYDRYVAICKPLHYPSIITNQFVSRALVFILARNTFLTAPIPILSARLHYCGRNIIENCICANLSVSKLSCGNITLNKIYQLFLAWTLLGSDLILIFL
SYIFILRAVLRLNTRQTAAKALSTCGSHFILILFFSTILLVFVFTHLAKKKVSPDIPVLLNVLHHVIPAALNPIVYGVRTQEIKQGIWKLLRKGSDSRK*
833 >lcl|XP_870840.1|Plus12525549..2526490 NW_001494955 olfactory receptor 49-like LOC614298 __SEG__ Chr4 {Bos taurus} MSNHSSAMEFCLLGFPGSQELHHILFAIFFLFYSVTIMGNTIIIVIICVDKHLHSPMYFFLGHLSAVEMLATSIIVPMMLWGLLLHEMQTVSLTACVTQLFLYLALGTTE
FALLGVMAVDRYVAVCNPLRYNTIMNSHTCISVVIGSWVFGFLCEIWPVYATFQFTFRKSNVLDHFYCDRGQLLKLSCGDTLFTEFVLFLMAVFIVVGSLVPTIVSYIYI
TSTILKIPTASGRRKAFSTCASHLTFVVIGYGSCLFLYVKPKQTQAAEYNKIVSLLIIVLTPLLNPFIFTLRNDKVKEALRDGVKRCCQLLKD*
834 >lcl|XP_870904.1|Plus11990257..1991360 NW_001493242 developmentally regulated GTP binding protein 1 isoform 2 LOC614209 __SEG__ Chr14 {Bos taurus} MSNTLAKIAEIEAEMARTQKNKATAHHLGLLKAHLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTMTTVPGVIRYKC
AKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILSEYKIHNADVT
LRSDTTADDLIDVVEGNRVYIPCICVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYMSPVVLPYSRTTVEDFCMKIHKNLI
KEFKYALVWGLSVKHSPQKVGKDHTLEDEDVIQIVKK*
835 >lcl|XP_871238.1|Plus12018889..2019860 NW_001492801 Olfr736 protein-like LOC614591 __SEG__ Chr10 {Bos taurus} MRTLETNTSGSVSVFILLGFPCRREIQILLFVLFSIIYFLILMGNAAIICAVWSSWKLHTPMYILLANFSFLEICYVSSDVPKMLANIISQTKSISYAGCLLQFYFFFSM
CAAESLFLSVMSFDRFLAICRPLHYPIIMTHRLCVLLVVFCWVGGFLWLLTPLILIPQVPFCGPNTVDHFLCDLAPLLALSCAPVSGIRLICGIVSSLIIFLTLLYILGT
YFYVLSVVLQMSSGSGRQKAFSTCASHLAVISLFYGSVMVMYVSPGSGEYPGIQKFVTLFYALATPFFNPLIYNFRNKDMEEALQKILSVLLKEIFKGSKSRI*
836 >lcl|XP_871457.1|Plus1875579..876523 NW_001495357 olfactory receptor OR1-33-like LOC614762 __SEG__ Chr7 {Bos taurus} MEKANESSLIGFVLLGFSDHPRLEAVLFVFVLLFYLLTLVGNITIIIISYLDPPLHTPMYFFLGNLSFLDICFTTSLAPQTLVNLRGPEKTITYGGCVVQLCISLALGST
ECILLVVMALDRYVAVCKPLHYVVIMNPRLCQQLAFISWLSGLASSLIHATFTLQLPFCGNHRLDHFICEVPALLKLACVDTTINELVLFVVSILFLLIPPALILISYGF
ITQAVLRLKSVEARRKAFSTCSSHLTVVIIFYGTIIYMYLQPINSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDVKDALKKLLTGKLCFLQT*
837 >lcl|XP_871621.4|Plus136025..36984 NW_001502744 olfactory receptor, family 1, subfamily F, member 1-like LOC614886 __SEG__ Chr25 {Bos taurus} MGEANQSRVSEFLLLGLSRQPQQQQQLLFLLFLTMYLATVLGNLLILLAISMDSRLHIPMYFFLCNLSFVDICFSSTTVPKVLANHILGRQTISFSGCLTQMYFVFMFVD
MDNFLLAVMAYDRFVAVCHPLHYSAKMTPQLCVLLVTGSWIIANLNVLLHTLLMARLSFCADNAIPHFFCDVTPLLKLSCSDTHLNEVVILTEGALIMITPFVCILASYV
RITCAVLRIPSTKGRWKAFSTCGSHLAVVSLFYGTIIAVYFNPLSSHSSEKDTVATVMYTVVTPTLNPFIYSLRNRNLKRALGKVVGRKMFSVSGENQN*
838 >lcl|XP_871633.3|Plus1complement(62477..63427) NW_001495357 olfactory receptor Olr1654-like LOC614895 __SEG__ Chr7 {Bos taurus} MAFLGNQTLISHFILLGLFTHSPLHLLLFSIIMAMFLVALSGNGLMILLINTDSRLHSPMYFFLSWLSLMDLMLISTIVPRMAIDYLLGHGSISFTGCGLQILFFLTLLG
DECFLLAFMAYDRYVAISNPLRYSVVMSRHVCWLMVAGSWLFGLVDGLIQAIFTLRFPYCGSQEIDHFFCEVPAVLKLACADTSLYETMIYVCCVLMLLLPFSVISASYL
RILITVLHMRSAEGRQKAFATCSSHMAAVSLFYGAAMITYMRPQAYHSSKQDKAVSAFYTMITPMLNPLIYSLRNKEVAGALKKLLGRCSCGVGQN*
839 >lcl|XP_871675.4|Plus1complement(83656..84606) NW_001495357 olfactory receptor 1395-like LOC614931 __SEG__ Chr7 {Bos taurus} MALMKNQTHISHFILLGLFNHTPLHLLLFSIIMVMFLVALSGNGLMILLINTDSRLHSPIYFFLSWLSLMDLTLISTSVPRMAIDYLLGHGSISFTGCGLQILFFLTLLG
DECFLLAFMAYDRYVAISNPLRYSVVMSRHVCWLMVAGSWLFGLVDGLFQAIYTLSFPYCGSQEIDHFFCDIPAVLKLACADTSIYEALIYVCCILMLLLPFSVISVSYL
LIFVTVLRMHSAEGRKKAFATCSSHMAVVSLFYGAALITYMRPQTYHSSKQDKVVSAFYTMITPMLNPLIYSLRNKEVAGALKKFLGRCLCGGRQE*
840 >lcl|XP_871791.2|Plus1complement(104295..105272) NW_001492803 olfactory receptor 49-like LOC615014 __SEG__ Chr10 {Bos taurus} MQHTADWAFPAEARGATGNHTTVTEFILLGLSEACELQMLLFLGLLLTYLLTLLGNLLIVVLTLMDRRLHTPMYYFLRNFAVLEIWFTSVIFPKMLTNILTGNRTISLEG
CFLQCFLYFFLGTTEFFLLAVMSFDRYVAICNPLRYVTIMSKRVCVQLVLSSWVTGFFIIIIPTFLTFQQPFCGPNIIDHFFCDSFPLLELVCADTSLIELLGFILANVS
LLGTLSVTATCYGHILHTILHLPAAKERWKAFSTCSSHITVVSLFYGSCIFMYVRSGKSSQGEDRNKVVALLNTVVTPVFNPFIYTLRNKPVKQVFYKQINKLLS*
841 >lcl|XP_871829.2|Plus1complement(163608..164534) NW_001492803 olfactory receptor 49-like LOC615040 __SEG__ Chr10 {Bos taurus} MGNHTTVTEFILLGLSEACELQMLLFLGLLLTYLLTLLGNLLIVVLTLMDRRLHTPMYYFLHNFAVLEIWFTSVIFPKMLTNILTGNRTISLASCFLQLFLYFFLGTTEF
FLLAVMSFDRYVAICNPLHYVTIMSKRVCVQLALFSWIMGFLLIAIPCSIIFQQPFCGPNIIDHFFCDSFPLLELVCADTSLIELLGFILANVSLLGTLSVTATCYGHIL
HTILRLPAAKERWKAFSTCSSHITVVSLFYGSCIFMYVRSGKSSQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQVNKLF*
842 >lcl|XP_872138.3|Plus1complement(6685144..6686070) NW_003101170 olfactory receptor, family 6, subfamily C, member 4-like LOC615284 __SEG__ Chr5 {Bos taurus} MKNRTFTEFILLGLTNQPEVQALIFIFLFLTYMLSVLGNLTIIILTLVDSHLQTPMYFFLRNFSFLEVSFTSIFIPRFLTSMTTGNKAISFVGCLIQYFFAIFLGATEFY
