SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro S    

ID / Description / Sequence
1 >lcl|NP_001012742.1|Plus1complement(3517102..3518844) NW_003456876 glycosyltransferase precursor C3H3orf39 __SEG__ Chr3 {Pan troglodytes} MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALGRQATEPAPALRIDYPKALQILMEGGTHMVCTGRTHTDRICRFKWLCYSNEAEEFIFFHGNTSVMLPNLGSR
RFQPALLDLSTVEDHNTQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQL
KTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHAFAD
VVRLVSNASMLVSMHGAQLVTTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRAEQARILQSREVPRHLCCRNP
EWLFRIYQDTKVDIPSLIQTIRRVVKGRPGPRKQKWTVGLYPGKVREARCQASVHGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILALQNHTFTENI
KPFTTYLVWVRCIFNKILLGPFADVLVCNT*
2 >lcl|NP_001065278.1|Plus1complement(<480..686) NW_003458855 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial precursor NDUFB11 __SEG__ ChrX {Pan troglodytes} MAAGLFGLSARLLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTQWQEDPEPEDENLYEK
3 >lcl|XP_001134765.1|Plus1complement(881425..881931) NW_003458792 39S ribosomal protein L35, mitochondrial-like MRPL35 __SEG__ ChrX {Pan troglodytes} MAASAFVGAMRSSFRNLWLLNIFASPAHRNCARNASLISALSTGRFSHIRTPFVSSTPRLITSVRNLTCGHTAVIPNRVAPLLPSVLKLPVRTVIYVSTQKGKRKTVKAV
IYRFFRLHSGLWVRRKAGYKKKFWKKTPARKKQLREFVFCDKTQSKLLDKMTVSFWKR*
4 >lcl|XP_001137282.1|Plus1938832..940097 NW_003457176 UPF0415 protein C7orf25-like isoform 2 LOC463917 __SEG__ Chr7 {Pan troglodytes} MSAHSMLCERITIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLTHLRAIVESAENLEEVVSVLHVFGYTDTLGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASHQQPVQYSNPHIIFAFYNSVSSPMAEKLKEMGISVRGDIVAVNALLDHPEELQPSESESDDEGPELL
QVTRVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERATVL
IKRINVVPDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKDYTTDSEH*
5 >lcl|XP_001137447.1|Plus13935979..3936881 NW_003457279 presqualene diphosphate phosphatase PPAPDC2 __SEG__ Chr9 {Pan troglodytes} MPSPRRSIEGRPLGVSASSSSSSPGSPAHGGGGGGGGGGGSRFEFQSLLSSRATGVDPTCARLRASESPVHRRGSFPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRS
LLAIDLWLSKKLGVCAGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHA
TRAALMSRFILNHLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNAPVLFLLWSQR*
6 >lcl|XP_001138122.1|Plus1complement(158603..159013) NW_003457513 transmembrane protein 203-like TMEM203 __SEG__ Chr9 {Pan troglodytes} MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLSTYFTTIVSVRLFQDGEKRLAVLRLFWVLTVVSLKFVFEMLLCQKLAEQTR
ELWLGLITSPLSLLAQLLMIRACRVN*
7 >lcl|XP_001140777.2|Plus1319340..319924 NW_003457457 uncharacterized protein C7orf50-like isoform 1 LOC737431 __SEG__ Chr9 {Pan troglodytes} MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRTGLDAEPERSPEEQRVLERKLKKERKKEERQRLREAGLVAQHPPARRSGAEMALDYLCGWA
QKHKNWRFQKTRQTWLLLHMYDSDKVPDEHFSTLLAYLEGLQGRARELTVKKAEALMRELDEEGSDPPLPGRAQRIRQVLQLLS*
8 >lcl|XP_001144356.1|Plus12089963..2091132 NW_003459063 protein FAM46D-like isoform 1 LOC740850 __SEG__ ChrX {Pan troglodytes} MSEIRFTNLTWDQVVTLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILSSHNGISYKDLDVIFGVELPGNEEFQVVKDAVLGCLLD
