SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor S    

ID / Description / Sequence
1 >lcl|NP_001008338.1|Plus18227233..8228477 NW_047355 mitochondrial ribonuclease P protein 1 precursor Rg9mtd1 __SEG__ Chr11 {Rattus norvegicus} MNVTVRFLRPFARYLVPYTFHRTRSNSYSRVLQRYVSSKVPSLPCHNKDSTSPPEQLELDGWKTTMKSSIQENGVSVVSDKDEDSLAATRELIEMWRLLGKEVPEHITEE
ELKTLMECASKSAKKKYLRYLYGKEMMKKAKQMKKEMKAAAREEAKRARSLEPSTGEEQRDFMFLRLWDRQTNIALGWKGVQAMQFGQPLVFDMAYDNYMKPSELQNTVS
QLLESEGWNRRNVDPFHIYFCNLEVDGAYHRELVKRYGEKWDKLLLTATEKSPVDLFPKDSIIYLTADSPNVMTTFKHDKIYIIGSFVDKNTQTGTSLAKAKRQNLATEC
LPLDKYLQWDVGNKNLTLDQMIRILLCLKNTGNWEEALKFVPRRKHTGYLEVPEHSQAAFRKLKKTKTLNSFRKGSLNVHMWKR*
2 >lcl|NP_001008558.1|Plus15144215..5145192 NW_047559 necdin homolog Ndn __SEG__ Chr1 {Rattus norvegicus} MSEQSKDLSDPNFAAEDPDTEMQVSDAVPVGVPPPAPLAANLSGPSCAPEGPMAAPQASPPPAERFEEVDPKILQQAAEEGRAHQPQSPARPIPAPPAPAQLVQKAHELM
WYVLVKDQKRMVLWFPDMVKEVMGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDRVALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRI
LGLRPWKKHSTFGDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGPRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARALREANLVAQAPRSSVSED*
3 >lcl|NP_001009437.1|Plus14995223..4996965 NW_047803 glycosyltransferase precursor RGD1304827 __SEG__ Chr8 {Rattus norvegicus} MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALGQQSLDPVPGLRIDYPKALQILMEGGTHMVCTGRTHTDRICRFKWLCYSNEAEEFIFFHGNSSVMLPNLGSR
RFQPALLDLSTVEDHNAQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAQEARLFFMEGWGEGAHFDLYKLLSPKQPLLRSQL
KTLGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFTRFMTERLNVSHAGAPLGEEYILVFSRTQNRLILNEAELLLELAQEFQMKTVTVSLEDHTFAD
VVRLVSNASMLVSMHGAQLVTALFLPRGATVVELFPYAVNPDHYTPYKTLATLPGMDLQYVAWRNMIRENTVTHPERPWDQGGITHLDRAEQARILQSREVPRHLCCRNP
EWLFRIYQDTRVDIPSLMQSIRRVVKGRPGPRRQRWAISLYPGKVREARCQASVQGATEARLSVSWQIPWNLKYLKVREVRYEVWLQEQGENTYVPYMLTLQNHTFTENI
KPFTTYLVWVRCIFNRSLLGPFADVLVCST*
4 >lcl|NP_001012124.1|Plus130868149..30868748 NW_047799 ribonuclease P 25kDa subunit Rpp25 __SEG__ Chr8 {Rattus norvegicus} MENFRKVRSEEAPAGDGDEGGSPSSGPFADLAPGAVHMRVKEGSKIRNLLAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLP
PGPTPGQTPSDPAASLSVLKNVPSLAILLSKDALDPRQLGYQPPNLSPGPSSPPTVSTSKRSLGESAAGEGTAKRSQPEPEAENEDRTA*
5 >lcl|NP_001013268.1|Plus1complement(1048084..1048740) NW_048038 melanoma antigen, family H, 1 Mageh1 __SEG__ ChrX {Rattus norvegicus} MPRGRKSRRRRNAKAAEENRNNRKIQASEASKTPMAASVTPSTPEEYLSGPEEDTSTPEKASSTLAEASSTALVQKPVTRSNFQGTKKSLLMSILALIFIMGNSAKEALV
WKVLGKLGMQPGRQHSIFGDPKKVVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGSSAP*
6 >lcl|NP_001013989.1|Plus135676120..35676494 NW_047334 membrane magnesium transporter 2 precursor Mmgt2 __SEG__ Chr10 {Rattus norvegicus} MVAWLWKVLVGVGLSALAHAAFSAAQHRSHMRLAEMKYEPLPTDIVLQTLLAFALTCYGVVHTAGDFRDRDATSELKNVTFDTLRNRPSFYVFQHSGSSLLQPSDTTRSS
NLNVPSSDDIRLKF*
7 >lcl|NP_001014032.1|Plus1complement(12067457..12068722) NW_047492 hypothetical protein LOC307008 RGD1308147 __SEG__ Chr17 {Rattus norvegicus} MSAYSMLSERIAMAKELIKRAESLSRSKKGGIEGGAKLCSKLKSELKFLQKIESGKVAIKESHLQSTNLTHLKAIVESAENLEEVVSVLRVFGYTDSLGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASRQQPVQYSNPHIVFAFYNSVSSPMADKLKDMGISVRGDIVAVNSLLNHPEEYLLSESESDDEGQELL
QVTRVDLDNVLARVAFPTEIKVDVCRRVNLDITTLITYVSAMSYGGCHFIFKEKVLTEQAEQERKERVLPQLEAFMKDKELFACESAVEDFQSILDTLGGPGERERAAVL
IKRINVVPDQPSERALKLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALAVPLPKARTNDSAH*
8 >lcl|NP_001014063.1|Plus1complement(3708902..3710077) NW_047627 hypothetical protein LOC310721 LOC310721 __SEG__ Chr2 {Rattus norvegicus} MADEGSSTKDSESFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSSNPVSEHFHPTVVGESMYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFADEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPSATNVTCYYQPAPYVSDGNFNNYYIAHPPVTYSQPYPTWLPCN*
9 >lcl|NP_001014273.1|Plus1complement(14186927..14187379) NW_047625 hypothetical protein LOC365778 LOC365778 __SEG__ Chr2 {Rattus norvegicus} MTSASEGHFDAYEALDLTEFGKNQPWWRKLFGHESRSSGEKYSVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYVKVDWTRVEKDMKKAKEQLTIR
KSAQIPTEVKSKAEEVVCFVKKNVLVTGGFFGGFLLGMAS*