LLASMSYDRYVAICKPLHYLTVMNSRVCIQLVFCSWLGGFLAIFPPIILMSQVDFCASNVLNHYYCDYGPLLELACSDTSLLELMVISLAVLTLVVTLVLVTLSYTYIIR
TILRIPSAQQRAKAFSTCSSHMIVISLSYGSCMFMYINPSAKEEGAFNKGIAVLITSITPLLNPFIYTLRNQQVKQAFKDTIKKIVKL*
843 >lcl|XP_872414.1|Plus13281827..3284958 NW_001493344 recombination activating gene 1 RAG1 __SEG__ Chr15 {Bos taurus} MAVSLPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKAPENAQAEKQDSSEGKPSLEQSPAALDKVGGPKPALTQPVLKPHPKFQKKSHDDGKARDKAIHQANLRHL
CRICGNSLKADQHHRRYPVHGPVDGKTQVLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCWSFMHRKFSSAPREVYSSRNATMEWHPHTPSCDICDAARRG
LKRKSQPPNSQLSKRLRTVIDRARQARRCKRRTQDRISSKELMKKTTNCSKIHLSTRLLAVDFPAHFVKSISCQICEHILADPVETNCKHVFCRICILRCLKVLGSYCPS
CQYPCFPTDLESPVKSFLSILNSLMVKCPAEECDEEVSLEKYNHHVSSHKESKETFVHINKGGRPRQHLLSLTRRAQKHRLRELKMQVKAFADKEEGGDVKSVCLTLFLL
ALRARNEHRQADELEAIMKGRGSGLQPAVCLAIRVNTFLSCSQYHKMYRTVKAITGRQIFQPLHSLRSAEKVLLPGYHPFEWQPPLKNVSSSTDVGIIDGLSGLASSVDD
YPVDTIAKRFRYDAALVSALMDMEEDILEGMRARELDDYLNGPFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTVMKISVAHGSQNVKVFEEAKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKSSELMLEMGGILRTFKFIFRGTGYDEKLVREVEGLEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHE
TVEELRDRVKGVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHLRKKMNLKPIMRMNGNFARKLMTKETVEAVCELIPSQERHE
ALKELMDLYLKMKPVWRSSCPAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKYYEMEDV
LKHHWLYTSKYLQKFMNAHNALKDSGFTLNSQGGLGDLLDLEESPESQDSMEF*
844 >lcl|XP_872754.1|Plus1complement(1966273..1967244) NW_001492801 olfactory receptor, family 11, subfamily H, member 6-like LOC615767 __SEG__ Chr10 {Bos taurus} MNVSRVNTVTEFILLSFPCSREVQVLLFVLFSVSYILTLMGNGAIVFAVKLDHRLHTPMYTLLANFSFLEMCYINTTVPNMLRNFLSETKTISFTACFLQFYFFFSMGIT
ETFLLPLMAFDRYLAICRPLHYPTIMSSRLCMNLVGLCWVTAFLCYPVPIYFITQLPFCGPNTIDHFVCDPGPLLALSCIPAPGIELSCSILSSLIIFITFFFILWSYTL
VLRAVLRVPSADGRRKAFSTCGSHLAVVSLFYGTIMMMYINPTSGNPAGIHKIVTLLYSAVTPLVNPLIYSLRNKDMNTALRKIQMFTKTGQSKQELMSGPRS*
845 >lcl|XP_872808.3|Plus157816..58757 NW_001493371 olfactory receptor, family 5, subfamily I, member 1-like LOC615808 __SEG__ Chr15 {Bos taurus} MAENGTLVTEFVLLGFQLSAELQTGLFFVFLLLYLITLGGNLGVTALIQSDPRFQTPMYFFLGHLSFLDICYSSVIVPQLLETLRTGKRTITFERCATQFFFFTLCASAE
CFLLAVMAYDRCVAVCNALLYASAMTPQTRLGLVAGAYGGAAVNSVVRTGCAFSLSFCKSNHVDFFFCDLPPLLKLACSETRPRERVIYLLAFLVIATSVSVILISYLFI
IRAILKIRSAGGKAKTFSTCASHITAVALFFGTLIFIYLKGNMGKSLGEDKIVSVFYTVVIPMLNPLIYSLRNKEVKEALKRALSRMKVSQAE*
846 >lcl|XP_872810.3|Plus1complement(33331..34266) NW_001493368 olfactory receptor 1018-like LOC615810 __SEG__ Chr15 {Bos taurus} MNMITTNFTVTEFVFLGLSSQPKMQLILFIMFLFFYLLTVVGNIIIITVIQIETRLQTPMYFFLTNLSFLDICYTSTDVPQMLSNMMGRKKTIPFPRCATQMYFSLSLGM
TECVLLGVMAYDRYVAICHPLHYTVIMNQRTCVQLAGISWASSFLSSTVINIFTLSLPYCGPNVLDHFFCEVPSILRLACTDTSFTEMVVFIFTIIIVFIPFLLIVVSYA
RILLTVLRMRSASGRHKALSTCGSHLTVVALFYGTGIFMYMRPQSKTSRAGGKIIAVFYTVITPMLNPLIYSLRNQDVKGALRRALEKQRT*
847 >lcl|XP_872824.3|Plus1177132..178064 NW_001502164 hypothetical protein LOC615824 __SEG__ Chr15 {Bos taurus} MANGNFTQVIEFILIGVSERPDLQIPLFFVFLVIYGLTVTGNLSIITLTSVDSQLQTPMYFFLRHLAMINLGNSTVIAPKMLINFLVKKHTTSFYECAIQLGGFLVFIVA
EIFMLAVMAYDHYVAICNPLLYMVVVSRRVCFLLVSLTYLYSFSTSIVTSFSVFSMAYCSFNVINHFYCDIVPLLALSCSNTSFPETVVFISASTNLMFSITVVVTSYFN
IILSILRICSSEGRKRAFSTCASHMTAVSVFYGTLLFMYLQPRNNHSLETDKMASVFYTLVIPMLNPMIYSLRNKDMKAALKRFLTNSCC*
848 >lcl|XP_872851.3|Plus1478266..479411 NW_001501761 hCG2044651-like LOC615841 __SEG__ Chr7 {Bos taurus} MGAKKEVTILAINKDMLTTENLEIFQKYCGVYSSMKTLFMGCLNPMYEHLSGCLYICFAYLTLFFFKRCPINMEPQNLTCVSEFLLLGLSDDPELQLLLFGLFLSMYLVT
MLGNLLIILAFISDSHLHTPMYFFLSNLSLTDISISTTTVPKMLVNLQMHSKSITYAGCLAQVSFFSLFACLESLLLTVMAYDRLVAICHPLYYLVIMNPRTCGLLVLAS
FFTSFLTSQLHYLMMSQLTFCADTEIPHFFCDLSQLLKLACSDISINNILILFIGTIFGGVPLSGVLYSYYRITSSILRVSSSGGNYKAFSTCGSHLAIVCLFYGTGLGV
YLSSAVSSSPRKGAVASVMYAVVTPMLNPIIYSLRNKDIKSALWRITHRIA*
849 >lcl|XP_872866.3|Plus1complement(19699..20637) NW_001504284 olfactory receptor 71-like LOC615852 __SEG__ Chr8 {Bos taurus} MEPVNSTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTGIVAVSVLDARLHTPMYFFLGNLSILDICYTSTFVPLMLVHLLSAQKTISFLGCALQMCLGLSTGST
ECLLLTIMAYDRYLAICRPLRYPVLMSHRLCWLLAGAAWVFCLFMSVTETVIAMRLPFCGHRVVSHFGCEILAVLKLACGDTSISEVFLLVGAILLLPVPLAFICLSYTL
ILATTLRVPSAAGRRKAFSTCSAHLAVVMLYYGTVIFMYMKPKSKEARISDEVFTVLYAVVTPMLNPVIYSLRNKEVKEAARKVWGRIQTSR*
850 >lcl|XP_872867.2|Plus1complement(514320..515279) NW_001494547 MAS proto-oncogene-like MRGPRD __SEG__ Chr29 {Bos taurus} MNHTLLQAPALVENSVEVEELSTAYWVLSAMVLFTCLGGFVGNGLVVWLLGSQGQRSPFSVYILHLGVADLLFLLCMASKVILICFQLVNRIHMALDIVSRMKYFTYTAS