FLPKDVKKEKLSPDIMKDTYVQKLVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVAAESMYGDFQEAMTHLQH
KLICTRKPEEIRGGGLLKYCSLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLHGVVNESTVCLMSYERRQILHLIAMMAL
KVLGELNILPNTRKVTCFYQPAPYFAAEAGYPIYVMPEPPPVSFQPYHPLHFRGSNGMS*
9 >lcl|XP_001146868.1|Plus12897006..2898094 NW_003456887 putative protein FAM172B-like LOC740222 __SEG__ Chr3 {Pan troglodytes} MTQELSFQKFIEQSDLLGELKYDFNEKDEFRHTETQRPFVFNYYENVLEKNSKRYQALGHLLEQYIYELLEKVCKLEKVYIPPEADKEEPRSFFFMSEKALTNHHSALLI
LLQDHGVFRAGQWSQQAIIHHGLQHGSQIPCIQMALQAHYDVIVLNPNDNFVEPKVEKEWKGLLTQNIESSSLKMVQGGSFFSLQHPPKCIPKRCSNTPEEHTAYIWDYF
ISKTEGKDIAFIVHGYGGLVFMDLLVRRRWEVMSKVYAVALIDSEHHVGHQLGSDVQLLAWIKHHCREWVTSPKPLDKPAATVFKKEFPMVSAGTEKYILAPSSSLQSIF
KYFKKALKARTTINFSRMPIVTRSSTKRKQSA*
10 >lcl|XP_001147119.2|Plus1144..1142 NW_003470885 polycomb complex protein BMI-1 isoform 2 BMI1 __SEG__ Chr10 {Pan troglodytes} IFYQAEMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSA
DAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYT
WRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATS
SG*
11 >lcl|XP_001147622.2|Plus117552..>17989 NW_003458980 melanoma-associated antigen H1 MAGEH1 __SEG__ ChrX {Pan troglodytes} MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEAL
VWKVLGKLGMQPGRQHSIFGDPKKIVTEEFVRRGYL
12 >lcl|XP_001148999.1|Plus1complement(2404736..2404984) NW_003457736 immediate early response 3-interacting protein 1-like LOC738404 __SEG__ Chr12 {Pan troglodytes} MAFTLYSLLQAALLCVSAIAMLHKERFLKNIGWRIDQRIGGFGEEPEIKSQLMNCIQSVTTVMRMPLIIVNSIAIVLLLLFG*
13 >lcl|XP_001152833.1|Plus1complement(29502220..29502648) NW_003457184 inactive Ufm1-specific protease 1-like UFSP1 __SEG__ Chr7 {Pan troglodytes} MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADARSKALLGVCVASGTEAYVLVLDPHYWGTPKSPSELQAAGWV
GWQEVSAAFDPKSFYNLCLTSLSSQQQQRTLD*
14 >lcl|XP_001154320.2|Plus1complement(8168621..8170618) NW_003456849 tetratricopeptide repeat protein 30B isoform 1 TTC30B __SEG__ Chr2B {Pan troglodytes} MAGLSGAQIPDGEFTAVVYCLIRNARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YHGRVLRLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQVNLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIR
QHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLAIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENY
PMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPVVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVI
GTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEI
IGWNI*
15 >lcl|XP_001154554.1|Plus1complement(8234643..8236640) NW_003456849 tetratricopeptide repeat protein 30A isoform 2 TTC30A __SEG__ Chr2B {Pan troglodytes} MAGQSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIR
QHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDALITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENY
PMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMYHLCIVNLVI
GTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHMIVIHDSVIQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEI
IGWNK*
