SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr S    

ID / Description / Sequence
1 >lcl|NP_001166991.1|Plus1449380..449532 NW_003536498 PTB-containing, cubilin and LRP1-interacting protein PID1 __SEG__ Chr15 {Sus scrofa} FQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTKTHSGCK
2 >lcl|XP_001924291.1|Plus1983921..984937 NW_003536763 melanoma-associated antigen B10-like LOC100156962 __SEG__ ChrX {Sus scrofa} MPRGQKSKLRAREKRRQARGETQHLRDAQATAAEGEESPSPPPGDNLQSSPAYGSGRKSQGSRKAPSTTTTSAGVSCTRSDEGAKSHDEEQPGTSLAMPSTDYSCRSPLD
QKAILLVQFLLRKYNMREPITKKDMMKHVIKRYKEHFHEILRKASELMVLAFGIDVKEVDPTRHCYVLISKFQRTSDERLRGEEIMPKTGLLMTILCVIFMKSNCATEEE
IWEVLNVMGIYAGKNHFIYGEPKKLITKDLVQERYLVYRQVANSNPPRYEFLWGPRAHAETSKMKVLEFLAKIHDTVPSAFPSWYEEALRDEEMRARARFAAMVRTGALA
NVHSGANF*
3 >lcl|XP_001926795.1|Plus1641352..642503 NW_003534651 small RNA 2'-O-methyltransferase-like LOC100152743 __SEG__ Chr4 {Sus scrofa} MAEDKECHSMVEEVPSKRIIKFNPPLYKQRYQFVKNLVEQHQPQKVADLGCGDLSLLSILKYLKCVTELVGVDINEGRLKWNGSRLSPCVGDHLDPRELDLVITLYHGSV
LEKDCRLLGFDLVTCIELIEHFDSEDLARFPEVVFGYMSPAMIVISTPNSDFNSLFPLSVFRDSDHKFEWSRVQFQTWALDVANRYSYSVEFTGVGEPPAEAEDVGYCTQ
IGVFRKKEKTTESDVLEHPGERVYEVVYTTSYPSLQQINYHRRVVVYLVYREVNKMRLRYQVSLRRHELEPESTDPDDPRRKFISGLPVHTPTEADKAMAMTPQPFCIGD
KFYVPLKRIIAYPRLGYLCGNVQELRELLADSIELNCDASAVKVDLYHCSDYC*
4 >lcl|XP_001927152.1|Plus11055819..1056460 NW_003535205 ribonuclease P protein subunit p25-like LOC100157338 __SEG__ Chr7 {Sus scrofa} MAKPPSPRSRQLRRMENFRKVRSEEAPVGNGEEGGGPGSGPFGDLAPGAVHMRVKEGSKIRNLLAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLVGLHQVTR
LRYRSVREVWQSLPPEPTPDQKPDEPAASLTVLKNVPSLAILLSKDALDPRQPGYQPPSPHPGPSSQPTAPTSKRSLGEPAAGEGSAKRSQPEPGAAEEDQTA*
5 >lcl|XP_001927186.3|Plus1325463..326449 NW_001886700 melanoma-associated antigen 10-like LOC100156705 __SEG__ ChrX {Sus scrofa} MPLRQQIELHKIEDEPEDPAEAQDLVETQLHWGEEESTPSSSSSSSVSSSYSVLFLETLEEEADPETPSPPQDPQGVCPSPAPVAPTPLSQSKDDASGSQDDEGPSPSHD
QEHADASQSGSLHLKVADLVEFLLLKYCAKEPTTQAEMLSVVLRDAQDHFPEVLSQASELIQLVFGLDVKEVDPSEHTYALVPTLGLTWDGVLSDGQSLPKTGLLVVLLG
VILLKGECAPEEEVWGALGKMGVCAGREHCIYGEPRELLTQVWVQEGYLEYHQVPHSNPAHYEFLWGPRAHAETSKLQVLEHMLRVSERDPRSFLSLSEEAVIEEEGS*
6 >lcl|XP_001927407.1|Plus11146448..1147260 NW_003536242 2-aminoethanethiol dioxygenase-like LOC100153304 __SEG__ Chr14 {Sus scrofa} MPRDNMASLIQRIARQACLTFRGSGGGRSSSDRGAAPGPEAPVPQGFPENLSKLKSLLTQVRAEDLNISPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIP
LHDHPGMHGMLKVLYGTVRISCMDKLEAGSGQRPRAPPPEQQFEPPLLARERDAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGPAAFLDILAPPYDPDDGRDC
HYYRVLEPVRAKEASDSACDLPREVWLLETPQADDFWCEGEPYPGPRVFP*
7 >lcl|XP_001927807.1|Plus1105263..105475 NW_003536079 26S proteasome complex subunit DSS1-like LOC100155621 __SEG__ Chr13 {Sus scrofa} MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLGAELEKHGYKMETS*
8 >lcl|XP_001927918.3|Plus1complement(484081..485556) NW_003533919 transmembrane protein 200A TMEM200A __SEG__ Chr1 {Sus scrofa} MIATGGVITGLAALKRQDSARSQHHVNLSPSPAAQEKKPVRRRPRADVVVVRGKIRLYSPSGFFLILGVLISIVGIAMAVLGYWPQKEHFIDAETTLSTNETEVIRNQGG
VVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQKHMNGIYTGLMGETEVKQNGNSCASRLAANTIASFSGFRSSF
RMDSSVEEDELVINESKSLGHLIPPLLSDNSASVCGLYPPPSKTAEDKSSGPKKCETKSIVSSSISAFTLPVIKLNNCVIDEPSIDNITEDADTLKSRSRNLSMDSLMLP
LPNSSQPFQPVSMILPRNNSIGESLSSQYKSSVALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRSNSKGYMKLENKEDPV
ERLLVPQAAVKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETRF*
9 >lcl|XP_001928497.1|Plus1complement(854468..854731) NW_003536657 bladder cancer-associated protein-like isoform 1 LOC100155728 __SEG__ Chr17 {Sus scrofa} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
10 >lcl|XP_001929056.1|Plus130611..31828 NW_003300225 NKAP-like protein-like LOC100154907 __SEG__ Chr7 {Sus scrofa} MAPVSRSRYPEDTVGSRRRRCSSSGSPPSAQARRSPLGGRSHFYSRGREGLRPPWGGSGVGALYSLSGSGSRERSPGLRNFSSSSSSVYYGGYRYHHHHYVGDRQWAEDY
EKEKEENYRQRRLKERERIGELGAPEVWGLSPKLPEPDSDEHTPVEDDEVKTKKTSSSDSSSEEKRKKKTSHSKKKRKKKSKRKYRKYSDNSDSNSDSNTDSSSDDDDKK
RPKKAKKKEKKKKHRAKKPKKKKTKKTRKESSDSNYKDSEGELPEGIWIEQSKIADNMDLIGPEAPITQISQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLT
SEEIASFEYSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKEDK*
11 >lcl|XP_003121200.1|Plus12286..2546 NW_003533908 splicing factor 3B subunit 5-like LOC100520703 __SEG__ Chr1 {Sus scrofa} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*
12 >lcl|XP_003122296.2|Plus1476364..476813 NW_003534180 probable lipid phosphate phosphatase PPAPDC3-like LOC100525446 __SEG__ Chr1 {Sus scrofa} MPASQSRARARDRNNILNRAEFLSLNQPPKGAPEPRGSARKASGPSAQPPPPGDGARERRQSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASAR
SMVKLIGITGHGIPWIGGTILCLVKSSTLAGQEVLMNLLL
13 >lcl|XP_003122568.1|Plus1complement(151568..152176) NW_003534206 coiled-coil domain-containing protein 85B-like LOC100525383 __SEG__ Chr2 {Sus scrofa} MEAETGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGSGGSGAAPTPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*
14 >lcl|XP_003122591.1|Plus1302945..304144 NW_003534207 zinc finger HIT domain-containing protein 2-like LOC100514699 __SEG__ Chr2 {Sus scrofa} MEPAGPCGICPAGEAQPARYTCPRCNVPYCSLRCYRAHGTCAEDFYRDQVLGELRGRSASPSRLASALRRLRQQRETEDEPEDAGLRPGPAPGGLSGLWERLAPAEKAAF
ERLLSRGEAGRLLPPWRPWWWGRGAGPRLLEELGDAPGRDADELEPAPAGSPPEPVKDEPAAAGPTPGDAPGVCAPAVPTRIPTLASLSRGRASPLVRFQLPNVLFAYAH
TLALYHGGDEALLSDFCATLLGVSGALGAQQVFTSAEEALQAAAHVLEAGEHPPGPLGTRGAMREAARILLGEGPANQKGYTLAALGDLAQTLGRARKQAVATEERDRLY
RARKKCQFLLAWTNENEVALTPLALDCARAHRAHAVAAEEVAALTGELEQLWGGPLPPAPRTLIEELPG*
15 >lcl|XP_003122690.1|Plus1complement(56269..57147) NW_003534212 leucine-rich repeat-containing protein 10B-like LOC100520292 __SEG__ Chr2 {Sus scrofa} MGIAESTPDELPSDAEEQLRNGEQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFA
QLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPP
RVADTVFLVGEGAVERMAERDEPTPRPPPRRPVRTFEDEEEEDLLIGGGGSRALGPPRGSLHALEAAPGLGT*
16 >lcl|XP_003125685.1|Plus1complement(184195..184428) NW_003534657 zinc finger protein 706-like LOC100511877 __SEG__ Chr4 {Sus scrofa} MAHRLQKIQSHQKKKAKKQTGQKKKQGHDKKTVAKATLIYTCTVCRTQMPDPKTFKQLFESMHPKTLLPPELADVQA*
17 >lcl|XP_003125873.2|Plus1complement(2374..3549) NW_003534680 protein FAM46C-like LOC100525341 __SEG__ Chr4 {Sus scrofa} MAEESSSARDCVSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSQLEEAGIKVQDIRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVSKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSSHPISEHLHPTVIGESVYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQDEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMTLRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPNATTVTCYYQPAPYVSDGNFNNYYVAHPPLPYSQPYPTWLPCN*
18 >lcl|XP_003126422.1|Plus1complement(338348..339187) NW_003534768 leucine-rich repeat-containing protein 10-like LOC100518485 __SEG__ Chr5 {Sus scrofa} MGNTIRALVAFIPADRCQKYVVRDLQEMPLDKMVDLSGNQLRRFPVHVCSFQELVKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKVLPQVVCTLKQLCILYLGNNKL
CDLPSELSLLQNLRTLWVEANYLTQLPDVVCELSLLKTLHAGSNALRLLPGQLQRLQELRTIWLSGNLLTDFPPVLLHMPFLEVIDVDQNSIRYFPSLAHLSSLKLVIYD
HNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQEAQVPALLPPFPPTNS*
19 >lcl|XP_003126689.2|Plus1320137..321234 NW_003534838 EP300-interacting inhibitor of differentiation 3-like LOC100514233 __SEG__ Chr5 {Sus scrofa} MSDERDSLRWGDREKGEEPVVTVTRSAYSGRQAQEEEGEAGADAFSDDLSLGEADIDPSLLELVDEEKCRSIRKQYRQLIYNVQQNRDDIVNTASDSLTEALEEANVLFD
AVSRTREAALDAQFLVLASDLGKEKAKQLNSDMSFFNQVAFCDFLFIFVGLNWMEDDGRDVLNDCDDNIAFSFWETVQKEATSWILQAETFHFIFGSFKSEPSSRKPRLE
NRKKVHKMEENGDMPTKLRKLDLSSNQEATEKEVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRLDQDRLPILEPINMNQVGEGNDP
SSHGRKQGVISLSLQDWKNIVATFEISEAMITNSY*
20 >lcl|XP_003126690.1|Plus1complement(66775..67872) NW_003534839 EP300-interacting inhibitor of differentiation 3-like LOC100514406 __SEG__ Chr5 {Sus scrofa} MSDERDSLRWGDREKGEEPVVTVTRSAYSGRQAQEEEGEAGADAFSDDLSLGEADIDPSLLELVDEEKCRSIRKQYRQLIYNVQQNRDDIVNTASDSLTEALEEANVLFD
AVSRTREAALDAQFLVLASDLGKEKAKQLNSDMSFFNQVAFCDFLFIFVGLNWMEDDGRDVLNDCDDNIAFSFWETVQKEATSWILQAETFHFIFGSFKSEPSSRKPRLE
NRKKVHKMEENGDMPTKLRKLDLSSNQEATEKEVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRLDQDRLPILEPINMNQVGEGNDP