LSLLTVISMQRCLSVLFPVWYKCHQPKHLSAVVCALLWVLSLLLNTVAMFLCSDFLARDELLCFRIDLVISILLMGVFTPLMAGSSLILCVGVQRSSTATHRRPTRVYVT
VLVCILVFLAFALPLGICWFLISWLDLPQKTKTVFSLLARLFSAISSSANPVIYFLVGRRKSRGLREPLGAVLRRALREEPELEGRETPTSTTATDPGF*
851 >lcl|XP_872893.3|Plus1complement(450431..452521) NW_001493065 slit homolog 1 protein-like SLITRK1 __SEG__ Chr12 {Bos taurus} MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKR
LHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKHRVDSSLPAPPAQEETFPPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIGTGSA
RNKPPANGLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSR
EKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSE
VLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD*
852 >lcl|XP_872923.3|Plus1complement(2580587..2581531) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC615901 __SEG__ Chr19 {Bos taurus} MTGRNQTTISEFLLLGLPIKSEHQNLFYTLFLAMYVTTVLGNLLILVLICLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQDLSIPYAGCLTQMYFFLFFGDL
EDFLLVAMAYDRYVAICFPLHYTTIMSPRLCLFLVVLPWVLTTFHAMLHTLLMARLHFCEDNVIPHFFCDLSALLKLSCSDTRVNELVIFFVGGLIIVIPFLLIIMSYAQ
IVSSILKVPSAKGICKAFSTCGSHLTVVCLFYGTIIGLYLCPSANNSIVKETVMSMMYTVVAPMLNPFIYSLRNRDMKGALRRVICRKKIHFSL*
853 >lcl|XP_872924.3|Plus1817503..818441 NW_001494173 olfactory receptor Olr1654-like LOC615902 __SEG__ Chr23 {Bos taurus} MEQKNESSFTGFILLGFSDRLQLELILFVVLLIFYIFTLLGNTTIIALSYLDACLHTPMYFFLSNVSFLDMCYTTSIVPQFLFNLSGADKSISFGGCVVQMYISLALGCT
ECILLGVMAFDRYAAVCRPLHYTVIMHPRLCALMASASWVTGFANSLLQTALVFLLPRCGRNKLAHFFCEIPPFLKLVCVDTTMNVYASFFASVIILLTPVALIVFSYGR
IVRAVLRIKSAAGQRKAFGTCGSHLTVVSLFFGTAIYVYYQPSSKNSQDQDKFMSLFYTVIIPMTNPLIYTLRNRDVKGAMKKLLWKDSDSR*
854 >lcl|XP_873029.1|Plus143766..44713 NW_001493372 olfactory receptor, family 5, subfamily I, member 1-like LOC615987 __SEG__ Chr15 {Bos taurus} MSTSRAWNGSSVTMFILLGFADHPQLQALLFVTFLGIYLVTLAWNLALIFLIRGDTRLHTPMYFFLGNLSFVDICYSSAVAPKMLSDFFRERKSISFLGCAVQFFFFVGA
GLTECFLLTAMAYDRYAAVSSPLLYSAVMSQGLCTRLVVGAYVSGFLSSLVQSSSIFRLPFCGPNLIDHFFCDLPPVLALSCSNTFSSQVVNFLVVAVVGGTSFLILLVS
YGHIVATVLKIRSVEGRRKAFHTCASHLMVVTLLFGTALFMYLRPSSSYSFGRDKVVSVFYSLVIPMLNPLIYSLRNKEIKDALWKMLGKKKVFS*
855 >lcl|XP_873039.2|Plus155248..56192 NW_001493372 olfactory receptor 1264-like LOC615998 __SEG__ Chr15 {Bos taurus} MGQSNHTNVREFVFLELTHFRELELFLFVIFLAVYVTTVLGNALVVVTITWESHLHTPMYFLLRNKSILDIVFSSVTVPKFLVDLLSERKAISYNGCMAQIFFFHFAGGA
DIFFLSVMAWDRYLAISKPLHYVTIMRREVWVGLVVASWVGGALHSTVQIILMLPLPFCGPSTLDAFYCDVPQVVRLACTDTFALELLLISNNGLVTLLWFLLLLGSYTV
TLVTLRSHAGEGRSRAVSTCTSHVLVVTLHFVPCVYIYCRPFIMLPVDTAVSINNTVITPMLNPVIYTLRNQEMKAAMKRLQRRLGPFESNKLR*
856 >lcl|XP_873333.1|Plus1complement(777774..778712) NW_001493314 olfactory receptor 670 (predicted)-like LOC616261 __SEG__ Chr15 {Bos taurus} MFPSNATDFHPSSFLLLGVPGLEEMHVWIGFPFCSVYLIALVGNNIILFVIKNTQSLHQPMFYFLAMLACIDLGLSTSTIPKMLGIFWFNLKEISFGGCVTQMFFIHIFT
AMETVVLVAMAFDRYVAICNPLRYSLILTNRTIGFILIVVFGVNFILVIPLVFLILRLPFCGHHIIPHTYCEHMGIARLACANIKVNMIFGLILISMVLVDVVLIVISYM
RILQAVFSLPSREARRKALNTCGSHICVILVFFTPAFFSFMTHRFGRNVPIYIHILLANLYVVVPPALNPVIYGVRTKQIQERVSSIFLRKG*
857 >lcl|XP_873346.2|Plus1516407..517351 NW_001493322 olfactory receptor 711-like LOC616273 __SEG__ Chr15 {Bos taurus} MLGRNITLVSQFILVGFPTAPWLQVLLFSLFLVVYLLVVVENLAIMLTVWVTGSLHKPMYYFLGSLSFLEVWYVSVTVPKMLDGFLLQRRCISFIGCMTQLYFFISLACT
ECVLLAAMACDRYVAICHPLRYPVIMTTGHCVQLVAFSYMSGFMVSVFKVYFISHVTFCGSNVMNHFFCDISPILKLACKDMSTAELVDFALAVVILVFPLATTILSYVY
IVSAILRIPSTQGRKKAFSTCASHLTVVIIYYTAMIFMYVRPRAIASFNSNKLISAVYAVLTPMLNPFIYCLRNQEVKNAIKKTVGVGQCFLLS*
858 >lcl|XP_873522.4|Plus1complement(<1948..2883) NW_001501890 cOR8U2 olfactory receptor family 8 subfamily U-like LOC508286 __SEG__ Chr15 {Bos taurus} MAQINCTQVKEFILVGLTDQEELKMPLFVLFLSIYLFTVAGNLGLILVIRTDSRLHTPMYFFLSNLAFVDFCYASVVTPKMLGNFLYKQNVISFNSCAAQLGCFLTFMVS
ECLLLTSMAYDRYVAICNPLLYLTSMSRGICIQLRAAPYSYGFLMALFHTIFTFRLSYCHSNTINHFYCDDMPLLRLSCSDTRSKQLWILACAGVTLISSVLIVFISYMF
IISTILRMRSAEGRCKAFSTCSSHMLAVTIFYGTLIFMYLQPISQHSLDTDKMASVFYTVIIPMLNPLIYSLRNKDVKNALKKIITNKNQAS
859 >lcl|XP_873525.2|Plus140809..41444 NW_001503545 regulator of G-protein signaling 2 RGS2 __SEG__ Chr4 {Bos taurus} MQSALFLAVQHECGPMDKGAGTGPKNEEKREKMKRTLLKDWKSRLSYFLQNSSSPGKPKTGKKSKQQTFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENI
EFWLACEDFKKTKSPQKLSSKAKKIYTDFIEKEAPKEINIDFQTKSLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT*
860 >lcl|XP_873697.3|Plus1172685..173641 NW_001502065 olfactory receptor 78-like LOC616558 __SEG__ Chr15 {Bos taurus} MSPPNDTQFHPSFFLLLGIPGLETLHIWIGFPFCAVYLTALIGNFTILFVIQAESSLHQPMFYFLAMLATIDLGLSTATIPKMLGIFWFCLKEILFEACLSQMFFIHSFT