16 >lcl|XP_001159521.1|Plus114372892..14373893 NW_003457733 EP300-interacting inhibitor of differentiation 3 EID3 __SEG__ Chr12 {Pan troglodytes} MKMDVSVRAAGCSDDLSSGEADIDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVSSANNSLTEALEEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSD
MNFFNQLAFCDFLFLFVGLNWMEGDPDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERTAPKTRLEHQKKVRKMEENGNMPTKLRKLDLSSYPESTEKN
VERILGLLQTYFRKCPDTPVSYFEFVVDPNSFSRTVENIFYVSFMVRDGFARIRLDEDRLPILEPMNVNQMGEGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITY
SSY*
17 >lcl|XP_001161693.1|Plus1complement(34234795..34235286) NW_003457279 alba-like protein C9orf23-like isoform 3 LOC746043 __SEG__ Chr9 {Pan troglodytes} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTV
RRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS*
18 >lcl|XP_001162885.2|Plus1758613..759734 NW_003456525 probable exonuclease V isoform 1 DEM1 __SEG__ Chr1 {Pan troglodytes} MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNTPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEK
AAVLDIGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLLIPTLQSEGHIREFPVFGEVEGVLLVGVIDELHYTAKGELELAELKTRRCPMLPLEAQKKKDCFQVSL
YKYIFDAMVQGKVTPASLIHHTKLCPEKPLGPSVLRHARQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHR
EPQGVDVEEAWKCRTCTYADICEWRKGSGVLSSTLAPQVKKAK*
19 >lcl|XP_001163393.1|Plus12058539..2059453 NW_003457926 melanoma-associated antigen G1 NDNL2 __SEG__ Chr15 {Pan troglodytes} MLQKPRNRGRSSGQAERDRDWSHGGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRAD
ILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEVWDFLRRLGVYPTKKHLIFGDPK
KLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS*
20 >lcl|XP_001164631.1|Plus119294961..19295527 NT_106996 RWD domain-containing protein 4-like LOC746498 __SEG__ Chr21 {Pan troglodytes} MNANEDQEMELEALRSIYEGDESFQELSPVSFQYRIGENGDPKALLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQ
FMENHNPINSATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE*
21 >lcl|XP_001168749.2|Plus1complement(2642..4804) NW_003466072 zinc finger CCCH domain-containing protein 11A-like LOC749429 __SEG__ Chr6 {Pan troglodytes} MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNEIVCTLWREGRCFRRVCRFRHMEIDKKRSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSTTVPESPEEEVK
ASQLSVQQNKLSVQSNPSPQLRSVMKVESSENVPSPKHPPVVINAADDDEDDDDQFPEEGDETKTPTLQPTPEVHNGLRVTSVRKPAVNIKQGECLHFGIKTLEEIKSEK
MKEKSKKQGEGSSGVSSLLLHPEPVPGPEKENVRTVVKTVTLSTKQGEEPLVRLGLTERLGKRKFSAGADSDPPSKRSLAQRLGKKVEAPETNTDETPKTAQVSKSLKER
LGMSADPNNEDATDKVNKVGEIHVKTLEEMLLERASQKHGESQTKLKTEGPSKTDDSTSGARSSSTLRIKTFSEVLAEEEHRQQEAERQKSKKDTTCMKLKTDSEIKKTV
VLPPIVASKGQSEEPAGKTKSMQEVHMKTLEEIKLEKARRVQQSSESSTSSPSQHEATPGARLLLRVTQRTWRKEEKILQEGNEVDFQSRIRMEATEASVESTGVDISKI
QVKRCATMREMRMRKQQEREKSVWTPLRGDVASCNTRVAEKPVLTAVPGITWHLTKQLPTKSSQKVEVETSGIADSLLNVKWAAQTLEKRGEAKPKVNVKQSVVKVVSSP
KLAPKRKAVEMHLAVTAAVKPLSSSSVLQEPPAKKAAVDAVVLLVSEDKSVTVPEAENPRD
22 >lcl|XP_001169780.1|Plus1complement(2136892..2137281) NW_003458657 protein LLP homolog isoform 1 LOC745749 __SEG__ Chr22 {Pan troglodytes} MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDCDVLMKDVQEIATVVVPKPKHCQEKMQCEVEDEKDDMKMETDIKRNKKTLLDQHGQYPIWTNQRQRKRLTAKRE