SSHGRKQGVISLSLQDWKNIVATFEISEAMITNSY*
21 >lcl|XP_003127119.1|Plus1425980..426330 NW_003534949 succinate dehydrogenase assembly factor 1, mitochondrial-like LOC100521971 __SEG__ Chr6 {Sus scrofa} MSRHSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHACLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRTRDPTEESCGAEAPGTPPGEGPKRPLDSMGAPG
TPSSER*
22 >lcl|XP_003127505.1|Plus1complement(1193897..1194235) NW_003534965 protein FAM32A-like LOC100515318 __SEG__ Chr6 {Sus scrofa} MEAHEHVQQGPPKLKGGPELRAIRRKKKKKAKDKAKLPEGMGTIRRDKEEKPPGLDVGTPAQVAFEKMQEERQGERIPKKASRTHRQRVEDFNRHLDTLTEYFDLPKVSW
TK*
23 >lcl|XP_003127506.1|Plus1complement(928014..928352) NW_003534965 protein FAM32A-like LOC100515485 __SEG__ Chr6 {Sus scrofa} MEAHEHVQQGPPKLKGGPELRAIRRKKKKKAKDKAKLPEGMGTIRRDKEEKPPGLDVGTPAQVAFEKMQEERQGERIPKKASRTHRQRVEDFNRHLDTLTEYFDLPKVSW
TK*
24 >lcl|XP_003127792.1|Plus1complement(413280..414203) NW_003300142 transmembrane protein 200B-like LOC100515438 __SEG__ Chr6 {Sus scrofa} MTAGSPGDCGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIAVAGYWPHRAGIPGPRAANSSSPPLTELRREGRGAGRAHGP
HERLRLLGPVVMGVGLFVFICANTLLYENRDLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRTPRAIGCVEQESWDLSPRRGTSPVPSLRSLRSEPANPRLGLPAL
LNSYPLKGSGLHPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGGGNLGARV*
25 >lcl|XP_003128160.1|Plus1complement(333830..334942) NW_003535127 probable exonuclease V-like LOC100511388 __SEG__ Chr6 {Sus scrofa} MAETGEEETVSAEASGFSDLSDSEFLDLEDTQESSMSLSEPGPSSALSEKHGNLISLPTWKGGLDVSSPMERFHLKYLYVTDLCTQNWCEQQMVYEKELPGFLTPEKSAV
LDTGASIHLARELEVHDLVTVPVTTKEDAWAIKFLNILSMIPTLQSEGRIREFPVFGEVEGVFLVGVIDELHYTARGELELAELKTRRRPVLPMNAQKNKDRFQVNLYKY
IFDAMVQGKVTTASLIYHTKLHPEKPLGPSVLRHARQGGFSVKSLGDLMELVYLTLTLSDLPVIDSLKIEYIHQETATVLGTEIVAFEEKEVRRKVQHYLAYWMGHREPQ
GVDVEEAWKCRACNYADICEWRKGSRLPNSVLEPQVKIAK*
26 >lcl|XP_003128207.1|Plus1636142..637134 NW_003535132 LOW QUALITY PROTEIN: protein FAM50B-like LOC100156092 __SEG__ Chr7 {Sus scrofa} MAQYKGTMREAGRALHLLKKREKQKEQMEVLKQRIAEETISKSKVDKKFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVREREMQLAQRARREKRRRQLEAQRERERK
REQRRQICGLSFSTDDGDDDSDGDREAAEPAGPRRPLGKDPAVDTSFLPDREREEEERRLREELRREWEARRERVKREEVEVTFSYWDGCGHRRAARIHKGGTVQQFLKR
ALQALRPDFRELRAAGVEQLLFVKEDLILPHCHTFYDLIVAQARGKSGPLFTFDVHEDVRLRSDATLEKDNSHPGQGVLRHWYKKNKHIFPAAAGNPTNPKKPWDR*TVR
*
27 >lcl|XP_003130689.1|Plus1complement(320993..322864) NW_003535682 recQ-mediated genome instability protein 1-like LOC100517963 __SEG__ Chr10 {Sus scrofa} MSVTSIASRVETWLLATWHVKVPLMWLEACINWIQEENDNVNLSQAQMNKQVFEQWLLTDLRDLEYPLLPDGILEVPKGELNGFFALQIISLVDVSQPAYAQIQKLRGKN
TSNDLITAETQVVPKPWEAKPSRMLMLQLTDGIVQIQGMEYHSIPALHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAPQRVLARLIGEPDPTVSV
IPNNSNQSIPRITDVLDPTLGPSDEELLASLDESDELAANNASLERSCFSTGSSSNAIPTTQLDFEPGLISPRPKERPQNQSMPFTDGELDDFSLEEALLLEEAVQKEQM
ETKELQPMTLNRTPDESIERFSHRSNTLNNFSLICKNGNNWNKKNLSEQMTNEDKSFSCPSARDRNSSTFSVNHNVPLPHDFTNEDKNSEPYNEIEQASSSGEHSFNNKI
LNGELVSYVPKKSGDISNENERHLQSCSLRSSENSTNLSVTMDLYSPPFIYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKISDGTAYLDVGFVHEILFS
LIGFSVPEMKQLKKDPCKYQKFREGLQKCQRDLIDLCCLMTISFDPCLSKAMVLALQDVNMEHLENLKRRLKK*
28 >lcl|XP_003130706.1|Plus1complement(621458..621949) NW_003535686 alba-like protein C9orf23-like isoform 1 LOC100522095 __SEG__ Chr10 {Sus scrofa} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTSPDTGLDPLTV
RRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGPMPSSSCGPRPRRRARDTRF*
29 >lcl|XP_003131117.2|Plus1complement(255522..255956) NW_003535833 gamma-glutamylaminecyclotransferase-like isoform 1 LOC100524456 __SEG__ Chr11 {Sus scrofa} MAHVFVYGTLKTGQPNHRVLLDGAHGRATLRGRARTLEPYPLVIAGEHNIPWLLQLPGHGRCVAGEVYAVDEQMLRFLDEFEGCPDMYQRTRLTVAVEGPAGGTVQCFAY
STATYPPEWLQLPHLDDYDSQGEHGLRYNPRENR*
30 >lcl|XP_003131714.1|Plus1complement(189543..190082) NW_003535887 peptidyl-tRNA hydrolase 2, mitochondrial-like isoform 1 LOC100519562 __SEG__ Chr12 {Sus scrofa} MISMPLVMEYLANPGALSFAAGVACGMCLGWGLRVRFGMIPKSSVSETDTDTETEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPELLQQWEY
CGQPKVVVKAPDEETLVELLTHAKMLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPVDLIDKVTGHLKLY*
31 >lcl|XP_003131912.2|Plus1600195..600527 NW_003535909 transmembrane protein 93-like isoform 1 LOC100519386 __SEG__ Chr12 {Sus scrofa} MAAVVVKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASILLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
*
32 >lcl|XP_003132189.1|Plus1complement(21723..23465) NW_003535955 uncharacterized glycosyltransferase AGO61-like LOC100524525 __SEG__ Chr13 {Sus scrofa} MHLSAVLNALLVSVLAAVLWKHVRLREHAASLEEELVLGRRAPEPAPTLRIDYPKALQILTEGGTHMVCTGRTHTDRICRFKWLCYSSEAEEFIFFHGNASVMLPSLGSR
RFQPALLDLSTVEDHNTQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAREARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQL
KALGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFARFLTEKLNVSHAGGALGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHAFAD
VVRLVSNASMLVSMHGAQLVTALFLPRGAAVVELFPYAVNPDHYTPYKTLATLPGMDLQYIAWRNTMPENTVTHPERPWDQGGIAHLDRAEQARILQSQEVPRHLCCRNP
EWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPRKQKWTVSLYPGKVREARCQSSVQGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILTLQNHTFTENI
KPFTTYLVWVRCIFNKTLLGPFADVLVCNT*
33 >lcl|XP_003132648.1|Plus1959498..960772 NW_001885223 protein FAM43A-like LOC100523468 __SEG__ Chr13 {Sus scrofa} MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMK
LTVSAQGIRMVHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHT
IPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQQEQEQELQEEEEEEHTDGCLNEEEEDRAGEGGPAEQEAEAPQELVVAMHFECGDLLETLESSREEALGE
GGVSPGPEAGPPPLLLGSASDMKAELSQLINDLGELSFGNDVRSLQADLRVTRLLSGESTGSESSIEGGGPDATTATTEDQSTDCGSPDEPLSG*
34 >lcl|XP_003133103.1|Plus1complement(988208..988555) NW_003536245 transmembrane protein 14C-like LOC100521406 __SEG__ Chr14 {Sus scrofa} MQKDSGPLVPLFWIGFGYAALVVSDWIIGYAKAGSVLSLVTALFFSGLAGLGAYWLSQDPGNIWVFLDTSGTLAGIMRMRFYHSGKCMPVGLVVGANWLMVAKLGISVLS
KPRPQ*
35 >lcl|XP_003133553.1|Plus1complement(164117..166114) NW_003536448 tetratricopeptide repeat protein 30A-like LOC100517977 __SEG__ Chr15 {Sus scrofa} MAGLGGAQIPDGEFTTVVYRLIRDARYAEAVQLLGGELQGSPKSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YHSRVLRLLAAIKYSEGDLPGARSLVEQLLSGEGREDSGGENELDDQVNLGCLLYKEGHYEAACSKFFAALQASGYRPDLSYNLALAYYSSRHYASALKHIANIIEHGIR
QHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEFQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDTRPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFALAADVLAENAHLTYKFLTPYLYDFLDALITCQTAPEEAFIKLDGLAGVLTEQLRRLTKQVQEARHNRDDEAVKKAVNEYDDAFEKYIPVLMAQAKIYWNLENY
PMVEKILRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKIYHLCIVNLVI
GTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTLMLRDSVIQECVQFLEHCELYGRNIPAIIEQPLEEERMHIGKNTVTYESRQLKALIYEI
IGWNM*
36 >lcl|XP_003133650.1|Plus1complement(248075..248284) NW_003536472 general transcription factor IIH subunit 5-like LOC100516115 __SEG__ Chr15 {Sus scrofa} MVSILKGVLIECDPAMKQFFLYLDESSALKFIIQDIDDTQVFVISELVNILQEQVGELMDQNAFSLTQK*
37 >lcl|XP_003133863.1|Plus1complement(118209..118670) NW_003301479 coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like LOC100513317 __SEG__ Chr15 {Sus scrofa} MPRGSRSRSFHMAPPASRAPQMRAAPRPALAAQPPAAAPPSAVGSPAAAPRQPGLMAQMATTVAGVAVGSAVGHTIGHAITGGFGGGSSAEPSRPDITYQEPQGAQPAQQ
QQIGPCFYEVKQFLECAQNQGDLKLCEGFSEVLKQCRLANGLS*
38 >lcl|XP_003135033.1|Plus1336866..337894 NW_003536761 melanoma-associated antigen B18-like LOC100512693 __SEG__ ChrX {Sus scrofa} MPRGQKSKLRAREKRRQARAETQGLEDAQATAAAAGESLSLVHALTEDRPQNLSAAETPSTPEAPQGTTDASAAVSCTNSDEGTSSQKEESSKSSRGTEGSRRDPLNKKV
VLLVQFLLQKYQKKEPITKADMLKFVIKKYKYHFNEILKRASEHMELAFGVDLKEVDPTRHCYALVSKLDLTFDGTMNEEENMPKTGLLMIVLGVIFMNGKCAPEEEIWE
VLNMMGVYAERKHFLYGDPKKVITEDLVQLKYLEYRQVPDSDPPRYEFLWGPRAHAETSKMKVLEFLAKVHDTVPSAFPSWYEEALRDEEERAQARAAARARLAAMASVR
SRATASNLSHAK*
39 >lcl|XP_003135034.1|Plus124677..25729 NW_003536762 melanoma-associated antigen B4-like LOC100512876 __SEG__ ChrX {Sus scrofa} MPRRQKSKCCARVKRHQTRGETQSLKGAEAAPAAAAAEEESPSSPSSVSQGAPPSSPAAGTRQRPQAGPAPSSPEAGVSRPGAEAGAQSQDENGASASQAAPSTQSTRKD