LMESAVLLAMAYDRYVAICNPLQYSSILTNRVVSEIGLAVLGRAFIFVIPFVFLILRLPFCGSYVIPHTYCEHMGLARLSCASIKINIIYGLCAICNLVFDIIAIALSYV
QILRAVFRLPSHEARLKSLSTCGSHVFVILAFYTPALFSFMTHRFGQNVPRYIHILLANLYVIVPPVLNPVIYGVRTKQIYDHVKKILKLKQRKKNDI*
861 >lcl|XP_873795.1|Plus1153261..154313 NW_001494524 olfactory receptor-like LOC616631 __SEG__ Chr29 {Bos taurus} MIVFPFMNLLVASCGFWCCGSLTYCHFPSFQDKNLTFTEIRNHTLVKEFILLGIPRTQGQEVVLFVVFFIFYACTLLGNLLILLAVVSDSRLHTPMYFFLCNLSVLDIGF
SSVSTPKMLANLLVKSRVISLDGCMSQVFFYHFLGCTESLLYTVMVYDRFAAICHPLRYAIIMNRRACALLVAGTWAISSFHATSLTTLTFQLPYCGSNEIDYFFCDIFP
VVKLACSNTLVIETVSFTNIGLIPMICFLLIVCSYLRIITAVLKMRSAEGRHKAASTCASHLSVVTLFFGPCALVYTQPSLSEVLVTPVQIFASVITPMLNPTIYTLRNK
DVKGALKKLVGGQMVSEGGH*
862 >lcl|XP_873821.2|Plus11433829..1434770 NW_001495357 olfactory receptor Olr1455-like LOC616651 __SEG__ Chr7 {Bos taurus} MENASDTTGINFILLGLFDYTQTHLFLFAMVLMAFLTSLMGNTFMIMLIQVDPQLHTPMYFLLSQLSLMDMMLVLTIVPKMAANYLMHNRSISPAGCGTQIFLFLTLGGG
ECFLLAAMAYDRYVAICHPLRYPILMNQKLCLQMTAGSWLLGGVDGLMQAGATLSFPYCHSREVNHFFCEAPSLVHLACADTMIYEFFMYVCCVLMLLIPLSLILTSYSL
ILAAVLHMQSTAARKKAFATCSSHLAVVGLFYGTLMFIYMRPKSYHSGAHDKVVSAFYTIFTPVLNPLIYSVRNKDVKGALRKWLVKHFRWSQ*
863 >lcl|XP_873830.1|Plus1887987..888925 NW_001494173 olfactory receptor Olr1654-like LOC616658 __SEG__ Chr23 {Bos taurus} MGQKNESSFAGFILLGFSDRLQLEPVLFVVLLIFYVFTLLGNTTIIALSYLDACLHTPMYFFLSNLSFLDMCYTTSIVPQLLFNLSGEDKSISFGGCVVQMFISLTLGGT
ECILLGVMAFDRYAAVCRPLHYTVIMHPRLCALMASASWVTGFANSLLQTVLVFLLPRCGRNKLAHFFCEVPSFLKLACVDTTMNVYVTFFGSVIMLLTPISLIMFSYGQ
IVRVVLRIKSAAGQRKAFVTCGSHLTVVSLFFGTAIYVYTQPSSSDSQDQDKFMSLFYTVIIPMTNPLIYTLRNRDVNGAIKKVLWKDSDSR*
864 >lcl|XP_873905.2|Plus11719761..1720699 NW_001495357 Olfactory receptor, family 2, subfamily L, member 8-like LOC616716 __SEG__ Chr7 {Bos taurus} MGNYNQTSTDFILLGLFPSSRTGLFLFILIGFIFLMALVGNLSMILLIFLDIRLHKPMYFLLSQLSLMDLNYISTTVPKMAYDFLFANKSISIIGCGIQSFFFLTMACAE
GLLLASMAYDRYVAICFPLHYPIRISRKVCILMITGSWIMGSINSCAHTTYILSIPYCQSRSINHFFCDVTVMLTIACIDTTVYEYTVFLSTTLFLLLPFIGIAFSYGRV
LLAVYCMNSAEGKKKAYSTCSTHLTVVSFYYAPFVYTYLRPRFLRTPTEDKVLAVFYIILTPMLNPIIYSLRNKEVIGALRRVTQRISPMKM*
865 >lcl|XP_873997.2|Plus11879000..1879950 NW_001495357 olfactory receptor Olr1654-like LOC539568 __SEG__ Chr7 {Bos taurus} MVWRNQTFNLDFILLGIFDYRPTHIFLFSLVLGIFTVAFMGNTLMVLLIYLDTQLHTPMYLLLSQLSLMDLMLISTTVPKMAFNYLSGRKSISLAGCGIQIFFYVSLLGA
ECFLLAVMAYDRYVAICHPLRYTILMNQKCCVFMTVASWILGFLDGIIVLVAAFSFPYCSSLEIHHFFCDVAALLPLSCADTSAFENLLFICCVVMLVFPVSVIIGSYSR
VLQAVISMDSKESRRKAFTICSSHLSVVGLYYGAAMFMYMRPASNHTPDQDKVVSAFYTILTPMLNPLIYSLRNKEVSKGFQKLLRKRKINCIQHL*
866 >lcl|XP_874177.3|Plus12024327..2025427 NW_001495357 hypothetical protein LOC616938 __SEG__ Chr7 {Bos taurus} MKKNMLNVFFQLLEIYFLTINLYTVLIPCKHHGFILKILGHTSALMGSMEEYNTSSTDFTFMGLFNRKETSGLLFAIISIIFFTALMANGVMIFLIRTDSHLHTPMYFLL
SHLSFIDMMYISTIVPKMLVDYLLDQRTITFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPLRYPILMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSRE
INHFFCEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVIASYAQILTTVHRMSSVEGRKKAFATCSSHMTVVTLFYGAAMYTYMLPHSYHRPEQDKVFSVFYTILTP
MLNPLIYSLRNKDVTGAMKRVLDRFKRTQRVSGDAF*
867 >lcl|XP_874210.3|Plus1202054..203025 NW_001501775 olfactory receptor, family 7, subfamily A, member 17-like LOC616964 __SEG__ Chr7 {Bos taurus} MESRNKTQISEFLLLGLSEEPALQPLIFGLFLFMYLITVIGNLLIILAISSDPHLHTPMYFFLSNLSFVDICFTSTTIPKMLWNIQTQSKGITYEGCFVQVYFYLLFAAL
DDFPLTMMAYDQYVAICHPLHYTVIMNPRLCGLLVLVSWIVSALFPLLHSLTVLQLSFCSDLEIHHFFCEITWLIRLACSDPFLNNMVVYFGSVILRGVPLASILYSYTK
IVFSICGISSAQKQYKAFSTCASHLSVVSLFYCSALGVYLSFTTTHSSHMSAIVSVMYTVVTPMLNPFIYSLRNKDIKRALKRFVGMEMFVKELFALGLKNCP*
868 >lcl|XP_874276.3|Plus1760001..760930 NW_001494525 olfactory receptor, family 8, subfamily A, member 1-like LOC617011 __SEG__ Chr29 {Bos taurus} MVTENHSTVTEFILQGLTERPELQLPLLFLFLGIYLVTMIGNLGMITLICLNAQLHTPMYYFLSNLSFVDLCYSSVITPKMLVNFVSGKNIISYAGCMAQLYFFLVFVIA
ECYMLTVMAYDRYVAICRPLFYNIIMSHRVCSLLMVGVYAMGFIGSTIETGLMLKQSYCEGLISYYFCEILPMMKLTCSSTYHVEMTVFLLAGFNIIVTSLTVLISYAFI
LSSILHISTTGGRAKAFSTCSSHLAAVGMFYGTTAFMYLKPSTASSLAQENVASVFYTTVIPMLNPLIYSLRNKEVKAAMQKTLRGKQF*
869 >lcl|XP_874337.3|Plus1complement(460359..461291) NW_001501922 olfactory receptor 491-like LOC617062 __SEG__ Chr15 {Bos taurus} MEAGNHTSVTEFILLGLTEDPTLRVLFFVVFLGIYVVTLIGNISIITLIRSFSHLHTPMYLFLSHLAFVDIGYSTSVTPIMLIGFLRHRLPLLVAGCEAQLCSVVMFGTA
ECFLLAAMAYDRYVAICLPLLYSTHMSPRVCVDLVGVSYLGGCVNACTFASCLLTLSFCGPNQIDHFFCDFSPLLKLSCSDVSIIEIIPSISSGSIIAVTVSVIALSYIC
ILNTILKMHSTEGRHKAFSTCTSHLTAVTLYYGTITFVYVMPKSSYSTEQNRVVSVFYTVVIPMLNPLIYSLRNRDVKEALRKASVRIYS*