10 >lcl|NP_001017474.1|Plus142638233..42638913 NW_047334 hypothetical protein LOC497934 LOC497934 __SEG__ Chr10 {Rattus norvegicus} MNVELPQQEGDDDDDDGDDEEAADRAGHSFPSRLQDSRSLDGLSGACGGGGSSSSGEAGAGGGRRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPSPVPPASG
RPCLTPAPTPTIPPIDPDVLRDLERLSRELGGRVDRLLCGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEV
LEALCK*
11 >lcl|NP_001020066.1|Plus1complement(1133060..1133962) NW_048049 hypothetical protein LOC317324 MGC114492 __SEG__ ChrX {Rattus norvegicus} MDPPENSQSANLDSTQFERETKDLEGAQVPRVEAEIETVATTSENGLDSSQSAQRTSEFSAAINSPAEVPSVGAPGGPVGEAFGPDSSRQDMLNSKVIDLILFLLLKYRR
KQQTCKAEILYMVIRGYEEHFPVIFAKASDCLRLTFGLEIVERNPRVHSYSLVHALGLTYDGMQHGFPGVPKTGLLIIVLCIIFIEDNCASEQVLWRILNNVGLYAGRDH
FVYGDPGVLITEHFVQEGYLECRQVADSDPPTKEYLWGPRAHAETTKMKLLKFFASIVKQDPKSYPTRYAEALKDEIERA*
12 >lcl|NP_001020167.1|Plus15618368..5619123 NW_047369 metallo-beta-lactamase domain containing 1 Mblac1 __SEG__ Chr12 {Rattus norvegicus} MSGPVRTEPLHGETPLLASSGSYSVVVLLRGYAEPQGVGDAVRADGTVTLVLPRGWVSDTSRRLAPSADGGAKTALEEAVRGPILVDTGGPWTRDALLEALATQGVAPGD
VTLVVGTHGHSDHIGNLGLFPQAALLVSHDFCLPGGLYLPHGLCETQPLILGSGLQVWATPGHGGQRDVSVVVEGTSLGTVVVVGDVFERLGDEDSWQDLSEDPVAQQRS
RERILSVADVVVPGHGAPFRVVREAVKSSED*
13 >lcl|NP_001025084.1|Plus14119973..4121160 NW_047492 NFKB activating protein-like Nkapl __SEG__ Chr17 {Rattus norvegicus} MSPVPGSRPNEDTLGSQKRRRGSESPPSVLQTSRFSRGFCSHLSGPEGLQPPRGADGVRPLHPVSRPRSGERPLSLGIRTLASSSSPICGGYRYHHNYAGDCSWSEDQEK
EKEESYRQRRLKERERIGELGAPEVWGLSPKIPEPDSDEHTPAEDEVKNQKSSSSDLTNEEKRTKTSHSTKKKRKKKPSKKKHKKYDSNSDSDIHSSSDSDKNKVKIKKK
EKKKKHRAKELKKKKRTKKEYNGISCKASGRELPEDVWMEQSMSADSTDLIGPEAPVTHTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECS
GYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK*
14 >lcl|NP_001025089.1|Plus1complement(46830..48824) NW_047657 tetratricopeptide repeat domain 30A1 Ttc30a1 __SEG__ Chr3 {Rattus norvegicus} MAGLSSSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSPRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPSF
YSRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFFAALQASGYQPDVSYNLALACYSNRHYAPALKHIANIIERGIRQ
HPELGVGMTTEGIDVRSVGNTVVLHQTALVEAFNLKAAIEYQLRNFEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEVVIKAVNEYDETLEKYIPVLMAQAKIYWNLENYQ
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCEIFGRSIPAVIEQPLEEERMHTGKNTVTYESRQLKALIYEII
GWNM*
15 >lcl|NP_001030026.1|Plus1781757..782638 NW_047565 phosphatidic acid phosphatase type 2 domain containing 2 Ppapdc2 __SEG__ Chr1 {Rattus norvegicus} MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGGGGSGRFEFQSLLSCRSGADPACARLRASDSPVHRRGSFPLAAACPAQVAPAPPPEDAGMNLNPSFLGIALRSLLAIDLW
LSKKLGVCAGESSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLMNLLFALLLDLLLVAVIKGLVRRRRPAHNQMDMFFTLSVDKYSFPSGHATRAALVS
RFILNHLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPLNVPVLFVLWNQQ*
16 >lcl|NP_001034091.1|Plus1complement(25406662..25407954) NW_047356 hypothetical protein LOC288031 Fam43a __SEG__ Chr11 {Rattus norvegicus} MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMK
LTVSAQGIRMVHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHT
IPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQQEEELQEEEEEEHLEGCLEEEEEEEEEEEDRVGDGDPAEEEAETQRALVVAMQLECEDLLDPLENGHEE
ALGDGGVSLGPSSGTPLPLSGCASDMKAQLSQLISDLGDLSFGNDVSTLESDLRVTRLLSGESTGSESSIEGGGLDATSASPGNPSGPADSTSLDEPYSS*
17 >lcl|NP_001037769.2|Plus1complement(23085673..23086836) NW_047773 EP300-interacting inhibitor of differentiation 3 Eid3 __SEG__ Chr7 {Rattus norvegicus} MSEEKCSLTGGEEKGEELARSLAWQHLVKQAEEDDDDDEEALKKEEEEEEEEEEEDEEEEEEGPDSSSDDLSPEAPCMHPDLLELAVDREKCRSIRRQYRQLIYTVQQNR
EDIVNTASDSLTEALEEANVLFDGVSRTREAALDAQFLVLASDLGKEKAKQLNSDMSFFNHVAFCELLLVFVGLNWMEEECEELSECDESIALSFWNMLHKEATAWMLQA
ETFHFIFGSFKAERSARKPRQEHHKRACKMEGNGDMPTKLRKLDVHANQETTEKEVERILGLLQTYFQKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRL
DQDRLPILEPTNVNQVDEENDSCSYCRKQGVISLSLQDWKNIVSTFEISEAMIKNSY*
18 >lcl|NP_001041419.1|Plus1complement(5437794..5438468) NW_047689 hypothetical protein LOC500028 LOC500028 __SEG__ Chr4 {Rattus norvegicus} MARAMSWFRATPEIPSPGEQDVFDEEADESLLVQREWQDHMRKRVQEGYRDGIDAGKAVTLQQGFNQGYKEGADVILNYGLLRGTLSALLSWCHLHGNSSTLIGKINNLL