PLTRKASMLVQFLLEKYKMKEPIMQTALLKIINKKYKEHFPEILRRASERMELIFGLELKEVNRSNHTYTLVSKLSLPSDGGHGGQSDERGLPRSGLLMTLLGVIFMKGN
RATEEEVWEFLNTLGVYAGRRHLIFGEPRRLITKDLVQQKYLKYRQVPHSDPPHHEFLWGPRAHAETTKMKVLEVLAKINDTVPSAFPNLYEEALKDEEERAGVRAEAKA
TALAEARAPSRAKSRSSTHI*
40 >lcl|XP_003135036.1|Plus167892..68944 NW_003536762 melanoma-associated antigen B4-like LOC100513448 __SEG__ ChrX {Sus scrofa} MPRRQKSKCCARVKRHQTRGETQSLKGAEAAPAAAAAEEESPSSPSSVSQGAPPSSPAAGTRQRPQAGPAPSSPEAGVSRPGAEAGAQSQDENGASASQAAPSTQSTRKD
PLTRKASMLVQFLLEKYKMKEPIMQTALLKIINKKYKEHFPEILRRASERMELIFGLELKEVNRSNHTYTLVSKLSLPSDGGHGGQSDERGLPRSGLLMTLLGVIFMKGN
RATEEEVWEFLNTLGVYAGRRHLIFGEPRRLITKDLVQQKYLKYRQVPHSDPPHHEFLWGPRAHAETTKMKVLEVLAKINDTVPSAFPNLYEEALKDEEERAGVRAEAKA
TALAEARAPSRAKSRSSTHI*
41 >lcl|XP_003135037.1|Plus186280..87233 NW_003536762 melanoma-associated antigen B3-like LOC100513636 __SEG__ ChrX {Sus scrofa} MPRSHKSKLHAGEKRLKARRETQSCGGAQVTAAAEEESATSSSPQCGGITQSLPATGSCSTTQEPQRALTTTTTSVGISYTRSDEASNGQDEDGVCAYEVPPFTERSDFL
TRKAGLLEQFLLYKYKMKQPILKEDMLKIIHQNHHDRFAEILKRASERIEIIFAVDLKEVDSTRQCYDLVSKLKLPNNGRVRGGRGLPKTGLLMNLLGMIFMKGNCATEE
DIWKFLSMMRVYAGRKHFIYGEPRKLITKDLVRLKYLEYRQVPDSDPPRYEFLWGPKAHIETSKMKVLEFLAKVNETVPSAFPIYYEEALRDEEERA*
42 >lcl|XP_003135042.1|Plus12293581..2294534 NW_003536771 melanoma-associated antigen B16-like LOC100520818 __SEG__ ChrX {Sus scrofa} MPWHQKKKNLQYSYDQCPQTHSKTHGLEVAQVSKALEETHFSSHPLMLGNLKEDPDAGILSIPKGPQSFCSSASTATSSTELDEGSMSQEEDSPGTSQAAPDTENVLIDD
LDDKVVMLMIFLLLKYQMQEPITEEEMLKIVDNCQAHFPEILMRTSEHMEIIFGLDLKEVDPANHRYDLLIKLGLTYDGMLHGEVGMPKTGILLLILGVIFMKGNCATED
EVWEVLSVIGVYSGRKHLILGEPRKLITEDFVKEKYLEYRQVANTDPAQFEFLWGPRAHAETTKMKVLEFLAKVHGIDPSSFPSQYEEALQDEEERA*
43 >lcl|XP_003135044.1|Plus11418855..1419883 NW_003536771 melanoma-associated antigen B16-like LOC100521702 __SEG__ ChrX {Sus scrofa} MSQSREIPHCTQEQHCAQGLEAAQASKDPEEASLSSHSLMPGNQEGALAAGAPSTSQGPQSACVAYAVTTALLSGKLGEHSSSQEKEGGSASSESSSEAENLPIDPLDEK
VNLLVQFLLQKYQKREPITKADMINDVIREHKDDFLEILRRVSERIELVFGVDLKEVDPTSHTYALVNKLDLTYDARLSDDEGMPKTSLLIIILGVIFMKGNRATEEEIW
EVLNMMDLHSGRDHFIFGEPRKFITKDLVREKYLEYRQVPNSDPPRYEFLWGPRAHAEASKMKLLEFLTKIHESDPTCFPSQYEEALRDEAERARARVATEASTSAKAKS
CSNPRSSSSSHP*
44 >lcl|XP_003135074.1|Plus1470324..470800 NW_003536773 brain protein 44-like protein 2-like LOC100515596 __SEG__ ChrX {Sus scrofa} MAAVVALWRRALETLKTKEFRDYLASTHFWGPVANWGLPLAAFKDMRAPPDIISGRMTMALIFYSMAFMRFAYRVQPRNLLLMACHGTNVVAQSIQGSRYLMHYYGSGAM
VATATATTAASTGSVGSITTTTPVVDDLAADCYCPEATSCDPLTPEQD*
45 >lcl|XP_003135159.1|Plus1complement(275839..276498) NW_003536786 melanoma-associated antigen H1-like LOC100519347 __SEG__ ChrX {Sus scrofa} MPRGRKSRRRRNARAAEENRNNRKIQASETSETPVAASVVPSTPGDDLSGPEEDPSTPEEASTTPVEASSTAQAQKPSVARSNFQGTKKSLLMSILALIFIMGNSAKEAL
VWKVLGKLGMQPGRQHSIFGDPKKVVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGYSAL*
46 >lcl|XP_003135258.1|Plus11169435..1170607 NW_003536804 protein FAM46D-like LOC100519527 __SEG__ ChrX {Sus scrofa} MSEIRFSNLTWDQVMTLDQVLNEVIPIHGRGNFPTLEVKPKDIIHVVKDQLIEQGIIVKDTRLNGSTASYILASHNGISYKDLDVIFGVELPSDQEFQVVKDVVLGCLLD
FLPKGVKKEKITLKTMKEAYVQKMVKVCNKHDRWSLISLSNNTGKNVELKFVNSLRRQFEFSVDSFQIVLDPILEFYSDKNGKLTKAFYPVVVAESMYGDFQEAMTHLQY
KLISTRKPEEIRGGGLLKYSNLLVRNFKPACEAEIKTLERYMCSRFFIDFPNVEEQQKKIESYLRNHFIGEEKSKYDYLMTLRGVVNESTVCLMGHERRQTLNMITLMAL
KVLGEQNILPNTENVTCFYQPAPYFAAEGGYPAYYVTSGPPPIFFQPYHPLHFHVPNGMV*
47 >lcl|XP_003135471.1|Plus1313802..314818 NW_003536857 putative MAGE domain-containing protein MAGEA13P-like LOC100522722 __SEG__ ChrX {Sus scrofa} MLHSPKSQSGKLEAGLQVQKEAQGLVGAQVPVAEEEAASSSLAPFIQGTPEVVPAAGTPSVPQSAERALEAIPSSKSNEGFSTQEEDPSIFRSPEFLLGSVLNKKVVELV
QFLSVKYVTKEPITEAEMLRNVIKEQKNHFPLIFSKVCECMEVVFGIEVKEVDPTNHTYVLIKTLDLTYDGMLSDDQGMPKTGLLILVLGVIFMEGNRAPEEKVWEVLNS
IGVYAGQKDFIYGEPVKLITKDLVKEKYLEYQQVPNSDPPRYEFLWGPRAHAETSKMKVLEFFAKVSGTDATSFTSWYEEALRDEKERAQDKAAAGDNTAAMASGSSGVK
SSSLSCPE*
48 >lcl|XP_003135485.1|Plus1complement(2970488..2971582) NW_003536860 putative MAGE domain-containing protein MAGEA13P-like LOC100511115 __SEG__ ChrX {Sus scrofa} MSLGHMSEHCKPEEDPHAPTEAQGLEGVQDPMVEKGEATATTTPSLTSPSAPSPITPLILGTPEEVPATGALGPLPSSKIVCFSPTAAPAMPRSQSAESSRREEEEGACI