870 >lcl|XP_874406.3|Plus1complement(2488913..>2489896) NW_001493662 Olfactory receptor 3A2-like LOC617122 __SEG__ Chr19 {Bos taurus} NFYSCDISLQRLMQPEARTNRTAVTEFILLGLVETDNLQPMVFVLFLFAYLVTVGGNLSILAAILVEPKLHTSMYFFLGNLSLLDIGCITVTVPAMLGHPLSHKRTVPYA
GCLSQLFFFHLLAGMDCFLLTAMAYDRFLAICRPLTYSTRMSQTVQRILVVVPWACAFTNALTHTIALTTLNFCGPCEVNHFYCDLPQLFQLSCSSNLLNELLLFGMSFI
MVGTTAVLIISSYIHVAAAVVRLRSAEGRKKAFSTCGSHLTVVCLFYGTGMFNYMRLGSEEASDKDKGVGVFNTIINPMLNPLIYSLRNPDVQGALWRVLVERQSLT*
871 >lcl|XP_874623.2|Plus1complement(353492..354445) NW_001493322 olfactory receptor, family 10, subfamily A, member 5-like LOC617297 __SEG__ Chr15 {Bos taurus} MAEGNWTRVNEFILMSFSSLPTEIQSLLFLTFLFIYLVTLLGNSLIILVTLADPMLHSPMYFFLRNLSFLEIGFNLAIVPKMLGTLIAQDTTISFLGCATQMYFFFFFGV
SECSLLATMAYDRYVAICSPLHYPVIMNPRTRAKLAAVSWFPGIPVATVQTTWLFSFPFCGSNNVNHFFCDSPPVLRLVCADTALFEIYAIIGTILFVMIPCLLILCSYT
CIAAAILNIPSAKGKRKAFSTCSSHLLVVSLFYVSLSLVYFRPKSNNSPESKKVLSLSYTVVTPMLNPIIYSLRNNEVKNALTRTFHKALGLRNCIL*
872 >lcl|XP_874663.2|Plus1complement(98729..99799) NW_001492989 OR1J4 protein-like LOC617333 __SEG__ Chr11 {Bos taurus} MCFFHCPFIPSRQEKSINRENHSSMSEFLLLGLPIQPEHQSMFFALFLGMYLTTVLGNVLILLLIRLDPHLHSPMYFFLSHLALTDVSFSSVIIPKMLVNMQTQDQSIPY
PGCVTQMYFFLFFTNLDDFLLTSMAYDRYVAICHPLHYTTIMGQGLCTLLVTASWILSCASALCHTLLLTRLSFCADLSIPHFFCDLGALLKLSCSDTSFNELAIFTAGV
AVIVLPLVCILISYGRIGATILKVPSTKGICKALSTCGSHLSVVSLYYGTIIGLYIFPSSSTSRDKITVVSVMYTVVTLLLNPFIHNLRNRDMKEALERLSHRAKVLFWC
LLIFVTATCVHTNPRSYIATFEPGKK*
873 >lcl|XP_874719.2|Plus1complement(50570..51559) NW_001502138 olfactory receptor MOR38-1-like LOC617378 __SEG__ Chr15 {Bos taurus} MSHWEVSKLPLSTTTSFYYAIFNRSNFMTFTLMGIPGLEAQHLWLSLPFFSMFLAILISNGAILFMLAREPTLHTPMYLLLALLMVADLISTLALLPKLLCLFWFNDRDI
AVNACFTQMFFIHGTSVVRSALLVAMAFDRFVAVCEPLRYNTVLSHSLVGRLGLMALAKGVILILPMPLLLQRLTFCHKVIPHTYCDHMAVVKLACDDTRPNQIYGLFVI
LLVVGLDLVLIGFSYGLILQAVIRLNSQDAIYKALNTCSAHLFVILITYVPALFSSLTHRLGHNIPPHAHILLANLYLLIPSMFNPIIYGMKTKDIQVKVAKCLCRRHS*
874 >lcl|XP_874762.3|Plus1266652..267605 NW_001493327 olfactory receptor 78-like LOC617417 __SEG__ Chr15 {Bos taurus} MFLSNNACLVPTSFWLTGIPGLESLHIWLSIPFSSMYLVAVVGNVTILAVIKLEHSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFDAHHIDLDACLAQMFFIHCFA
TVESGIFLAMAFDRYVAICNPLRHTSVLTHTAVKHLGLAALLRGVLYIGPLPIMIRLRLPLYRTQIITHSYCEHMAVVTLACGDTTVNNLYGMGIGFLVLILDSLAITAS
YAMIFRTVMGLATPEARLKTLGTCSSHICAILVFYIPIAVSSLTHRFGHHVPPHIHILLANFYLLIPPILNPVVYAVRTKQIRERLLHILKTGAQSK*
875 >lcl|XP_874873.2|Plus198586..99530 NW_001501889 hypothetical protein LOC617507 __SEG__ Chr15 {Bos taurus} MENKTGVTEFVLLGLASAPGLQVPLFIVFTLIYLFSVVGNLGMVVLILMDSRLHIPMYLFLSNLSLADFCYSIAVTPKVMAELLMGDQVTFYNACAAQMFFFVALATVEN
FLLPSMAYDHYAAVCKPLLYTTAMTTRVRAGLAAGPHIYGFLSASVHSRDTFSLSFCRSNLLHHFFCDVPAVVALSCSDRHVSELVLVFVASFNIFFALLVILISYLFIF
VTILKMHSAEGYQKALSTCASHLTTVSIFYGIAIFMYSQPSSSHSMDTHKIASVFYTMVIPMLNPLVYSLRNKEVKSAFKKAVEKANLSLGFTF*
876 >lcl|XP_874946.4|Plus1complement(340985..341932) NW_001493322 olfactory receptor 159-like LOC617571 __SEG__ Chr15 {Bos taurus} MMQGNWTVVNEFVLVSFSSLSSQLQALLFLLFLTIYLVTLMGNVLIILVTTADSALQSPMYFFLRNLSFLEIGFNLVIVPKMLGTLIIQDTTISFLGCATQMYFFFFFGA
AECCLLATMAYDRYVAICDPLRYPIIMGRRACGQLAAASWFSGFPVATVQTTWIFSFPFCGPNRVNHFFCDSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYV
RILSTIFGMPSAEGKRKAFSTCSSHLLVVSLFYSTAILTYFRPRSSNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKAALRRAIRRTLGFRKL*
877 >lcl|XP_874972.3|Plus1336571..337509 NW_001493639 olfactory receptor 1348-like LOC617592 __SEG__ Chr18 {Bos taurus} MERSLELGNMTRVQEFILLGLSTSPETREVLFAIFLTLYLLTLLENALIVFLVCSHTELHKPMYFFLGNLSCLEMCYVSVTMPSLLAGLWMGPYHVPFTACMTQLFFFIV
LICTECTLLASMACDRYVAICRPLHYPLLMRPQVCLGLAGTSWLGGLLVSVAKTACIASLSYCGPNVLNHFFCDVSPLLNLSCTHVALTELVDFLSAIVIFCGTLLVSLA
SYSAIGVTVLRMPSAAARHKAFSTCASHLVVVGIFYLAALFIYCRPSRIRSMDLNKLLSVVYTVATPMCNPVIYCLRNREVHAALLRTLRWT*
878 >lcl|XP_875040.3|Plus1complement(653490..654437) NW_003101172 olfactory receptor 599 (predicted)-like LOC519071 __SEG__ Chr15 {Bos taurus} MGSTNMSYLNPKTVILIGIPGLEHVQFWIGFPFFSVCLVALLGNIVLIIIIATERSLHQPMYILLAVLAATDLGLCVAIAPKMLAIFWFGSYSMAFDACLTQLFFIHALQ
GMESGILLAMAFDRYIAICDPLRHASILTPLFLVQMVLMVAIRTTVLVGILPILLKRLQIFQSVVIDHSYCEHMAVVKLAVEDAHINRSYGLFVAFAILGFDLIFVFISY
ILIFRAVSHLPQKEARLKAFNTCTSHIIIFLEFYILAFFSFFSHRFGHVSPYTHIFLSTIYLLVPPALNPIVYGVKTMEIRKRVAQICIMKHDSR*
879 >lcl|XP_875064.2|Plus11355191..1355733 NW_001494130 glycoprotein IX (platelet)-like GP9 __SEG__ Chr22 {Bos taurus} MPAWVALLLFWAAAEASEDCPAACACRALDTMGLQVDCRGRGLEVLPALPAPTRELLLTNNSLQSVPPGAFDHLPQLQALDLAHNPWRCDCGLVYLRLWLEDRAPEQLLR
LRCAGPAHAADRTPAQLSGSELGGCGWTLRESWAGPGSWWDAALVVVAALGLALLVSLLCTIPVPRASPR*