NAVGQCEECVIKHLKSVTSPPRITDLLDSIEDLDLCHVVPPEKAVEARGDTSADISTDADRSPNGMDCSHPECCRTQEHAHLEKPSLTWILEQTSNLVKQLGISVDILQH
LRQL*
19 >lcl|NP_001073360.1|Plus14706455..4709256 NW_048043 melanoma antigen, family E, 1 Magee1 __SEG__ ChrX {Rattus norvegicus} MSLVSQNSRRRRGGRANGRKNSGKGRPAAVPGPAVPRDRSDPQILQGLGATEGPGTSVLPTPRGGSSTSVPPTASEGSSAPGQLITSEGRNTSQLPTSRKGRGTRRPPAV
SAGLNAAASITASEGASTPVLPTAPKGSKASEHLTISEGASISEQPQSHEGPNVQPTLGEGSGTSVPPTFSEESGISEPLPSGEGLSISVSPTISEGAGINEPSPASKAP
STSVPPTASNGLGINLPPTSSEGLSISVLFSASEESDISVPPPSAEGLSTSMPPPSGEVQSTWVPPIILEGCSVKVRSTSRKGRRTPVRSAACESPSPSAECLSTSLSSI
SAEGFCSSLAPCAEGSDTCELLPCGEGPSTSGLHDLEEESSISQMPLAAEGPSASGSSIEDENPEEALSCGASVGMNLCKCTSLALQKADDPSVRPKRAEGFLDFQVLRD
SENSNSITIMGLGTAHVALTLKPQDPMEQNVAELLQFLLLKDQTKYPIKESEMREFIVQEYRNQFPEILRRAAAHLECIFRFELKELDPEEHTYILLNKLGPVPFEGLED
IPNGPKMGLLMMILGQIFLNGNQAREADIWEMLWRFGVQRERRLSVFGNPKRLLSVEFVWQRYLDYRPITDCVPVEYEFYWGPRSHVETTKMKILKFMARIYNKDPMDWP
AQYNEALEEEAERDVPNNWRAVPHFRRPLFQEVSPELLASDSDAPGCPSKYSPHSWPESRLESKSRKLVQLFLLMDSTKLPIPKKGILYYIGRECSKVFPDLLNRAARTL
NHVYGTELVVLDPRNHSYTLYNRREMEDMEEIMDSPNRPGNNFLMQVLSFIFIMGNHARESAVWAFLRGLGVQNGRKHVITCRYLSQRYIDSLRVPDSDPVQYDFVWGPR
ARLETSKMKALRYVARIHRKEPQDWPDQYREALEDEANRAEAGRRPLVVRNLR*
20 >lcl|NP_001100118.1|Plus1complement(33449649..33450140) NW_047711 hypothetical protein LOC298002 RGD1306576 __SEG__ Chr5 {Rattus norvegicus} MEHYRRAGSVELPASSPMPQLPPDTLEMRVRDGSKIRNLLGLALARLEGGSTRHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTSPDTGLDPLTV
RRHVPAVWVLLSRDPLDPSECGYQPPGAPPGLGSIPSSSCGPRPRRRARDTRS*
21 >lcl|NP_001100405.1|Plus18190855..8191553 NW_048043 hypothetical protein LOC302366 RGD1562871 __SEG__ ChrX {Rattus norvegicus} MPLPSLSPAKPVVESSPETQEGVLDAAKPEGAQGPQGAQGAQGAEGAKEALWPARQDLPPAGTIAPPSGKEDQSSSTSMGTQECLASEPPEGGEGKAEEKAAVESDQEER
LLPLSEMIPYISCSICKGYLIDAATITECLHTFCKSCIVKHFEHSNRCPKCNIIVHEAKPHNNLRMDPQLQNIVYKLVSGLEEKEKKQRREFYKENRGQTPKPAAVPQPG
PSSEENTKEVVD*
22 >lcl|NP_001100406.1|Plus17632554..7633726 NW_048043 hypothetical protein LOC302368 RGD1559589 __SEG__ ChrX {Rattus norvegicus} MSEIRFSNLTWDHIVTLDRVLDEVIPIHGRGNFPTLEVKPKDIVHVVKDQLIKQGIIVKDTRLNGSTASYILASHNGISYKDLDIIFGVDLPSDQEFQVVKDAVLGCLLD
FLPKGVKKEKITLKTMKEAYVQKMVKICSNNDRWSLISLSNNTGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMVHLKY
KLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLRNHFIGEEKSKYEYLMTLHGVVNQSTVCLMGYERRQTLNMITLLAL
KVLGEQNILPSTDNVTCFYQPAPYLVLEGGYPSYYVASGPPLVYFQPCHTVQFPVQNGMM*
23 >lcl|NP_001100411.1|Plus14458751..4460322 NW_048043 melanoma antigen, family E, 2 Magee2 __SEG__ ChrX {Rattus norvegicus} MSVVSQNARQGRAETTADYSDSQGEMQATNASGPPNSMLVPEAAQGLEIPDDPQGASAPQAAQDPRDIEVLIDEQSRRLGALRVHDPLEERSVALVNFLRMKSQSEGSIR
QSEMLEFLNEYSDQFPEILRRASAYLDRVFGLNLRVLDPQTDTYNLISKPGPQTTERLAETLDMPKAGLLALVLGHILLNGNRAREASIWDLLLKVEVIDETQRINNLFG
NTRNLLTTDFVQMRFLEYWPVYGTNPLEFEFLWGSRAHREITKMEALKFIAEAHDEEPWSWPEEYNKALESDKAKERSQAAGLEFWSEDTMNDKANDVVQLAINGTEELL
PIHQDELLAHTGKEFEDVFPNILSRATLILDLFYGFSLIEVDASDHIYLLVPQPESEEEQVMLESLGRPTHEYMMPILGLIFLMGNRVKEAKIWNLLRRFNVDVGRKHAI
TCKLMRQRYLECRPLSYSNPVEYELLWGPRAHLEITKMKALEYMARLYRKQPQDWPEQYREAVEDEEARARSEATAMFFFGSM*
24 >lcl|NP_001100819.1|Plus1complement(10827172..10828179) NW_047491 hypothetical protein LOC306883 RGD1563458 __SEG__ Chr17 {Rattus norvegicus} MAQYKGTMREAGRAMHLIKKREKQKEQMEVLKQRIAEETIMKSKVDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALLREREIQLAKREQLEQRRLQLEILREKERR
RERKRKISNLSFTLDEEEDGDQEDGRQAEGAEVHSGGAKKNLGKNPDVDTSFLPDREREEEENRLREELRQEWEAKREKVKGEEVEITFSYWDGSGHRRTVRMRKGSTVQ
QFLKRALQGLRRDFRELRAAGVEQLMYVKEDLILPHYHTFYDFIVAKARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWD
KYTIR*
25 >lcl|NP_001101044.1|Plus117226409..17227611 NW_047563 zinc finger, HIT type 2 Znhit2 __SEG__ Chr1 {Rattus norvegicus} MEPAGLCGFCPAGEAVPARYTCPRCNAPYCSLRCYRAHGACAEDFYRDQVLRELRGRNASPSRLAGALRRLREQREAEDEPEETGLRPGTRPGGLSGLWERLAPAEKAAF
ERLLSRGEAGRLLPPWRPWWWGRGTGPRFLEELDDDASRDLAEPELLPARTGLESVDDAAAAGEPLAEDSSVARPPAMPARIPALASLSRSPTSPLVRFQLPNVLFAYAH
TLALYHGGDDDALLSDFCATLLDVSGALGTQQVFHSTEEALQAAAHVLEAGEHPPGPLGTRGAMQEVARILLGEGPINQKGYTLIALGHLAQTLGRARKQAVVGEERDRL
YRARKKCQFLLAWTNENEAALTPLALDCARAHRAHAVTVEEMATLTGELERLWGGPVPPAPRILIEELPG*