KRKGKSKAKAVKVAKGLAW*
23 >lcl|XP_001169842.1|Plus1complement(14671747..14672415) NW_003457217 UPF0428 protein CXorf56-like isoform 1 LOC746586 __SEG__ Chr8 {Pan troglodytes} MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQVVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCNTEDEETMYLRRPEGIELQYRKKCAKCGLLLFYQSQPKNAP
ITFIVDGAVVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRPLQELAEWEAKKVKMKGTLIDNQ
FK*
24 >lcl|XP_001173870.2|Plus1complement(1778499..1780013) NW_003458272 phosphatidylinositol-glycan biosynthesis class W protein isoform 1 PIGW __SEG__ Chr17 {Pan troglodytes} MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLIDFVVLIVPMVATLTIWASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFL
KILEKFLNISLESEYIPAISCFRVITSAFTAIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGSAMVCLEVRRRKYMEGSKLHYFTNSLYSVWPLVFLGIGRLAII
KSIGYQEHLTEYGVHWNFFFTIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYVAIHMAGVQTGLYVHKNR
SHIKDLIKVACFLLLAAISLFISLYVVQVNVEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTNKKHSQSLVPEAERMEPSLCL
ITALNRKQLIFFLLSNITTGLINLMVDTLHSSTLWALFVVNLYMFSNCLIVYVLYLQDKTIQFW*
25 >lcl|XP_003308286.1|Plus18389221..8389598 NW_003456548 brain protein I3 BRI3 __SEG__ Chr1 {Pan troglodytes} MDHKTLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPRQPPYSYLVTRTPTHHPRVYNIHSQTVTRYPTNSVVVVGGCPVCRVGGLQDCFTFLGIFLAIILFPFGFICCF
ALRKRRCPNCGATFA*
26 >lcl|XP_003308339.1|Plus1complement(2388541..2389716) NW_003456608 protein FAM46C-like isoform 1 LOC469434 __SEG__ Chr1 {Pan troglodytes} MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPNATNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN*
27 >lcl|XP_003308817.1|Plus1complement(415656..415886) NW_003456647 zinc finger protein 706-like ZNF706 __SEG__ Chr1 {Pan troglodytes} MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTRMPDPKTFKQHFESKHPKTSLPPELADVQA*
28 >lcl|XP_003309270.1|Plus1complement(5921827..5922879) NW_003456814 putative transmembrane protein 185B-like isoform 1 TMEM185A __SEG__ Chr2B {Pan troglodytes} MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASVGAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTH
FWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITI
VVPLLTFEVLLVHRLDGHNTFSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLHHEDSEDAEETSVPEAPKIAPIFGKKARVVI
TQSPGKYVPPPPKLNIDMPD*
29 >lcl|XP_003309523.1|Plus13887975..3888364 NW_003456853 protein LLP homolog LOC743986 __SEG__ Chr2B {Pan troglodytes} MAKSLWSKWKRKMRAEKRKKNAPEEVSRLKSILKLDDDVLMKDVQEIATVVVSKPKHCQEKMQCEVKDEKGDMKMETDINRNKKTLLDQHGQYPIWMNQRQRKSLKAKRE
KRKEKNKAKAVKVAKGLAW*
30 >lcl|XP_003310727.1|Plus1complement(7376703..7377272) NW_003457016 FUN14 domain-containing protein 2 FUNDC2 __SEG__ Chr5 {Pan troglodytes} METSATRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNIEGNFESLDLTEFAKKQPWWRKLFGQESGPSAEKYSMATQLFIGGVTGWCTGFIFQKVGKLAAT
AVGGGFSLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS*