880 >lcl|XP_875303.1|Plus1452894..453895 NW_001494127 XC chemokine receptor 1-like XCR1 __SEG__ Chr22 {Bos taurus} MEPSDIPESTTFYEYDPQSFLCEKRTFVFATVSTTILYCLVFFLSLVGNSLVLWVLVKYESLESLTNVFILNLCLSDLVFSCLLPVWILGYHWGWVLGDLLCKLLNMVFS
ISLYSSISFLTIMTIHRYLSVVSPISSLRVHTLQRRVLVTAAVWAASILSSIPDAIFHKVFPSGCDYSELEGFLASVYQHNVIFLLSVGVILFCYVEILRTLFRSRSKRR
HRTVRLIFTIVAAYFLSWAPYNLILFLQTLLKLGVIQSCEVSQQLDYALLICRNVAFSHCCFNPVLYVFVGVKFRRHLKSLLRRFWLCRQQVPSLPPSPHPPGAFTYEGI
SFY*
881 >lcl|XP_875409.1|Plus1complement(12935..13714) NW_001494429 leucine rich repeat containing 3B LRRC3B __SEG__ Chr27 {Bos taurus} MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKG
VAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMVSNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISY
VVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV*
882 >lcl|XP_875436.3|Plus1complement(32861..>33811) NW_001493327 olfactory receptor 78-like LOC618010 __SEG__ Chr15 {Bos taurus} LIMPSFNQSIFHPTVFFLTGIPGFEIYHAWVFIPFCCLYVIAISGNGMILFVIITESSLHEPMYYFLSMLSFMDLGLCLSTLVTMMGIFWFNVREISFDACIGQMFFIHG
FTLMESSVLLAMAFDRYIAICNPLRYATILTNSTIIKVGFAIVVRVTTVVVPLLLLLKRLSFCGSHVLHHSYCFHPDVMKLSCTDTKINSAFGLAIVISTAALDSVLILL
SYVPIINSVLSIASPEERKKAFGTCVSHISAVAIFYIPMISLSLVHRFGKHAPPLVHTLIANVYLLIPPVMNPIIYSVKTKQIQKAMVKVALSKII*
883 >lcl|XP_875457.2|Plus1574408..575346 NW_001494175 olfactory receptor, family 12, subfamily D, member 3-like LOC618034 __SEG__ Chr23 {Bos taurus} MENITTVNEFLLLELTSTQELQPVLFVTLLIIYMINLFGNGSILVVVILEPRLYSPMYFFLGNLSCLDICYSSVTLLILMANLLSAHKAVSFLGCITQLHFFHFLGCTES
ILLAIMGFDRFVAICYPLRYTLIMNLNVCILLATVAWITSFFYALMHSVMTARLNFCHSLKLNYFFCDVKPLLELACGDIRLNQWLIFIVTGSLSMAACFLTFLSYLYII
SFLLFKNRTCRGLHKALSTCASHFMVVSLFYGTVGLTYIPPASATSVSQGRYVAVIHTTVTSLLNPLIYTLRNKEVKLALKRVFGRKLKLSV*
884 >lcl|XP_875475.1|Plus1complement(630668..631612) NW_001494175 olfactory receptor 124-like LOC618052 __SEG__ Chr23 {Bos taurus} MWVSNQSSLDDFILLGFSDRSWLETPLFVILLVAYIFALFGNISVILVSCLDPQLDSPMYFFVSNLSFLDFCFTTSTVPQMLVNLRGPEKTISYGGCVAQLYISLALGST
ECILLAIMAFDRYAAICKPLRYPIIMNQRRCIHMATGTWISGFANSLVQSTLTVLTPRCGQRVIDHFFCEVPALLKLACTDTHVNEAELNVLGALLLLVPLSLILGIYVF
IAQAVTRIRSAESCWKAFNTCASHLLVVSLFYFTAISMYVQPPSSYSRDRGKIMALFYGIVTPTLNPFIYTLRNKDVKAALRRALTKEFWARTR*
885 >lcl|XP_875487.2|Plus1687076..688008 NW_001494175 putative olfactory receptor-like protein-like LOC618064 __SEG__ Chr23 {Bos taurus} MKGTNASTLAGFILLGFSDQPHLEMVLLLVVSIIYILTLMGNTAIILVSYFNPKLHTPMYFFLSNLSFLDLCFTTSVVPQMLWNLKGPDKTISYTGCVIQLYVALGLGST
ECVLLTVMAYDRFNAICRPLHYGVIMHPKLLQQLAALAWISGFVGSTVQTILVFQLPLCSHHMVDDFTCEEPALIKIACVNTTFLENELSIASVLYVVIPLGLILVSYGC
IVRSVLKIKSTEGRRKAFGTCGSHLIVVVLFFGTLASIYIQPKSKYTQNYSKFLTLFYTVVTPSLNPLIYTLRNKEAKWALRRLLGRDPS*
886 >lcl|XP_875493.3|Plus1complement(733840..734802) NW_001494175 olfactory receptor 131-like LOC618070 __SEG__ Chr23 {Bos taurus} MRRFNNTLHHSKGFVLVGFSEWPKLEMVVFVAISIFYIMTLLGNSAIIILSRLDPRLHTPMYFFLANLSFLDLCYTTSTVPQMLVNIQSHRRNISYGGCIAQLFIFLGLG
STECVLLSVMAFDRYVAICQPLHYSVIMHSRLCQQLAAVAWVTGFSNSLVQTVLTFLLPRCGQYQVENFFCEVPAMLQLSCVDTWINEVEMYAAVVVIKVIPVGLILFSY
INIVRSVVRIQSSEGRKKAFNTCGSHLLVVVMFYGSAISGYAYMAPKNNSAKLKGKLLALFYGLVTPMLNPLIYTLRNKDVKEAVKKLLGRELEQGWNMA*
887 >lcl|XP_875498.1|Plus1complement(372707..373660) NW_001493327 olfactory receptor 550-like LOC618075 __SEG__ Chr15 {Bos taurus} MFSCNTSTSGHSTFLLTGFPGLEASHHWVSIPINLICVVSILGNSIIFFLVSTDPALHEPMYSFLSMLAASDLGLCASTFPTMVRLFWLGVRELPFDLCAAQMFFIHAFT
YVESGVLLAMAFDRFVAIQDPLHYSSILTHSAMAKVGAAILVRAILLNLPGPILLRRLLFPQVSVLSHCYCLHCDLVGLACSDTQVNSLVGLVSILLSLGFDSSLIMLSY
ALILQTVLSIVSPGERLKALNTCVSHLCIVLIFYLPKLGLSVLHRVEKHSYPALAVLMANLHFLVPPFMNPIIYCVKSKQIRQGLLKRFQQKRVDVS*
888 >lcl|XP_875531.3|Plus1complement(2613140..2614081) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC618112 __SEG__ Chr19 {Bos taurus} MTGRNQTIVSEFLLLGLPIKSEHQNLFYLFDAAMYVTTVLGNLLMVVLICLEPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMHSQDPSISYAGCLTQMYFLLFFGDL
ESFLLVAMAYDRYVAICFPLRYTTIMSPRLCLFLVVLPWVLTTFHAMLHTLLMARLHFCDDNLIAHFFCDMSALLKLSCSDTRVNELVIFIMGGLILVIPFLLIITSYAQ
IVSSTLKIPSARGIRKAFSTCGSHLTVVSLFYGTVIGLYLCPSANNSVKETVMATMYTVVTPMLNPFIYSLRNRDMKGALGRVFWRKKAPFSL*
889 >lcl|XP_875542.3|Plus1complement(2588242..2589186) NW_001493662 olfactory receptor, family 1, subfamily E, member 2-like LOC618124 __SEG__ Chr19 {Bos taurus} MTGRNQTTILEFLLLGLPIKSEHQNLFYALFLAMYVTTILGNLLILVLICLDPHLHTPMYLFLSNLSFSDLCFSSVTMPKLLQNMQSQDLSIPYAGCLTQMYFFLFFADL
GDFLLVAMAYDRYVAICFPLHYTTIMSPRLCLFLVLLPWMLTTFHAMLHTLLMARLHFCEDNVIPHFFCDLSALLKLSCSDTRVNELVIFFVGGLIIIIPFLLIIMSYAR
IVSSILKVPSAKGICKAFSTCGSHLTVVSLFYGTIIGLYLCPSAHNSTVKETVMSMMYTVVAPMLNPFIYSLRNRDMKGALGRVFCKKKNAFSL*