26 >lcl|NP_001101047.1|Plus1complement(21470411..21471289) NW_047563 leucine rich repeat containing 10-like RGD1564983 __SEG__ Chr1 {Rattus norvegicus} MGIAESTPDELPSDAEEQLRSGEQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPSDFA
QLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPP
RVADTVFLVGEGAVERMAERDEPIPRPPARRPARAFDDEEEEDLLIGSAGPRALGPARDNLRALEAPPGLGT*
27 >lcl|NP_001101096.1|Plus12767412..2768182 NW_047601 2-aminoethanethiol (cysteamine) dioxygenase Ado __SEG__ Chr20 {Rattus norvegicus} MPRDNMASLIQRIARQACLTFRGGSTGSEAPAPGFPENLSQLKSLLTQVRAEDLNIAPRKALPQPLPRNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLK
VLYGKVRISCMDKLDTGAVHRRPPPEQQFEPPLQPTEREAVRLGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGPAAFLDILAPPYDPEDGRDCHYYRVMEPIKPKEA
SGSACDLPREVWLLETPQADDFWCEGEPYPGPKVLP*
28 >lcl|NP_001101443.1|Plus1complement(2665730..2666851) NW_047719 defects in morphology 1 homolog Dem1 __SEG__ Chr5 {Rattus norvegicus} MAETGEEETASAEASGFSDISDSELVEFLDLEDAKESAVSLSKPGPSSELPGKDDKPVSLQNCKRGLDVLSPMDRFHLKYLYVTDLCTQDWCELQMVYGKELPGSLTPEK
AAVLDIGASIHLAKELELHDLVTVPTTTKEDAWAVKFLNILSMVPTLQSEGRIREFPVFGEVEGIFLVGVIDELHYTSKGELELAELKTRRRPVLPLSAQKKKDYFQVSL
YKYIFDAMVQGKVTPASLIHHTKLCVDKPLGPSVLRHARQGGVSVKSLGDLMELVFLSLTLSDLPAIDTLKLEYVHQETATTLGTEIVAFEEKEVKSKVRHFVAYWMGRR
DPQGVDVEEAWKCRTCDYVDICEWRRSSGMLSSLREPKAKKLK*
29 >lcl|NP_001101510.1|Plus13326169..3327962 NW_047762 hypothetical protein LOC314300 RGD1307704 __SEG__ Chr6 {Rattus norvegicus} MDELPNGNGAAPLKRGRGRRRRQPQPRGASVLALPLRPRKVRRHRKSAASRVAALRARALLSEDSDSNVESVRGKRERPAELPEASRSAEPRPVPVRPRPASATLPRRVE
GRAALSRNLGKPAPLPGSHVDDPERPWDSPLQQVLAELNGIPSSRRRAARLFEWLLAPLPPDHFYRRLWEREAVLVRRQDHSYYEGLFSTSDLDWMLRYEDVHFGQHLDA
ARYIDGRRETLNPPGRALPAAAWSLYQAGCSLRLLCPQAFSPTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRDPSEELALTSS
PNFSQEDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAVLPLAMQAAIEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVL
VARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVHGLPIRWEAGEPVNVGAQLTTETQVHMLQDGIARLVGEGGRLFLYYTVENSRVYHLEEPKCLEIYPQQADA
MELLLRSYPEFVRVGDLPCDSVEDQLSLATMLYDKGLLLTKTPLVLS*
30 >lcl|NP_001102383.1|Plus1complement(7099862..7100212) NW_047557 hypothetical protein LOC365238 LOC365238 __SEG__ Chr1 {Rattus norvegicus} MAASTMEAYEQVQKGPLKLKGVAELGVTKRRKKKDKDKAKMLETMGMRKKSEEEKQHCLDKRTPAQAAFEKMQEKRQTERILKKASKTHKQRVEDFNRHLDTLTEHYDIP
KVSWTK*
31 >lcl|NP_001102425.1|Plus1complement(29041934..29043283) NW_047657 four jointed box 1 Fjx1 __SEG__ Chr3 {Rattus norvegicus} MGRKMRGAAAAGLWLLALGSLLTLWGGLLPPRTELPASRPPEDRLPRHPIQSGGPAPEPRFPLPPPLVWDARGGSLKTFRALLTLAAGADNPPGRHPDDRGRHVPSGLSW
PAEHTAVHGGVFWSRGLEEQVPRGFSEAQAAAWLEVARGARVVALDRGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQ
WVQVQEELRTAHWTEGSVVSLTRWLPNLTDVVVPEPWRSEDGRLRPLRDAGGELTNLSQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMHRATSNLHRGPG
GALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYSRHEPRFPELAELADPHAQLLQRRLDFLAKHILHCKAKYGRRPGDLITL
RGREGLGYE*
32 >lcl|NP_001102712.1|Plus1complement(575861..576778) NW_047694 hypothetical protein LOC500204 RGD1562515 __SEG__ Chr4 {Rattus norvegicus} MACFGLYCGKTLLFKNSSTEIYGECGACPRGQRTNEQKYCQPCMESPELYDWLYLGFMAMLPLVSHWLCIEWDAKDSNSRGAFFQQVSALLECSMAAIVTLLVSDPVGTL
AIHSCRVLMLSDWYTMLYNPSPDYITTVHCTQEAVYPLYTIVFVYYAFCLVLMLLLRPLLVKKIQWHLYMPNQLESIYTALYFFPVLTVLQAVAGGLLYYAFPYIVLVTS
LANLAVYLVFVKIESYSDLMKKDRLLVLFSHWFLHAYGLIALSRGQQLEQDLLLLTLVPFPTLFYFFTTKFTKPSRIISEGTKGH*
33 >lcl|NP_001102835.1|Plus1complement(9723021..9723380) NW_048034 hypothetical protein LOC503429 RGD1563528 __SEG__ ChrX {Rattus norvegicus} MAAVVALMRKTRDYIKTKEFRDYITSTHFWGPVANWGLPLAAFKDMKAPPDIISGRMTTALIFYSMAFMRFAYRVQPRNYLLMACHFTNVLAQSIQASRYLNHRYGGGAT
AKATKPPAK*
34 >lcl|NP_001103008.1|Plus110600751..10601119 NW_047397 hypothetical protein LOC689412 LOC689412 __SEG__ Chr13 {Rattus norvegicus} MLTLPYISDTGTMPPERCLFGVTLNIAGILGIATIYVRYKQVHPLNPEENLIIKLNKAVLVLGILSCLGRSLVANFQKSALFIVHVCGAVLALSMGSFYMFVQTILSYQM
QPKIHSKQVFWV*
35 >lcl|NP_001119559.1|Plus1complement(4812757..4812921) NW_047778 zinc finger protein 706 Znf706 __SEG__ Chr7 {Rattus norvegicus} MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRVRVPRPKLP*