31 >lcl|XP_003311066.1|Plus11198866..1199282 NW_003457100 protein FAM136A-like LOC471842 __SEG__ Chr6 {Pan troglodytes} MVELQQLRVQEVVDSMVKSLERENIWKTQGLMFWCRASCCEDSQAFTQQVHQCIECCPVPLAQVQALVTSELEKFQDHLARCTMHCNDKAKDSIDAGSKELQVKQQLDGC
VTKCVDDHMHLIPTMTKKMKEAVLSIGK*
32 >lcl|XP_003311187.1|Plus1442968..443249 NW_003457108 multiple coagulation factor deficiency protein 2-like LOC736404 __SEG__ Chr6 {Pan troglodytes} MYLTEDVINKPEAEMSLQDLQLHYFKMHDYDGNYLLDGLELSTAITHIYKEKGSEQAPLMSEDELINIRDGVLRDDDKNNDGYIDYAEFAKSL*
33 >lcl|XP_003311528.1|Plus124721823..24723298 NW_003457154 transmembrane protein 200A TMEM200A __SEG__ Chr6 {Pan troglodytes} MIATGGVITGLAALKRQDSARSQQHVNLSPSPATQEKKPIRRRPRADVVVVRGKIRLYSPSGFFLILGVLISIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNEGG
VVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQRQMNGMYTGLMGETEVKQNGSSCASRLAANTIASFSGFRSSF
RMDSSVEEDELMLNESKSSGHLMPPLLSDSSASVFGLYPPPSKTTDDKTSSSKKCETKSIVSSSISAFTLPVIKLNNCVIDEPSIDNITEDADNLKSRSRNLSMDSLVVP
LPNTSESFQPVSTVLPRNNSIGESLSSQYKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRNNSKGYMKLENKEDPM
DRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETRF*
34 >lcl|XP_003312169.1|Plus111195360..11195815 NW_003457452 LOW QUALITY PROTEIN: putative coiled-coil-helix-coiled-coil-helix domain-containing protein CHCHD2P9, mitochondrial CHCHD2P9 __SEG__ Chr9 {Pan troglodytes} MPRGSRSRTSRMAPPASRAPQMRAEPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTQGHAVTGGFSGGSNAEPARPDIAYQEPQGTQPAQQ
QQPCFYEIKQFLECAQNQGDIKLCEDFSKVLKQCRLAK*LA*
35 >lcl|XP_003312172.1|Plus115814390..15816267 NW_003457452 recQ-mediated genome instability protein 1 RMI1 __SEG__ Chr9 {Pan troglodytes} MNVTSIALRAETWLLATWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKN
TTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSV
IPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGNSSNTIPTRQSSFEPEFVISPRPKEEPSNLSMHVMDGELDDFSLEEALLLEETVQKEQ
METKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGYPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDGHSLNN
KILNREVVNYVQKRSSQISNENDCNLQSCSLRSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSGSGGIWSITAKVSDGTAYLDVDFVDEIL
TSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK*
36 >lcl|XP_003312180.1|Plus16667285..6667890 NW_003457452 required for meiotic nuclear division protein 1 homolog LOC739614 __SEG__ Chr9 {Pan troglodytes} MPAILLRAVARSHRILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQNLDLFLPDKTAGGLNKSQILEMNQKKKKRSNTSMLSPLNAACCQDEKAHLPIRKSFGTHRRV
THKPNLLGSKWFIKILKRHFLSVSTETFVPKQDFPQIKRPLKASRTRQPSRTNLPVLSVNEVKWGWPRLLCLVIIAHAKPVCVCTPALPPT*
37 >lcl|XP_003313185.1|Plus11362562..1363170 NW_003457685 coiled-coil domain-containing protein 85B CCDC85B __SEG__ Chr11 {Pan troglodytes} MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*
38 >lcl|XP_003314201.1|Plus15618469..5620769 NW_003457804 u3 small nucleolar RNA-associated protein 14 homolog C isoform 1 UTP14C __SEG__ Chr13 {Pan troglodytes} MNVNQVAENLALSHQEELVDLPKNYPLSENEDEGDSDGERKHQKLLEAISSLDGKNRRKLAERSEASLKVSEFSVSSEGSGEKLVLADLLEPIKTSSSLATVKKQLNRVK
SKKVVELPLNKEKIEQIHREVAFSKTSQVLSKWDPIILKNQQAEQLVFPLGKEQPAIAPIEHALSGWKARTPLEQEIFNLLHKNKQPVTDPLLTPMEKASLQAMSLEEAK