890 >lcl|XP_875543.4|Plus1complement(44094..45026) NW_001495357 olfactory receptor 1394-like LOC618125 __SEG__ Chr7 {Bos taurus} MDIWNHTSLSDFILLGLFSYSPYDFFLFSLVLLASATALAGNILFLLLTQADRRLHTPMYFFLSQVSIMDLTIMGAVVPKMAANFLSGSTFISRGGCATQVFLVVMVGGA
ECFLLAVMAYDRYVAVCHPLRYPVLMNWKACCLMSLASWMGGVADSVIDVGMVFSFPYCGSLQVDHFFCEVPAMLHLSCADTSLFEDLIYACCVIMLLLPLGVVVASYAR
ILMAVISMTSTEGKQKALSTCSSHLAVVGLYYGGAIFSYMQRASTRTPVGDRATSIFYTILTPMLNPLIYSLRNKEVMRAFKKMWKMQGR*
891 >lcl|XP_875559.2|Plus11340963..1341907 NW_001494480 olfactory receptor 49-like LOC618139 __SEG__ Chr28 {Bos taurus} MNGDARNRTAAPEFMLEGFPAVQHLGKVLFSVHLLMYLASVAGNTLIITITWADHHLQTPMYFFLSSFSFLECCFTTTVIPKLLAIFLLGRQKISFAACITQAFVFLFLG
ATVFFLMAVLSLDRYMAICKPLYYPTIMNPRMCSLLVSACLVLGFSLMVVPVTKLSQLFFCGSRVIPHFFCDLGPLINLSCSDIRSIEMLAFGLALFILSTSFIITIISY
SNIVVTILHLPSAKERQKAFSTCSSHFIVLSLMYGSCVFIYMKPKGTNQLDSNKGAALVNTVVTPLLNPVIYTLRNKQVHQALRNALTRVRLQK*
892 >lcl|XP_875595.1|Plus1535045..535947 NW_001493607 free fatty acid receptor 1 FFAR1 __SEG__ Chr18 {Bos taurus} MDLPPQLSFALYVAAFVLGFPLNTLAIAGAVSHARLRLTPSLVYALHLGCSDLLLATSLPLKAVEALAGGTWPLPAPLCPAFALVHFAPLYAGGGFLAALSVGRYLGAAF
PLGYQAARRPLYSWGVCVAVWAIVLCHLGLVFGLEAPGGWLDNSTSSLGISTPINGSPVCLEAWDPASAGPARFSLSLLLFFLPLVITAFCYVGCLRALAHSGLSHRRKL
KAAWVAGGALLTLLLCLGPYNASNVAGFLHPDIGGQWRQLGLITGAWSVVLNPLVTGYLGGHPGQGTVCVAKTKAGASQK*
893 >lcl|XP_875819.2|Plus1complement(2123719..2124657) NW_001495357 olfactory receptor, family 2, subfamily G, member 6-like LOC618395 __SEG__ Chr7 {Bos taurus} MEESNSSSEKGFLLLGFSDQPQLERILFVIILLFYILNLLGNTAIILVSYLDPKLHTPMYFFLSNLSCVDICFTTSVAPQLLVTMNKKDKNMSYGGCVAQLYVATGLGSS
ECILLAVMAYDRYAAVCRPLHYTTIVHPQLCASLASTAWLSGLITSLIQCSLTVQLPLCGHRKLDHIFCEVPVLIKLACVDTTFNEVELFVASVIFLIVPVSLILVSYGF
ITRAVLRIKSTAGRSKVFGTCSSHLLVVIIFYGTIIFMYLQPAKSSSKNQGKFVSLFYTIVTPLLNPIIYTLRNKDVKGAMRTLVMGNAFSS*
894 >lcl|XP_875820.3|Plus1complement(213830..214759) NW_001492991 olfactory receptor, family 1, subfamily F, member 1-like LOC618396 __SEG__ Chr11 {Bos taurus} MERLNQTSGVSEFILLGLSSRPEDQKPLFILFLIMYLVTITGNVLIILAISSDPQLHTPMYVFLSVLSFTDIWYTTTIVPRMLVDFLSEKTISYAGCLTQMYFIYALGNT
DNCLLAAMAYDRYVAICDPFHYVTIMSHCRCVLLVAFSCSLPHLHSLLHILLLNQLTFCDSNVVHHFLCDINPLLKLSCSSIFVNDLTIKTEGLVFWVTPFLCIVFSYVR
ILMAVLRIPSAAGKRKAFSTCGSHFTVVILFYGSIFYVYLQPLSSYTVQDRVAALVYTVLTSMLNPFIYSLRNKDMKRGLGKLLGRRKS*
895 >lcl|XP_875832.3|Plus1173242..174030 NW_001492991 olfactory receptor Olr418-like LOC509074 __SEG__ Chr11 {Bos taurus} MERLNQTSRVSEFILMGLSSLPEDQKPLFIIFFIIYLVTITGNLLIILAIHSDSQLQTPMYFFLSFLSFIDICFTTTIVPRMLVNFLSHKTISYAGCLTQMYFIYALGNT
DSWLLVVMAFDRYVAICDPFHYVTIMSHHRCVLLVAFSCSLPHFHSLLHTLLLNQVTFCDSNIIHHFLCDFSPLVKLSCSSTFVNEIVXXXXXXXXXXXXXXXXXVSTYT
VRDHMATIVYTVLTSTLNPFIYSLRNKDLKQGLRKLLVRRKP*
896 >lcl|XP_875847.1|Plus13125695..3127473 NW_001495330 leucine rich repeat and Ig domain containing 3 LINGO3 __SEG__ Chr7 {Bos taurus} MTCWLWVLSLQFLLLPAALPPAGGCPARCECTAQTRAVACPRRRLTAVPDGIPAETRLLELSRNRIRCLNPGDLAALPLLEELDLSENVIAHVEPGAFANLPRLRVLRLR
GNLLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLRSLRRLEVGDNDLVFISRRAFAGLLALEELTLERCNLTALSGESLGHLRGLGALRLRHLAIAALEDQNFQR
LPGLLHLEIDNWPLLEEVAAGSLRGLNLTSLSVTHTNITAVPSAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLL
STLEESTFHSVNTLETLRVDGNPLACDCRLLWVVQRRKTLNFDGRPPACATPAEVRGDALRSLPDSALFEYFVCRKPKIRERRLQRITAAAGADVRFQCRAEGEPAPTVA
WVTPRHRTVTAASAGRARVLPGGTLHIQDARPGDSGTYTCVASNAGGNDTYFATLSVQPEPAVNRTPGEGRNDTQVAARFPLDLTTILVSTAMGCITFLGVVLFCFLLLF
VWSRGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI*
897 >lcl|XP_876023.2|Plus1complement(2357877..2358818) NW_001493662 olfactory receptor, family 1, subfamily G, member 1-like LOC618597 __SEG__ Chr19 {Bos taurus} MEWENLTSVSEFFLLGLSQQPEQQWPLFGLFLSMYLVTVTGNLLIILAITAHAQLHTPMFFFLANLSLTDICFVSTTIPKTLANIWAQNQVISYTGCLSQLYFFLMFGML
EASLLAVMAYDRYVALCYPLHYIMVMSPGLCGFLVSASWVTNALHSLLHTLLMSSLSFCAHQEIAHFFCDINPLLSLSCTDPFINELVIFTVGGLMGLVCVLCLVISYAY
IFSTILKIPSAQGKWKAFSTCSSHLSVVSLYFGSSFCVYFSPLSNHSAQKDAVASVMYTVVTPMLNPFIYSLRNRDIKSSLKKLMWARKIQSF*
898 >lcl|XP_876094.1|Plus1268278..269204 NW_001493369 olfactory receptor MOR235-2-like LOC618675 __SEG__ Chr15 {Bos taurus} MDVLRPPNNVTEFVLLGLTQNPHVQKILFIAFLFIFLFTVLANLLIVITIALSPTLSAPMYFLLTYLAFLDASFTSVTTPKLIVDLLHQRGIISWRGCLTQVFLEHFLAA
SEVIVLTVMAYDRYVAICKPLHYTTIMRQGLCRLLVVVAWIGGILHATVQVLFTMELTFCGPNVIDHFMCDFFSLLELACSNTYIPGMVVAANSGGMCLLIFSMLLISYI
VILSSLRSHGSEGRRRALSTCGAHFTVVVFFFLPCVFTYTRPVATYPVDKWVTMFSAILTPMLNPIIYTVRNVEVKKAMRNLLKRRVV*
899 >lcl|XP_876134.2|Plus1complement(10380..11354) NW_001504284 olfactory receptor 157-like LOC618717 __SEG__ Chr8 {Bos taurus} MESETNGANQTVVTEFVLLGLHDHHNLEMVLFVLCLGIYSVNVLGNALLIGLNMLDPRLHTPMYFFLSNLALMDISGTSSFVPLMLVNFLETQSTISFPGCALQMYLTLA