SQDPADPESLLREELNKKMAELVQFLTVKYVTKEPITEAEMLTNVIKEHKDHFPLIFSKVSECMEIVFGIEVKEVDPSSHSYVLVRTLDLTYDGMLRDDDQSMPKTGLLI
FILGVIFMEGNRASEEKVWEVLSMMGVYAGREDFIYGEPRKLITEDLVKEQYLVYQEVPDSDPPRYEFLWGPRAYAETSKMKVLKFFAKISGTDPTSLPFWYEEALQDEK
ERGQAGAAAGDGATSTASGSSSVTSAASPALSEA*
49 >lcl|XP_003135492.1|Plus1complement(1726941..1727711) NW_003301850 melanoma-associated antigen 10-like LOC100513259 __SEG__ ChrX {Sus scrofa} MPVDQLSDLRKVVNQLFLSEEAATPSPSSASSPPPSSVEAEALLQDALLAMMADLVEFLLLKYCTKEPITKAEMLNVVLRDAQDRFPDVLSRASECMLLVFGLDLKEVDP
EEHTYTLFPTLGLTWDGVLSDHELSLPKTGLLVVVLVVISLQGDRAPEEVVWETLGVMGVCAGMVHCIYGEPRALLTQVCVQEGYLEYRQVPHSDPARYEFLWGPRAHAE
TSRLKILEHLLRVNGRVPRSCRFLAAVAVNEEEEGP*
50 >lcl|XP_003135495.2|Plus1complement(1868379..1869161) NW_003301850 melanoma-associated antigen 10-like LOC100513838 __SEG__ ChrX {Sus scrofa} MPLDRLSDLRKMVAQLFGWEEEEEEAAATPSPSSSSGPPPSSVEAEASQEDALLVMMADLVEFLLLKYRAKEPITKAEMLNVVPRDAQDRYPEVLSHASECMQLVFGLDL
KEVDPGEHTYALVPTLGLTWDGVLSDEHSLPKTGLLVVLLAVIFLEGDYAPEEVVWLELGKMGLYPGKVHCIYGEPRALLTQVWVQEGYLEYRQVPRSDPARYEFLWGRR
AHEETSKLKVLEHLLRVNGTGPRSCPSQSAEAVNEEEEGP*
51 >lcl|XP_003135498.2|Plus1complement(1823160..1823777) NW_003301850 melanoma-associated antigen 10-like LOC100514384 __SEG__ ChrX {Sus scrofa} MADCGEFCSQKYAXKEXIXKAEMLNVVLRDAQDRFPDVLSRASECMLLVFGLDLKEVDPEEHTYTLFPTLGLTWDGVLSDHELSLPKTGLLVVVLVVISLQGDRAPEEVV
WETLGVMGVCAGMVHCIYGEPRALLTQVCVQEGYLEYRQVPHSDPARYEFLWGPRAHAETSRLKILEHLLRVNGRVPRSCRFLAAVAVNEEEEGP*
52 >lcl|XP_003353574.1|Plus11987828..1988730 NW_003534113 presqualene diphosphate phosphatase-like LOC100623955 __SEG__ Chr1 {Sus scrofa} MSSPRRNIEGRPLGACAASTSSPGSPVHGGGGGGGGGGSSSRFEFQSLLNSRTPCADPTCARLRASESPVHRRGSFPLAGTNPSQASPPLLPEEDRLDLNPSFLGIALRS
LLAIDLWLSKKLGVCAGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLSRSDSWAGREVLTNLLFALLLDLLLVALIKGLVRRRRPTHNQMDMFFTLSVDKYSFPSGHA
TRAALVSRFILNHLVLAIPLRVLVVLWAFILGLSRVMLGRHNVTDVAFGFFLGYTQYSIVNYCWLSPYNAPFLFVLWNQQ*
53 >lcl|XP_003353882.1|Plus1828878..829756 NW_003534211 leucine-rich repeat-containing protein 10B-like LOC100624168 __SEG__ Chr2 {Sus scrofa} MGIAESTPDELPSDAEEQLRNGEQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFA
QLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPP
RVADTVFLVGEGAVERMAERDEPTPRPPPRRPVRTFEDEEEEDLLIGGGGSRALGPPRGSLHALEAAPGLGT*
54 >lcl|XP_003353946.1|Plus1complement(337125..338438) NW_003534233 four-jointed box protein 1-like LOC100626682 __SEG__ Chr2 {Sus scrofa} MGWRMRGAAATAGLWLLALGSLLALWGGLLPPRTELPASQTPKDRLPRRPARSGGREPAPRFPLPPPLARDARGGSLKTFRVLLTLAASSDGPPGQPPGERRRHVPTGRS
WPEERAAVHGGVFWSRGLEEQVPPGFSEAQAAAWLEAARSARVVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGA
QWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGHLRPLRAVGAELANRSQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQRATSNLHRGP
GGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGRDAAARLLRLYQHHEPHFPELAALADPHAQLLQRRLDFLAKHILHCKAKYGRRPGT*
55 >lcl|XP_003354514.1|Plus1101234..102049 NW_003534400 metallo-beta-lactamase domain-containing protein 1-like LOC100624211 __SEG__ Chr3 {Sus scrofa} MSGLVRTEPLRGDTPLLVPGDPYSVVVLLQGYAEPEGVGEALRADGSVTLVLPQAWGPASSHREPSPESHEVKTALEEAARGPILVDTAGPWAREALLGALAGQGLSPGD
VTLVVGTHGHSDHIGNLGLFPRAALLVSHDFCLPGGLYLPHGLAEERPLRLGPGLEVWATPGHGGQRDVSVVVAGTTLGTVMVVGDVFERDGDEDSWQALSEDPVAQKRS
RKRILGTADVIVPGHGAPFRVIREASPSETEGQRNSQPELVIGDKEPTVHR*
56 >lcl|XP_003354528.1|Plus1complement(163391..163819) NW_003534401 inactive Ufm1-specific protease 1-like LOC100620991 __SEG__ Chr3 {Sus scrofa} MGDKPPGFRGSRSWIGCVEASLCLDHFGGPQGRLCHVPRGAGLQGELERLYSHFAGGGGPVMVGGDADAQAKALLGVCLGPGTEAYVLVLDPHCWGAPKNPSELQAAGWV
GWQEVSTAFDPNSFYNLCLTSCNSEKQRNALD*
57 >lcl|XP_003354908.1|Plus1727655..729412 NW_003299766 tetratricopeptide repeat protein 39B-like LOC100624062 __SEG__ Chr3 {Sus scrofa} MSLALNRRENNKDDFTSFSKGENDKEEKFEDAYEMIPAATTMDLVSSLEECTTGLYLFLNNRFSDAINLIYPWSKNSIYHALIYSILMVVKAILTFDPHDIDIGLTAAKE
ALRTCNNFRRKSRMMSLSHLVSKQGIKAIEEELHAEVCYAECLILKSTVMFIQDDSVLSLLKSGINIGLSYQIYKDCQQVLTQIHNYQSKTYKHLVGGIKFGLGAFNLIL