MHRAELQRARALQSYYEAKARKEKKIKSKKYHRVVKKGKAKKALKEFEQLQKVNPTVALEEMEKIENARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNK
ELTQKLQVASESEEEEGGTEVEELLVPHVVNEVQMNVDGPNPWMFRSCTSDTKEAATQEDPEQLPELAAHEVSASGAEERPVAEEEILLREFEERQSLRKRSELNQDAEP
ASSQETKDSSSQEVLSELRALSQKLKEKHQSRKQKASSEGTVPQVQREEPAPEEAEPLLLQRSERVQTLEELEELGKEDCFQNKELPRPLLEGQQSERTPNNRPDAPKEK
KEKEQLINLQNFLTTQSPSVRSLAVPTIIEELEDEEERDQRQMIKEAFAGDDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKRRQFLIKAPEGPPRKD
KNLPNVIISEKRNIHAAAHQVQVLPYPFTHHRQFERTIQTPIGSTWNTQRAFQKLTTPKVVTKPGHIIKPIKAEDVGYQSSSRSDLPVIQRNPKRITTRHNKEEKL*
39 >lcl|XP_003314246.1|Plus1complement(1963581..1964042) NW_003457822 gamma-glutamylaminecyclotransferase-like isoform 1 LOC467312 __SEG__ Chr13 {Pan troglodytes} MALVFVYGTLKRGQPNHRVLRDCAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRRVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPA
PTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR*
40 >lcl|XP_003314730.1|Plus1complement(10654642..10655367) NW_003457950 thioesterase superfamily member 4-like LOC467803 __SEG__ Chr15 {Pan troglodytes} MLRSCARRLRTLGALCQPPPVGRRLLGSEPRPALRSFSSEEVILKDYSVPNPSWNKDLKLLFDQFMKKCEDGSWKRLPSYKPTPTERIQDFKTHFLDPKLMKEEQVSQAQ
LFTRSFDDGLGFEYVMFYNDVEKRMVCLFQGVPYLEGPPGLIHGGAIATMIDATVGMCAMMAGGIVMTANLNISCKRPIPLCSVVTINSQLDKVEGKKFFVSSNVQSVDE
KTLYSEATSLLIKLNPAKSLT*
41 >lcl|XP_003315342.1|Plus12085947..2086279 NW_003458251 transmembrane protein 93-like TMEM93 __SEG__ Chr17 {Pan troglodytes} MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
*
42 >lcl|XP_003316205.1|Plus1121470..121688 NW_003458478 protein kish-A-like LOC100609777 __SEG__ Chr19 {Pan troglodytes} MSAIFNIQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVEVCCIVMAFSILFIQ*
43 >lcl|XP_003317448.1|Plus1143898..144941 NW_003458814 melanoma-associated antigen B1 isoform 1 MAGEB1 __SEG__ ChrX {Pan troglodytes} MPRGQKSKLRAREKRRKAREETQDLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAVSCTKSDEGAKCQGEENASFSQATTSTESSVKDPVAW
EAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDRFIEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGVIFLKGNSATEEEI
WKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSTVRARRRTTAT
TFRARSRAPFGRSSHPM*
44 >lcl|XP_003317464.1|Plus152110..53084 NW_003458828 melanoma-associated antigen B16 MAGEB16 __SEG__ ChrX {Pan troglodytes} MSQDQESPRCTHDQHLQTFSETQSLEVAQVSKPLEKTFLSSSHPLVPGKVKEAPAAKAESPLEVPQSFCSSSIAVTTTSSSESDEASSNQQEEDSPSSSEDTSDPRNVPA
DALDQKVAFLVNFMLHKYQMKKPITKADMLKIIIKDDESHFSEILLRASERLEMIFGLDVVEVDPTTHCYGLFIKLGLTYDGMLSGEKGVPKTGLLILVLGVIFMKGNRA
TEEEVWEVLNLTGVYSGKKHFIFGEPRELITKDFVKEKYLEYQQVANSDPARYEFLWGPRAKAEASKMKVLEFVAKVHGSHPHSFPSQYAEALKEEEERARARI*
45 >lcl|XP_003317544.1|Plus1complement(74841..78251) NW_003458999 protein FAM123B-like LOC465669 __SEG__ ChrX {Pan troglodytes} METQKDEAAQAKGAATSGSTREQTAEKGAKNKAAEATEGPTSEPSSSGPGRLKKTAMKLFGGKKGICTLPSFFGGGRSKGSGKGSSKKGLSKSKTHDGLSEAAHGPEDVV
SEGTGFSLPLPELPCQFPSSQSAHGALETGSRCKTSVAGATEKAVAEKVPSMPKPKKGLKGFFSSIRRHRKSKVTGAEQSEPGAKGPERVRARPHEHMSSAPQVPCFEET
FQAPRKENANPQDAPGPKVSPTPEPSPPATEKMACKDPEKPMEACASAHVQPKPAPEASSLEEPHSPETGEKVVAGEVNPPNGPVGDPLSLLFGDVTSLKSFDSLTGCGD