36 >lcl|NP_001119564.1|Plus17746794..7747054 NW_047544 splicing factor 3b, subunit 5 Sf3b5 __SEG__ Chr1 {Rattus norvegicus} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN*
37 >lcl|NP_001121079.1|Plus1complement(<3641..5581) NW_047657 tetratricopeptide repeat domain 30B Ttc30b __SEG__ Chr3 {Rattus norvegicus} MAGLSSSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSPRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPTY
QTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEGAEDSGGENDYDGQINLGCLLYKEGHYEAACSKFLAALQASGYQPDISYNLALAYYSSRQYAPALKHIADIIERGIRQ
HPELGVGMTTEGIDVRSVGNTIVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTIQVQDARHSRDDESAKKAVNDYDETLEKYIPVLMAQAKIYWNLENYQ
MVEKXSANLWNSVMTTMCGS*MWPMSSSCRKTSTRRPLVSMSPLSRRIMITS*VSALSY*LTSVFXTL*QVKMRKLRS**GRLRRRRNNSPMMTRTRKSTTFAL*IW**E
PFIVPKETMTLASLGLSRAWSLTIRSWELIRGIMPKDASCPYWRTCQSTQSC*GTASFKNVSSF*STVNFMAEASLLLSNSPWRRKECTRGRIRSLM
38 >lcl|NP_001127936.1|Plus121580844..21581224 NW_047762 hypothetical protein LOC299818 RGD1308261 __SEG__ Chr6 {Rattus norvegicus} MAKSLRSKWKRKMRAEKRKKNAPRELNRLKSILKVDGDALMKDVEEIATVVVPKHYQEKMQCDVAVDDEKDDMKMETEIKRNKKTLLDQHGQYPVWMNQRQRKRLKAKRE
KKRGEKQSKGRQGPGLV
39 >lcl|NP_001129366.1|Plus128580352..>28581140 NW_047762 WD repeat domain 25-like Wdr25l __SEG__ Chr6 {Rattus norvegicus} MASLVAYDDSDPESEADPARSGDAAGQMSDVSGISRPEVEFASSTGVTKEGAQHTGNSPYEDPGKQRLPLARLWRSDPGSCPSQRLQWPSKEPDSTFPTSEPPGPSLWMN
RAPVGHVPLAAACFKPLKPAWDAFTPSHTHSKLESTAGNASSSQRKRGEACVLPYIPKRLRQLQVLNPEATGGRDVEPPGSPAGCAPAPLCVAPTVSEFIQPYLNSQYRE
TTVPKKVLFHLRGHRGPVNSIQWCPVFSKSHMLLSASMDKTFK
40 >lcl|NP_001139507.1|Plus112368830..12371265 NW_047425 toll-like receptor 10 Tlr10 __SEG__ Chr14 {Rattus norvegicus} MRLISSIYTLYNIIMSTEAWAPRPTDERELISNYSNMALRKVPPDVTPATTILDLSYNLLYQFQSSDCHSFSKLRFLILCHNSIQQLDTKIFDLNKELSYLDLSYNRLQS
ITWSSLVDLRHLDLSFNDFDTLPACEEIGNMRHLETLGLSGAKIQRSDLQKIANLQFSTVFIGLNTLSHYEEGSLPVLNTTVLHIVLPMAANFWVLLCDGMKTSKVVEMS
NIGGKSQFVSYETPRTLSVENTKASTLIFHKVDLLWDDLLHVFQFVWRTSVECFQIQDLTFGGMASRDHSSFDYSNTVMKAVILESIHFRIFFIPQNKIYLFFTQMDLEN
LTISDAQMPHLLFPSHPQSFQHLNFANNILTDDLFKNPIQMPYLKTLVLRGNQLETLSLVSLFANHTSLLHLDLSQNLLQHGNGEKCMWPDTLILLNLSSNKFDGSVFRC
LPKSIQTLDLNNNKIRAVPKEIIYLKSLRELSIAFNFLTDLPGCDHFKQLSSLNIEMNLILSPSLDFFQSCQEVKTLNAGRNPFRCICEFRDFIWLEKHSKGLMSGWPDS
YACEYPLSLKGTPLKDVYLPELACNTTLLIVTIVLVILVLGLVVAFCILKFDMLWYLRVLAQCIRTQHRIRKTVREERKRSIQFHAFISYAAHDSVWVKNELIPNLETED
GSVLLCLPERNFDPDRSIAENIISCTEKSYKSIFVLSPNFVQNGWCHNELYLAHHNPFRDNYDYIIPILLEPIPSYCVPTKFPKLKALLEKKVYLEWPKDRRKHGLFWAN
LRAAINVNLSDTRGRCELQTFTKPNADCQGSTISLVRTDSF*
41 >lcl|NP_598266.1|Plus1complement(1888581..1888844) NW_047659 bladder cancer-associated protein Blcap __SEG__ Chr3 {Rattus norvegicus} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
42 >lcl|XP_001054803.1|Plus15175609..5179385 NW_047559 MAGE-like 2 Magel2 __SEG__ Chr1 {Rattus norvegicus} MSQLSTNLGDSSPPESPVPAVHSRPTVLMRAPPASSRAPPVPWDPPPVDLQAPMAAWQAPQPAWEASEGQLSAPVAQLAQPPTLGAPMVQAPSLGGAMAKPPTPGVLMVH
QPPPGAQMAQSSTPGVLMLHPSVQGGSLGAHPPPPGTPMTHPPGTSMAHPPPPPPPPPPPGTPMTHPPPPGTPMAHPPPGNPMTHPPPPGNPMVQPLPPGTPMVHGGPHG
TPMPHAPIAATPIAQQPTPGVLMAQQLTPGVLMVQPPAPGAQMVQPPPQTALMTQSPASITPMAKPSGPGVVMIHPPGARGPIIQTPVSGAPMAQTVLPPGQPLATWAPQ
GQPLILQIQSQVIRAPQQVPSVPQTPQVQLATPPGWQATTPNWQVTPQGWPTTPLTWQATQVTWQAPTIAWQAAPPVRQGPQPIRPGPPPIRPGPPPVLRQIPPVIRQIP
TVMRQAPPLIRQAPPPIRPAPHGIAGQPQLWQVLPPPPPLRQAPQARLLLPRVPGAQVPTAPPVAQIHLVPQSGPRVPQTVLPAQLSIPIPVPQVAPQSAPRAVHCPSII
WQAPKGQAPVPQELPVPQELPVPQDLPVSEELPVPQELPVPQELQMPQELPVPQELQVQQELQVPEGLQVPLEFQEVQQAQAMGWRAPKVPTHFWQSVPAQDTQEQPTQI
THVEQQQPFQGAAASPKALQTQLPTHQAQTTGLQAELPSVQVQPSWQGPPPILQAHPGTSATLTNFPRGSSRSRMTPSGEPGPSSLEPRGPPRERRAPAKDKKGPPKERM
IIGATFCAPRGAPASKAYLPTAWKNLPASSETFPATSRVFPSTSHFQPASTDAFRGPSATSESPKSLPFALQDPYACVEALPAVPWVPYPDGNSSSACKAVPTILMVTAA
APQASATDAEASKSSEPPRRSGKATRKKKHLEPKEDNCGHSMPSRDRRGPRSWENPSQNDWEIQRAMQLLGDRESLYTPQGLNDWGYPNTSRMPSSLDGPSTSRDQGFCG
GSGGSQTWMASEVPPSVSRGSSTAQEDPDRETQPLSPLDERANALVQFLLVKDQAKVPVQLSEMVNVVIREYKDDSLDIINRANTKLECTFGCQLKEVDAKTHTYIIVNK
MAYPQCNLLASYLERPKFSLLMVVLSLIFMKGYCIRENLLFSFLFQLGLDVQETSSLFRITKKLITSVFVRHRYLEYRQIPFTEPAEYELLWGPRAFLETNRVHILRFLA
ALYENQPQIWSCQYLDSLAELEYKDANDEESHDSDDDSHDPTSSPHPH*