SLVPPKTLKLLNIVGYSGDREVGLSLLHESASESHINNILSVLTLFFYYNYISVAFGVEKGHSSAIENLSLIYLQKFPNCVILKFFHARFSMLKGSFKRAQLTLEECIFI
QNEWKQVHHLCYWELMWCHIFLLEWRQAYHFADLLFQNSRWSKAIYSFAKASLLAVLPSDFLKSVGEDMSSLFLNVDNLRIRILGTSVPIEKFVAEKGQRYGSTPGWFTA
QPILEFIYAWSGFRVMSKRLELISTWLSIIDKGEELLQENPNKEYGIDDISLLNLLKGLCLKYLGKYSLAEHYLNHVIQKEKLLKYDHYLVPYSYYELGILYYLKGDYAN
AIKSLENIKNYKDYSMEARLQFRAHVALEQIAKEK*
58 >lcl|XP_003355806.1|Plus1532596..534662 NW_003534895 ataxin-1-like LOC100514525 __SEG__ Chr6 {Sus scrofa} MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGIVVAGQSQAGARVSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTF
NVASSLIQHPGIHYPPIHYTQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLTTSHLPHFVPYASLLAEGATPPPQASSPAHSFNKAPSATSPPGQLPHHSSTQPL
DLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQEGQSALEAAAANGQRQRERNLVRRESEALDSPSSKGEGQGLVPVVECVVDGQLFSGSQTAQVEVAVPAHRGTP
DTDLEVQRVVGALASQDYRVVAAQRKDEPSPLNLSHHNPDPQGEGRGSARNPAEMAEKNQARGLYTQSHQEPMKHRPVPKAMVVANGNLVPSGTDPGLLPMGSEILVASS
LDVQARATFPDKESTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQG
WSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNGNSVSQASCAPPGQLGTPRERPERTVLGPREQCDSDGKSQPSGESSRMAEPSQPEPGAQACWPAPSFQRYSMQGE
EARAALLRPSFIPQEVKLSIEGRSNAGK*
59 >lcl|XP_003355883.1|Plus1423620..424429 NW_003534947 nucleoside diphosphate-linked moiety X motif 19, mitochondrial-like LOC100620085 __SEG__ Chr6 {Sus scrofa} MSCPLRPGASNWRRAATVVLAAGWPRWVPAAPSRPQLPAEGFRLLLLERSEKQNFLPGAHVFPGGVMDAADRSSDWLRLFAPHHWPPRFGLGPAPPQRVVFPGLSDAVAR
AVDGDAGALPDDVAFRICAIREAFEEAGVLLLRPRGPLAAEREPGLALAPSLDLADWRSRVRRDAQHFLCLCAHLDCTPDIWALHDWSCWFTPFRNSDVLRFETLFFLCC
LREPPQVLSDSGEIVNCQVGCPLGVQWGTHGSLKVTTLAGGPGSPSTSQ*
60 >lcl|XP_003356225.1|Plus1596539..597525 NW_003534991 protein FAM43B-like LOC100624917 __SEG__ Chr6 {Sus scrofa} MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNREDPTYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKM
KLTLGPHGIRMQPCERGGSGGSGSRRPAHAYLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARSHKARALARLLRQTALAAFSDFKRLQRQSDARHVRQQ
HLRAGGAAASVPRAPLRRLLNAKCAYRPPPAERGRGAPRLSSIQEEDEDQDEEAEEREEGASQCERPEVLSLARELRTCSLRGAPAPPPASQPRRWKAGPRERAGQAR*
61 >lcl|XP_003356380.1|Plus1371189..371668 NW_003535019 uncharacterized protein C18orf19 homolog LOC100621714 __SEG__ Chr6 {Sus scrofa} MQWNVPKTVFRLGHRTFMEPHKAGLFGLCQNIKGPLLLYNSESRVVLAQGPQKRWLLLPAAQCSAKERKPFTAHPPQPGVLHHKQREHKLLPKRVLSSSAMSPGTPSEKK
EEPDPLQDRSISLYQRFKKTFRQYGKVLIPVHLITSAVWFGTFYYAAIK*
62 >lcl|XP_003357549.1|Plus1complement(500335..501066) NW_003535599 lipoma HMGIC fusion partner-like 3 protein-like LOC100627596 __SEG__ Chr9 {Sus scrofa} MPGAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQAGYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFF
IGLSMMLIIACIICFTLFFFCNTATVYKICAWMQLTSGECALTSAEAEVGGGPRAPKPGRGRSGRDGGLCAPLWAEQLKPLRRELWEAGTPGVPQPRHQRLVPALSRTSQ
VRGMPPRGTRRRQGGCWSESAKN*
63 >lcl|XP_003357551.1|Plus1complement(38391..39122) NW_003535600 lipoma HMGIC fusion partner-like 3 protein-like LOC100627940 __SEG__ Chr9 {Sus scrofa} MPGAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQAGYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFF
IGLSMMLIIACIICFTLFFFCNTATVYKICAWMQLTSGECALTSAEAEVGGGPRAPKPGRGRSGRDGGLCAPLWAEQLKPLRRELWEAGTPGVPQPRHQRLVPALSRTSQ
VRGMPPRGTRRRQGGCWSESAKN*
64 >lcl|XP_003357757.1|Plus157415..59286 NW_003535683 recQ-mediated genome instability protein 1-like LOC100622097 __SEG__ Chr10 {Sus scrofa} MSVTSIASRVETWLLATWHVKVPLMWLEACINWIQEENDNVNLSQAQMNKQVFEQWLLTDLRDLEYPLLPDGILEVPKGELNGFFALQIISLVDVSQPAYAQIQKLRGKN
TSNDLITAETQVVPKPWEAKPSRMLMLQLTDGIVQIQGMEYHSIPALHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAPQRVLARLIGEPDPTVSV
IPNNSNQSIPRITDVLDPTLGPSDEELLASLDESDELAANNASLERSCFSTGSSSNAIPTTQLDFEPGLISPRPKERPQNQSMPFTDGELDDFSLEEALLLEEAVQKEQM
ETKELQPMTLNRTPDESIERFSHRSNTLNNFSLICKNGNNWNKKNLSEQMTNEDKSFSCPSARDRNSSTFSVNHNVPLPHDFTNEDKNSEPYNEIEQASSSGGHSFNNKI
LNGELVSYVPKKSGDISNENERHLQSCSLRSSENSTNLSVTMDLYSPPFIYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKISDGTAYLDVGFVHEILFS
LIGFSVPEMKQLKKDPCKYQKFREGLQKCQRDLIDLCCLMTISFDPCLSKAMVLALQDVNMEHLENLKRRLKK*