IIAEQDMDSMTDSMASGGQRANRDGTKRSSCLVTYQGGGEEMALPDDDDEEEEEEEEEVELEEEEEEVKEEEEDDDLEYLWETAQMYPRPNMNLGYHPTTSPGHHGHMLL
DPVRSYPGLAPGELLTPQSDQQESAPNSDEGYYDSTTPGFEDDSGEALGLVRRDCLPRDSYSGDALYEFYEPDDSLENSPPGDDCLYDLHGRSSEMFVPFLNFEPFSSSR
PPGAMETEEERLVTIQKQLLYWELRREQLEAQEARAREAHAREAHAREAYTREAYGREAYARETHTWEAHGREARTREAQAREVRSRETQVRETQARQEKPVLEYQMRPL
GPSVMGLAAGVSGTSQISHRGITSAFPTTASSEPDWRDFRPLEKRYEGTCSKKDQSTCLMQLFQSDAMFEPDMQEANFGGSPRRAYPTYSPPEDPEEEEVEKEGNATVSF
SQALVEFTSNGNLFSSMSCSSDSDSSFTQNLPELPPMVTFDIADVERDGEGKCEENPEFHNDEDLAASLEAFELGYYHKHAFNNYHSRFYQGLPWGVSSLPRYLGLPGLH
PRPPPAAMALNRRSRSLDTAETLEMELSNSHLVQGYLESDELQAQQEDSDEEDEEEEEGEWSRDSPLSLYTEPPGAYDWPAWAPCPLPVGPGPAWISPNQLDRPSSQSPY
RQATCCIPPMTTSISLSVPESRAPGESGPQLARPSHLHLPMGPCYNLQPQASQSMRARPRDVLLPVDEPSCSSSSGGFSPSPLPQAKPVGITHGIPQLPRVRPEHPQPQP
THYGPSSLDLSKERAEQGASLATSYSSTAMNGNLAK*
46 >lcl|XP_003317570.1|Plus1788415..788714 NW_003459038 putative MAGE domain-containing protein CXorf50-like LOC100614435 __SEG__ ChrX {Pan troglodytes} MLKYVIKRYRSFLPEIFKKASDLPELVFGFYLKELDPAEHSYVLIRKIDPALVWGLTGDQGTPKTRLLMITLDSIFMQASCVPEEVVWEVLRVLEAHFV*
47 >lcl|XP_003317794.1|Plus1complement(53297..53680) NW_003459252 melanoma-associated antigen 4-like LOC100612183 __SEG__ ChrX {Pan troglodytes} MSPEQRNQHCEPEESLEAEGDEALGLVGVQPPLAEEQEAASFSSPLTVGTLEGLPAAGSPGSPQSPQGTSTSPTTIDNTLWSQSNEGSSCQEEAPGTSPDPADLKTLFQE
ALDGKVTELVHFLLYKY*
48 >lcl|XP_003317797.1|Plus1111388..112344 NW_003459255 melanoma-associated antigen 8 isoform 1 MAGEA8 __SEG__ ChrX {Pan troglodytes} MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSINEEEGPSTSPDPAHLESLFRE
ALDEKVAELVRFLLRKYQIKEPVTEAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAP
EEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQVPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV*
49 >lcl|XP_003317800.1|Plus11959638..1960591 NW_003459259 melanoma-associated antigen 4 isoform 1 MAGEA4 __SEG__ ChrX {Pan troglodytes} MSSEQKSLHCKPEEGLEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGLPQSPQGASALPTTISFTRWRQPNEGSSSQEEEGPSTSPDAESLFREAL
SNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLVGNNQIFPKTGLLIIVLGTIAMEGDSASEE
EIWEELGVMGVYDGREHSVYGEPRKLLTQDWVQENYLEYRQVPGSDPPRYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV*
50 >lcl|XP_003317803.1|Plus1complement(2130704..2131078) NW_003459259 melanoma-associated antigen 5-like LOC473823 __SEG__ ChrX {Pan troglodytes} MSLEQKSQHCKPEEGLDAQEEALGLVGVQAAATEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASAFPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALS
KKVADLIHFLLLKY*
51 >lcl|XP_003317808.1|Plus1complement(8939..9883) NW_003459260 melanoma-associated antigen 12 isoform 1 MAGEA12 __SEG__ ChrX {Pan troglodytes} MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPAIEEQETASSSSTLVEVTLGEVPAAESPSPPHSPQGASTLPTTINYTLWSHSDEGSSNEEQEGPSTFPDLETSFQVALS
RKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVRIGHLYTLVTCLGLSYDGLLGDNQIVPKTGLLIIVLAIIAKEGDCAPEEK
IWEELSVLEASDGREDSVFAHPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE*