43 >lcl|XP_001057861.1|Plus14736512..4737276 NW_048043 hypothetical protein LOC680578 __SEG__ ChrX {Rattus norvegicus} MFLRKLCVFSPSQPLDVKTKFHNSDKDDLFLEVQIQNISSATVFIQNVSLELPEKYTHKPLNTVNLDGRDECTFGTRTFLQATEGRCYLYHLQVKEEDSNRARPLSGLTK
MGSVKIMWKRELGEMAMLYTVPLEREAQSCGDLKLSLEKIPDTVVIEEPFQMTFKITNCSDRIMSLIVRMHNTPPVRWFGRSGSYLGKLIPGSSISFTLTLMCVQLGVIQ
IAGLRIIDTTVKTKYCYDGAASVCVVPSMVKMKN*
44 >lcl|XP_001061669.1|Plus11141259..1141678 NW_047816 coiled-coil-helix-coiled-coil-helix domain containing 4 LOC685505 __SEG__ Chr9 {Rattus norvegicus} MSYCWQEGKDRIIFVTKEDHETPSSAKLVADDPNDFYEEHGLILPNGDINWNCPCLGGMASSPCGEQFKSAFSCFYYSTKDIKGLDCIDQFRAMQECMQKYPDLYPQDKE
EEEEAKPMEPVEETADTKASAAKEQGASS*
45 >lcl|XP_001064935.2|Plus120709375..20710172 NW_047710 WD repeat domain 25-like LOC685709 __SEG__ Chr5 {Rattus norvegicus} MASLVAYDDSDPESEADPARSGDAAGQMSDVSGISRPEVEFASSTGVTKEGAQHTGNSPYEDPGKQRLPLARLWRSDPGSCPSQRLQWPSKEPDSTFPTSEPPGPSLWMN
RAPVGHVPLAAACFKPLKPAWDAFTPSHTHSKLESTAGNASSSQRKRGEACVLPYIPKRLRQLQVLNPEATGGRDVEPPGSPAGCAPAPLCVAPTVSEFIQPYLNSQYRE
TTVPKKVLFHLRGHRGPVNSIQWCPVFSKSHMLLSASMDKTFKVR*
46 >lcl|XP_001068178.2|Plus1680829..681683 NW_047724 TMEM200B protein-like Tmem200b __SEG__ Chr5 {Rattus norvegicus} MTAGSPGDRGARRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIAVAGYWPGRASHAHVPRTGRAHGPHERLRLLGPVIMGVGLFV
FICANTLLYENRDLETRRLRRGVLRAQALRPPDGPGWDALLPSPAHGSPGAVAEPETWDLAPRRGPSPVPSVRSLRSEPANPRSGLPALLHSYPLKGPGLPPPWGPRTQT
GHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGDLGARV*
47 >lcl|XP_001073421.2|Plus13094711..3094950 NW_047419 rCG47273-like LOC690138 __SEG__ Chr14 {Rattus norvegicus} MELEVMSRYTSPVNPAVFPHLTVVLLAIGTFFIARFFIYELTSTKYTRGIYKELLISLVASLFMGFGILFLLLWVGTYV*
48 >lcl|XP_002728093.1|Plus110103839..10104183 NW_047400 transmembrane protein 14C LOC100361993 __SEG__ Chr13 {Rattus norvegicus} MQKDSGPLVPLHYYGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGTSLLMVAKLGLSMLS
SSHP*
49 >lcl|XP_002728433.1|Plus1complement(2004583..2004987) NW_047470 transmembrane protein 60-like LOC100361056 __SEG__ Chr16 {Rattus norvegicus} MRMSLAQRVLLAWLFTLLFFIMLVLELDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKKPWYLITMLLKLAFCLALCAKLEQFTTISLSYV
FIPLWALLAGALTELGYNVFFVRD*
50 >lcl|XP_002728932.1|Plus12131478..2131897 NW_047565 coiled-coil-helix-coiled-coil-helix domain containing 4 LOC100361898 __SEG__ Chr1 {Rattus norvegicus} MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEDIKGSDCIDQFRAMQECMQKYPDLYPQDEE
EEEEAKPVEPVEETADTKASAAKEQGASS*
51 >lcl|XP_002728993.1|Plus1complement(6850143..6850367) NW_047601 transmembrane protein 167B-like LOC100360884 __SEG__ Chr20 {Rattus norvegicus} MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACIVMAFYVLFIK*
52 >lcl|XP_002729093.1|Plus156669248..56669487 NW_047625 rCG47273-like LOC100363048 __SEG__ Chr2 {Rattus norvegicus} MEIEAMNRYTNPVNPAVFPHLTVVLLAISMFSTAWFFVYEVTSTKYTRDIYKELLISLVASHFMGFGVLFLPLSVGIYV*
53 >lcl|XP_002729227.1|Plus1complement(50349..52343) NW_047657 tetratricopeptide repeat domain 30B LOC100362431 __SEG__ Chr3 {Rattus norvegicus} MAWQSSSKVPDGEFTAVVYRLIRDSRYSEAVQLLSAELQGSPRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPTY
QTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQ
HPELGVGMTIEGIDIRSVGNTAVLHQTALIEAFNLKAAIEYQLRNFEVAQETLTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTDQLRRLTKQVQEARHNRDDEIIKKAVNEYDETLEKYIPVLMAQAKIYWNLENYQ
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILGVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYEDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHMIVLCDGVVQECVQFLEHCEIFGRNIPAVLEQPLEEERIHTGKNTVTYESRLLKALIYEII
GWNM*
54 >lcl|XP_002729293.1|Plus1complement(563581..564036) NW_047660 gametocyte specific factor 1-like RGD1306224 __SEG__ Chr3 {Rattus norvegicus} MEPESIEICPYNPHHRIPLSRFQYHLASCRKKNPKKAKKMASCKYNACHVVPIRKLAEHEATCVNRSSMEEEDALGPLQVSLPRPQNEDTLQVRWLSSPDIWNVDGANCH
PMFVLKSFVPQKLVCESDIQESPGGDQCPEDPQTRTRKANF*
55 >lcl|XP_002729683.1|Plus142024059..42024289 NW_047760 hypothetical protein LOC100361944 __SEG__ Chr6 {Rattus norvegicus} MSESEPGRKWVRCMADAVVKLGTGFGLGIVFSLTFFKRRMWPLAFASGVGLGMAYSNCQHDFQAPYLLHGKYVKEQ*