65 >lcl|XP_003358326.1|Plus1332326..333390 NW_003535915 uncharacterized protein C17orf59 homolog LOC100620287 __SEG__ Chr12 {Sus scrofa} MESPRGRPGPEADLLALGEQQAAIFGGGPGRTPSEPPAGLRLSGEEEAENVEGTSRHPRASPKPSGCSFVHRPEREPREDELGRRGTPSGAESCLGAPGPEHDPHGSLRL
KNPEPPEDKPASERVCRRGSPGGGGMDVEQEKEDDEEEAAAGRTGRSFSSRLQDSRSLDGLSGACGGSGSAGGAEYGPGGGRRATISSPLELEGTVSRHGDLTHFVANNL
QLKIRLSGAPQPPPPAPARPCSAPTPTPAIPPIDPDVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQ
PVQGLARQVRDIRRTLEVLEALCK*
66 >lcl|XP_003359258.1|Plus11194962..1195774 NW_003536242 2-aminoethanethiol dioxygenase-like LOC100622768 __SEG__ Chr14 {Sus scrofa} MPRDNMASLIQRIARQACLTFRGSGGGRSSSDRGAAPGPEAPVPQGFPENLSKLKSLLTQVRAEDLNISPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIP
LHDHPGMHGMLKVLYGTVRISCMDKLEAGSGQRPRAPPPEQQFEPPLLARERDAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGPAAFLDILAPPYDPDDGRDC
HYYRVLEPVRAKEASDSACDLPREVWLLETPQADDFWCEGEPYPGPRVFP*
67 >lcl|XP_003359406.1|Plus1194833..196578 NW_003536297 metal transporter CNNM2 CNNM2 __SEG__ Chr14 {Sus scrofa} MIGCGACEPEVKMAGGPAAAALPTRKMAARRSLSARGQGVLQAAAGRLLPLLLLSCCCSAGGCAAAGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVYGQNI
NNETWSRIAFTEHERRRHSPGERGLGGPAPPEPDSGPQRCGIRTSDIIILPHIILNRRTSGIIEIEIKPLRKMEKSKSYYLCTSLSTPALGAGGSGSAGGAVGGKGGSGV
AGLPPPPWAETTWIYHDGEDTKMIVGEEKKFLLPFWLQVIFISLLLCLSGMFSGLNLGLMALDPMELRIVQNCGTEKEKNYAKRIEPVRRQGNYLLCSLLLGNVLVNTTL
TILLDDIAGSGLVAVVVSTIGIVIFGEIVPQAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPYNDLVKEELNIIQGALE
LRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGGKFCYLSLA
CSFSLHPPPYSSPLPSDQPPLGELTGISPLF*
68 >lcl|XP_003359479.1|Plus1complement(300119..300346) NW_003301319 rab3 GTPase-activating protein catalytic subunit RAB3GAP1 __SEG__ Chr15 {Sus scrofa} MAPPEEELKRMGSPEERRQNLASDFPPPAGRELILRTTVPRPAPYSRALPQRMYSVLTKEDFRLAGAFSSDTSFF*
69 >lcl|XP_003359494.1|Plus1complement(481792..482847) NW_003301344 transmembrane protein 185B-like LOC100624144 __SEG__ Chr15 {Sus scrofa} MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGVIQWSYWAVFAPIWLWKLLVLAGASVGAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTH
FWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITI
VVPLLTFEVLLVHRLDGHNVFSYVSIFVPLWLSLITLMTTTFRRKGGNHWWFGIRRDFCQFLLEICPCLREYGNISYDLHHEDSEDAEETSSVPEAPKIAPMFGKKARVV
ITQSPGKYVPPPPKLNIDMPD*
70 >lcl|XP_003360257.1|Plus1complement(796159..797424) NW_003536732 UPF0415 protein C7orf25 homolog isoform 1 LOC100517984 __SEG__ Chr18 {Sus scrofa} MSAHSMLCERIAIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLTHLRAIVESAENLEEVVSVLHVFGYTDALGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASHQQPVQYSNPHIIFAFYNSVSSPMAEKLREMGISVRGDIVAVNSLLDHPEELQLSERESDDEGPELL
QVTRVDRENILARVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFVFKEKVLTEQAEQERKEQVLPELEAFMKDKELFACESAVKDFQSILDTLGGPGERERAALL
IKRINVVPDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKDCTTDSKH*
71 >lcl|XP_003360311.1|Plus11606856..1607164 NW_003301778 DET1- and DDB1-associated protein 1-like LOC100626587 __SEG__ ChrX {Sus scrofa} MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVDLEGESSAPPRKVARTDSPDMHEDT*
72 >lcl|XP_003360513.1|Plus1complement(3025137..3026231) NW_003536860 putative MAGE domain-containing protein MAGEA13P-like LOC100624770 __SEG__ ChrX {Sus scrofa} MSLGHMSEHCKPEEDPHAPTEAQGLEGVQDPMVEKGEATATTTPSLTSPSAPSPITPLILGTPEEVPATGALGPLPSSKIVCFSPTAAPAMPRSQSAESSRREEEEGACI
SQDPADPESLLREELNKKMAELVQFLTVKYVTKEPITEAEMLTNVIKEHKDHFPLIFSKVSECMEIVFGIEVKEVDPSSHSYVLVRTLDLTYDGMLRDDDQSMPKTGLLI
FILGVIFMEGNRASEEKVWEVLSMMGVYAGREDFIYGEPRKLITEDLVKEQYLVYQEVPDSDPPRYEFLWGPRAYAETSKMKVLKFFAKISGTDPTSLPFWYEEALQDEK
ERGQAGAAAGDGATSTASGSSSVTSAASPALSEA*
73 >lcl|XP_003360524.1|Plus1complement(1815321..1816145) NW_003301850 melanoma-associated antigen 10-like LOC100156285 __SEG__ ChrX {Sus scrofa} MPVDQLRDLCKMEAELQAPAQPQTLAEALPFGSEEEAETPSTPSPSSSSVPPPSSVEAEASLWDIRRVMMADLVGYLLLKYRAKEPITKAEMLGVVPRDAQDQFPDVFCR
ASACMLLAFGLDLKEVDPGEHTYALVPTLGLTWDGVLSDDELSLPKTGLLVVVLVVIFLQGDCSLEEEIWRALGRMGVCAGKVHYIYGEPRALLTQVWVQEGYLEYRQVP
HSDPARYEFLWGPRAHAETSKVKILEHLLRVNGRVPRSCRFLPEEVVNEEEEGP*