LGTTECVLLAMMACDRYVAICQPLHYSKLMNQQTCTWMAVLSWGAGFANSLLHSILTWSLPFCGHNIINHFFCEILAVLKLACGDISLNALILTVASAVVTLPPLLLIFL
SYVFILTTILRVPSAASRHKAFSTCSAHLTVVVIYYGTISFMYFKPKAKDLYLDKLLALFYGVVTPSFNPIIYSLRNAEVKAASIALLRGDLLSRKMACFPVVL*
900 >lcl|XP_876202.2|Plus1121563..122621 NW_001494081 chemokine (C-C motif) receptor 8 CCR8 __SEG__ Chr22 {Bos taurus} MDYTPEPNLTTATDFYYPDIYSSPCDGEGRESKLLLAVFYCILFVFGLLGNSLVILVLVACKKLRSVTDVYLLNLALSDLLFVFSFPFQTHYQLDQWVFGTVMCKVVSGF
YYIGFFSSMFFITLMSMDRYLAVVHAVYALKVRTISMGTALSLVVWLTALVATSPLLVFYQVASENGILQCYSYYNQQTLKWKIFIHFEVNILGLLIPFSILMFCYIRIL
HQLKSCQNHNKTKAIKLVLIVVVASLLFWVPFNTVLFLTSLHDMHVLDGCVMSQQLTYATHVTETISFTHCCVNPIIYAFMGEKFKKHLSELFRKSCSHTLVYIGRQVSR
EVLEKSSSNQQSSRSSTVDYIL*
901 >lcl|XP_876232.4|Plus1complement(1596..2540) NW_001501883 olfactory receptor Olr879-like LOC618816 __SEG__ Chr5 {Bos taurus} MKNYTAITTFILVGLTDDPNLKILLFIFLLLTYLLSVAGNLIIITLTLVDPHLKTPMYFFLRNFSILEVSFTTVCIPRFLYTMASGDNTVTYNACATQLFFVVILAVTEF
FILTAMSYDRYVAICKPLHYTTIMNNMVCIKFLIGCYMIALIIVLPPFGMGFELEFCDSNVIDHFGCDAAPILKITCSDTEFLERFVLVLAALTLLFTLVCVIMSYTYII
RTILRFPSAQQRKRAFSTCSSHIIVVSITYGTCIFIYIKPHAKEGVAINKVVSVLTTSVAPVMNPFIYTLRNKQVVQAFKDMIKRVASYFKGLK*
902 >lcl|XP_876427.3|Plus1complement(827181..828125) NW_001494173 olfactory receptor 1365-like LOC619021 __SEG__ Chr23 {Bos taurus} MERANNSAFSRFILLGFSNQPQLETALFAVILIIYSLSCLGNGAIMLLSTMDPHLHSPMYFFLSNLSFMDLCLTTCTVPQTLANFKGKDKTITYGGCVAQLFIALGLGGV
ECVLLSVMAYDRYVAVCRPLHYMVIVHPQLCLQLVVTAWLTGFGSSVVQTALTMTLPLCGKNQVDHFFCEVPVMLKLACTNTSVNEAELFAVSVFFLVVPLSLILVSYGH
ITRAVLKIKSAQGRQKAFGTCGSHLMVVIIFFGTLISMYLQPPSSYSQDVNKSIALFYTLVTPLLNPLIYTLRNKEVKGALRRQMRRILDLRPS*
903 >lcl|XP_876476.1|Plus1complement(118028..119002) NW_001492803 olfactory receptor 49-like LOC619067 __SEG__ Chr10 {Bos taurus} MLHTADWAFPAEARGATGNHTTVTEFILLGLSEACELQMLLFLGLLLTYLLTLLGNLLIVVLTLMDRRLHSPMYYFLRNFAVLEIWFTSVIFPKMLTNILTGNRTISLEG
CFLQSFLYFFLGTTEFFLLAVMSFDRYVAICNPLRYVTIMSKRVCVQLVLSSWITGFLLNIIPGFLTIQQPFCGPNIIDHFFCDNFPLLELICADTSLMEILSFILANVS
LLGTLSVTATCYGHILHTILHIPSAKERQKAFSTCSSHITVVSLFYGSCIFMYVRSGKGGQGEDRNKVVALLNTVVTPVLNPFIYTLRNKQVKQVFREQLNKLF*
904 >lcl|XP_881920.3|Plus11377802..1378737 NW_001495357 olfactory receptor Olr1455-like isoform 2 LOC614090 __SEG__ Chr7 {Bos taurus} MENTNVTTGINFILLGLFNYTETHLFLFSMVLMTFLTSLMGNAFMIMLIYVDPRLHTPMYFLLSQLSLMDMMLVLTIVPKMAANYLRHTRSISPTGCGAQIVLLLTLGGG
ECFLLAAMAYDRYVAICHPLRYPILMNQKLCLHMTAGSWLLGGVDGLMQAGATLSFPYCHSREINHFFCEAPSLVRLTCANTMIFEFFMYVCCILMLLIPLSLILASYSL
ILAAVFRMQSNEARKKAFATCSSHLAVVGLFYGTSMFIYMRPKSYHSVGHDKVVSAFYTILTPVFNPLIYSVRNIEVKGACRKWLEKHFKS*
905 >lcl|XP_881984.2|Plus1245185..246132 NW_001495313 olfactory receptor, family 10, subfamily H, member 1-like isoform 2 LOC510087 __SEG__ Chr7 {Bos taurus} MQGANISAVTEFILIGFSSFPHLQLMFFLLFLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCALSISEILYTFAIIPRMLADLLSTNRSISYTACASQMFFSFTFGFT
HSFLLTVMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWAGGSVMGLLVTSAVFHLPFCSSNVIHHFFCHVPPLMKLACGDNVSTVAKGVGLVCIAALLGCGLLILLSYA
FIVAAILRIPSPEGRHKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSLERDTLMGITYTALTPFLSPIIFSLRNKELKEAVKKTFLSKLFLHRS*
906 >lcl|XP_882142.1|Plus1763457..764398 NW_001493314 olfactory receptor 78-like isoform 3 LOC615216 __SEG__ Chr15 {Bos taurus} MSPVNNSWIHPSSFLLLGIPGLENMQVWLGFPFGIVYLIALLGNVTILFVIQTEHSLHQPMFYFLAILALTDLGLSTATIPKMLGIFWFNLGVISFGGCLTQMFFIHLFT
GFETFMLVAMAFDRYVAICHPLRYNTILSNRNTCIIVEIGMLKNLVFVFPLISLLLRLSFCGHNTIPHTYCEHMGIARLACVSIKVNILFGLILISMILLDVVLIAISYV
KILHAVFRLPSQEARLKALNTCGSHVCVILAFFTPAFFSFMTHRFGHNIPRYIHILLANLYVVIPPALNPIIYGVRTKQIRNQVVTICHFKKA*
907 >lcl|XP_883783.1|Plus1complement(6773927..6775849) NW_001493344 leucine rich repeat containing 4 isoform 4 LRRC4C __SEG__ Chr15 {Bos taurus} MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLRDVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRN
HIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIK
LDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARC
NTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTASAT
LNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKM
RKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI*
908 >lcl|XP_885855.3|Plus1260206..261135 NW_001493367 olfactory receptor 1264-like isoform 2 LOC540128 __SEG__ Chr15 {Bos taurus} MANTHNVTEFIFLGLSSNPEVQKVCFVMFLLLYTAIVLGNFLIVLTVISSRSLGSPMYFFLSYLSFAEICYASTTAPRLISDLLAERKAIPLWGCMSQVFFIHLFGGTEI
FLLTVMAYDRYVAICKPLSYTTIISRQACALLVGAAWVGGFVHSLAQILLIFRLPFCGPNVIDHYFCDVLPLLKLACSDTVLIGLLIVANGGTLSVISFVVLLASYVVIL
LHLRTRSSAGRRKALSTCGAHVTVVTLFFGPCIFIYLRPSTTLSADKTVAVFYTVITPLLNPVIYSLRNAEVKKAMRRLWVRAMKLEER*