56 >lcl|XP_002729837.1|Plus131179428..31179721 NW_047774 hypothetical protein LOC100362230 __SEG__ Chr7 {Rattus norvegicus} MLESELGRKWDGCMADAVLKLGTGFGLGIFSLTFFKRRTWPLAFGSGVGLGMTYSNCQRDFQAPYFFLHGKYVREQCLMLRTSQREERETVFISQEY*
57 >lcl|XP_002730098.1|Plus1complement(9363949..9364413) NW_047817 SCAN domain containing 3-like LOC684279 __SEG__ Chr9 {Rattus norvegicus} MPRDSRSRTSRVTPPASRAPQMRAAPRRAPAAQPPATAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGANAEPARPDITYQEPQGAPLQN
QHSFGPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCRIANGLI*
58 >lcl|XP_219510.1|Plus1complement(16627191..16627799) NW_047563 coiled-coil domain containing 85B Ccdc85b __SEG__ Chr1 {Rattus norvegicus} MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAVGSGAGPTPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*
59 >lcl|XP_225150.5|Plus1complement(6699036..6700889) NW_047487 RecQ mediated genome instability 1 Rmi1 __SEG__ Chr17 {Rattus norvegicus} MSVASAVLRVETWLLATWNIKVPLMWLEACVNWIQEENNSANLSQAQINKQVLEQWLLTDLRDLEHPLLPDDILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKS
TTNDLVSAETQTAPEPWQVRPSRMLMLQLTDGVTQVQGMEYQSIPALHSALPPGTKILVHGHILFRLGVLLLKAENVKVLGGEVDGLAEEYAQEKILARLIGEPDPTVSV
IPNNSNPSAPRVSGDLDAALGPSDEELLASLDESEEPAASDDVTVGRLSFSTGPSSDTAPTIQTGFEPGCNISSRPKEKLPNQPVHFTDGEFDDFSLEEALLLEETVQKE
KMEAKASQPLSLKESVGKRVEEAFSPRPGGLNHTASTHKQGNSHFSEKTSEQMIHEDTLFDCSSTRHHRKRLLAHDFTKDSKISEVDDVAQQTTNSSDVHCLSNKMLNRK
PDLSEKSSQHSKGNGHPFQTCSSRSFENNTNLSIGMDLHCPPFIYLSVLMARKPKEVTTVKVKAFIVTLTGNLSSSGGFWCVTAKVSDGTAYLDVDFIDEILTSMIGYSV
PEMKQLKKDPLKYKKFLEGLQKCQRDLIDLCCLMTVSYDPSSCKGMVLELQDVGVEHLENLKKRLNK*
60 >lcl|XP_226598.3|Plus1complement(2046655..2048694) NW_047536 similar to Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog) RGD1561758 __SEG__ Chr19 {Rattus norvegicus} MKPVHERSQECLPPKKRDLPVTSCSTNHTPSSDASEWSRGVVVAGQSQTGARVSLGGDGTEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQ
HPGIHYPPVHYAQLPSTSLQFIGSPYSLPYAVPPNFLPNPLLSPSANLATTHLPHFVPYASLLAEEAAPPPQAASPAQSFTKSSSATSPPGQLPHHSNTQPLDLAPGRMP
IYYQTSRLPAGYTLHETSTAGASPILTPQEGQSALEAAAANGQRQRERSVRRESEPLDSTSSKGESQGLVPVVECMVDGQLFSGSQTPRVEVAAPTHRGTPDTDLEVQRV
VGALASQDYRVVAAQRKDEPSPLNLSHHTLDHQGEGRGSARNPTEVVEKNQTRVFYPQSHQEPVKHRPLPKAVVVANGNLVPTGTDPSLLPVGSEILVASSLDMQARATF
PDKEPTPPPVTSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRT
AQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLGTPRERPERTILGPRDLCDSEGKNQTSGEGSRVGEPSQPEPSAQACWPAPSFQRYSMQGEEARAALLRP
SFIPQEVKLSIEGRSNAGK*
61 >lcl|XP_226872.1|Plus1complement(6411997..6412671) NW_047623 CWC15 homolog LOC310177 __SEG__ Chr2 {Rattus norvegicus} MTTAARPTFEPARGGRRKGEGDLSQLSKQYSSRDLPSHKKIKYTQTTQDAPEEVRNCDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLT
DEEDEDFEEERDDDDTAALLAELEKIKKERTEEQARKEQEQKAEEERILSGNPLLNLTGPSQPQTNFKVKRRWDDDVVFKNCAKGIDDQKKDKRFVNDTLRSEFHKKFME
KYIK*
62 >lcl|XP_229691.1|Plus1complement(5331728..5332669) NW_047761 coiled-coil domain containing 94 RGD1559848 __SEG__ Chr6 {Rattus norvegicus} MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYVYKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
EKLLEQEEKRMQKEREDEELNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLLQHRLSQEQWQQQQEEEDKRETVALLEEARYRRLLDDSDSEDEAPPS
RPQAAARPNPTAILDEVPKTKRKAEGLCRKAQLAGLVIPKKAKTEANRGSEQVQVPTTGAPESRKVANPVPQTPGASSLSQLGAYGDSEDSDS*
63 >lcl|XP_229707.2|Plus14911559..4912500 NW_047761 coiled-coil domain containing 94 RGD1560857 __SEG__ Chr6 {Rattus norvegicus} MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKICGEYIYKGKKFNARKETVQNEAYLGLPIFHFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
EKLLEQEEKRMQKEREDEELNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLLQHRLSQEQWQQQQEEEDERETVALLEEARYRRLLDDSDSEDEAPPS
RPQAAARPNPTAILDEVPKTKRKAEGLCRKAQLADLVIPKKAKTEANRGSEQVQVPTTGAPESRKVANPAPQTPGASSLSQLGAYGDSEDSDS*
64 >lcl|XP_233583.3|Plus1complement(1134994..1135986) NW_047726 family with sequence similarity 43, member B RGD1560959 __SEG__ Chr5 {Rattus norvegicus} MLPWRRNKFVLVEDEAKRKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAVGRIWARCGPGGGTKM
KLTLGPHGIRMQPSERGSGGSGGRRPAHAYLLPRITYCAADGRHPRVFTWVYRHQARHKAVVLRCHAVLLARAHKARSLARLLHQTALAAFSDFKRLQRQSDARHVRQQH
LRAGGAAASVPRAPLRRLLNAKCAYRPPPGERSRGAPRLSSIQEEDEEEDAEEEDAQDSEGGALQRERPEVLSLARELRTCSLRGAPAPPPPAQPRRWKAGSRERAGQAR
*
65 >lcl|XP_234947.3|Plus115904161..15904970 NW_047773 otubain 1 RGD1565010 __SEG__ Chr7 {Rattus norvegicus} MAAEEPQQQKQEPLGSDSEGVNCLVYDEAIMAQQDQIQQEIAVQNPLVSERLELSVLYNEYAEDDNIYQQKNLHKKYSYIRKTRPDRNCFYPAFGFSHLEALLDDSKELQ
RFKAMSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSHYLVVYLRLLTSGYLQRKSKFFEHFIEGGQTVKEFCQQEVEPMCKESDHIHIIA
LAQALSVSIQVEYMDRGEGGTTNPHVFPEGSEPKVYLLYRPGHYDILYK*
66 >lcl|XP_235505.1|Plus1814123..814578 NW_047781 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa-like RGD1306782 __SEG__ Chr7 {Rattus norvegicus} MAAWRLSLCARSLFAIRGLQAAPLRWKSSSSRAVIARSAAASKKRREEPTIQWMEDPEPEDENVYLKNPNFHGYDDDPNMDVWNMQAVFFFGFSIALVLGTTFVAYVPDY
RMLEWAHREAMMLVKYREANGLPLMESNRFDPSKINLLDNK*
67 >lcl|XP_237538.1|Plus1complement(1384133..1385035) NW_047819 leucine rich repeat containing 30 Lrrc30 __SEG__ Chr9 {Rattus norvegicus} MGVKQSRASSDDKDPKRFLVGKRQKFSSWDDTLLLGKDPRSLLKRGMRHVSFSLVTKGMTDIPDFLWGLLEVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLKSLPK
EVSLLQSLKVLFLNMNCLAEVPAELSLCRNLEVLSMSHNCLSQLPASFADLARLRKLNLSNNYFAHIPLCVFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNI
HSFPRSLCLVTSLELLNLNNNDIQTLPDELYLLCRLGRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLYSYLKDKKHN*
68 >lcl|XP_344501.1|Plus1complement(5084617..5085558) NW_047470 coiled-coil domain containing 94 RGD1563937 __SEG__ Chr16 {Rattus norvegicus} MSERKVLNKYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLAEITFKTDPENTDYTMEHGATRNFQA
EKLLEQEEKRMQKEREDEELNNPMKVLENCTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLLQHRLSQEQWQQQQEEEDERETVALLEEARYRRLLDDSDSEDEAPPS
RPQAAARPNPTAILDEVPKTKRKAEGLCRKAQLAGLVIPKKAKTEANRGSEQVRVPTTGAPESRKVANPAPQTPGASSLSQLCAYGDSEDSDS*
69 >lcl|XP_345625.1|Plus11427172..1428986 NW_047754 tetratricopeptide repeat domain 39D Ttc39d __SEG__ Chr6 {Rattus norvegicus} MSRYQRHEDNDEYLLNTLSLSEGETERMARVTRSVNLRDSETEDKFEDAHEIIPVATTMSLLSSLEECTTGLYLFLNNRFSDAINLIHPWSKNSSYHALIYSMFMVVKAI
LTFEPQDIQIGMNAAKEALKTCNNFRKKPRIMTLSRLVSRQGIKSIKEEELHAEVCYAECLVLKSAITFIQDDSLLNFLKSGVNVGSSYQIYKDCQQVLELMPENQSKTH
RHLNGGIKFGVGVFNLMFSLVPPKSLKLLNMVGYSGDREVGLALLHDSASEPHINNILSVFTLLFYYNYVRVVVGVEKASTAATESLFLVYLEKFPNCVVLKFFRARFNM
LNGNFESAKLKLQECIITQNEWKQVHHLCYWELMWCHIFLQNWKQAYNYANLLFQHSRWSKAIYTYSKAIILALLPPDSVDSENESLSSYFLRVDSLRIKFLGSSVPIEK
FIAEKSQRYGTTTGWFTAQPLLEFIYAWSGFRVMSKKIELISSWLMIIDKGKELLNENPNEEYGVDDMSLLNLLKGLCLKHLGKHLKAEHYFIRVIRKERSLKYDHYLVP
YSYYELGMLHYLKGDYTNATKNLDNIKNYKDYSMEARLQFRAHIALEQIAKLEK*
70 >lcl|XP_574204.3|Plus1complement(465184..465612) NW_047532 hematopoietic stem/progenitor cells 176-like RGD1564492 __SEG__ Chr19 {Rattus norvegicus} NAGKAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAKGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSY
TDVMCNPFYNPGDRIQSRAFDTMVTSMMAQVC*
71 >lcl|XP_576628.3|Plus12573092..2574999 NW_047819 similar to KIAA1913 RGD1561734 __SEG__ Chr9 {Rattus norvegicus} MIATGGLLRISARKQDPLRPPSQVPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMAVVGYWPKANAANRGGSKQFLPVGSIHRTGAASNSSSGNKN
PAKNHSGTPGGVNSSSVGGPRSSPPARTAATSSSSSSSSSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLRDLYSTVIDVHSL
RAKDLAAAAAAAAAAAASSSAAAPGSAPPGAAPLNGFLNYVQSRGLELKPGSCAGSADAFGAAAMLARGSWPHPAGLGGGGSGTREAGSPPDLASSPRCPREPPSLTEAV
YSIYRERSSGAGRRRTTVAAVAAATATVTAAASGGSSPAPCSPTGSWGRQSTASSLVGSSLSAFALLPLHGDRDRDRDSEGASCSWHRPPGERGSRDLPRGELDLSLTDL
RGAEGGARWASGEPEEPEGGTTACTARGQGRRLPRTGRYAAWRRRSTSGLPEYRAPPSPEPPPSGFAADLDSGPPGTVATPSLPLRPEDSPGVRRDSHSSQSDDQSSSNK
GYTPLREADTSVESVVDVVARKRLDCEAATDPSTEHSSPEGPSPEPTRVELHTGQRQFTNKEKLFLISRSHTPGVEDPELENSSN*
72 >lcl|XP_578081.2|Plus1complement(33503702..33503941) NW_047627 rCG47273-like RGD1565088 __SEG__ Chr2 {Rattus norvegicus} MELEVMGTHTSPVNPAVFPHLTAVLLAIGMFFTSWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLPLWVSVCV*
73 >lcl|XP_579917.3|Plus1complement(1498359..1498715) NW_047557 RGD1562079 RGD1562079 __SEG__ Chr1 {Rattus norvegicus} MSRLSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHASLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGTFVRPRGPTEEPVDATAPGNRLDDSDALKNPCEGTGA
RETRSDGR*