52 >lcl|XP_003317876.1|Plus148445..48879 NW_003460627 protein phosphatase 1 regulatory subunit 11-like LOC469207 __SEG__ Chr1 {Pan troglodytes} PQRQKKRRVCHPPSSFPPSPEAGAGLSETVTETTVTVTTEPENRSLTIKLPKWKPEKKVEWTSDTVDNERMSRRSSKCCSIYEKSRAFGESSTESDEEEEEGCGHTHCVR
GHRKGWRPATLGPAPTTPPRPPDPSQTHAGPMQH*
53 >lcl|XP_003318172.1|Plus1561..1133 NW_003476978 melanoma antigen preferentially expressed in tumors-like LOC739887 __SEG__ Chr22 {Pan troglodytes} MVNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECRITDDQLLALLPSLSHCSQLKTLSFYGNSISISALQSLLQH
LIGLRNLTHVLYPVPLESYEYVHGTFHLERLAYLHARLRELLCELGRPSMVWLSANPCPHCGDRSFYDPEPILCPCFMRN*
54 >lcl|XP_003318187.1|Plus11720..2661 NW_003477534 LOW QUALITY PROTEIN: melanoma-associated antigen 2-like MAGEA2 __SEG__ ChrX {Pan troglodytes} MPLEQRSQHCKPEEGLEARGEARGLVGAQAPATEEQQIASSSSTLVEVTLGEVPAADSPSPPHSPQGASSFSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAIS
RKMVELVHFLLLKYRAREPVTKAEMLESVIRNFQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVTCLGLSYDGLLGDNQIMPKTGLLIIVLAIIAIEGDCAPEEK
IWEELSMLEVFEGGEDSVFEHPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHTLKMGGEPHIPTHPCMNGL*EREKS
55 >lcl|XP_003318549.1|Plus14607646..4608128 NW_001238034 UPF0587 protein C1orf123-like LOC100613453 __SEG__ Chr7 {Pan troglodytes} MGKIALQLKATLENITNLRPVGEDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIEILSSTIKAYNAEDNENFKTIVEFECRGLEPVDF
QPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC*
56 >lcl|XP_003319057.1|Plus11018757..1018975 NW_003459298 protein kish-A-like LOC100609238 __SEG__ ChrY {Pan troglodytes} MSAIFNFQSLLTIILLLICTCVYIRSLAPSLVDRNETELLGIFWKCVRIGEWKIPYVAVCCIVMGFNILFIQ*
57 >lcl|XP_003339193.1|Plus1complement(38537770..38538030) NW_003457154 splicing factor 3B subunit 5 SF3B5 __SEG__ Chr6 {Pan troglodytes} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*
58 >lcl|XP_003339415.1|Plus110671..11618 NW_003459255 melanoma-associated antigen 9 MAGEA9B __SEG__ ChrX {Pan troglodytes} MSLAQRSPHRKPDEDLEAQGEDLGLMGAQEPTGEEQETTSSSDSEEEEVSASGSSSPPQSPQGGASSSFSVYYTLWSQFDEGSSSQEEEEPSPSVDPAQLEFMFQEALKL
KVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEFMQVIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKAALLIIILGVILTKDNCAPEEVI
WEALSVMGVYVGKEHIFYGEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV*
59 >lcl|XP_508371.2|Plus15435866..5437179 NW_003457670 four-jointed box protein 1 FJX1 __SEG__ Chr11 {Pan troglodytes} MGRRMRGAAATAGLWLLALGSLLAMWGGLLPPRTELPASRPPEDRLPRRPARSGGPAPAPRFPLPPPLAWDARGGSLKTFRALLTLAAGADGPPRQSRSEPRWHVPARRP
RPEESAAVHGGVFWSRGLEEQVPPGFSEAQAAAWLEAARGARVVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGA
QWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGRLRPLRDAGGELANLSQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQRATSNLHRGP
GGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYRRHEPRFPELAALADPHAQLLQRRLDFLAKHILHCKAKYGRRSGT*
60 >lcl|XP_509258.2|Plus1complement(873587..874774) NW_003457733 uncharacterized protein C12orf12-like LOC452117 __SEG__ Chr12 {Pan troglodytes} MTQTLDTREDPLNLGGGGGCGCGWAHSASLSSWSSCHRRRPGAPVYNRPHRYSPKTEYGPTRKQPKQQHGPGFWFQPPVCSNWGCWGGPWRPPPPGFRKFPCPVQLFRVY
GLHPLCFCCCSCWSGSWNPGWVRPPGRKKRWGRRGRGLRHHPRRSSPRSPPADVSTLPRPVKLYEWREPGMRAPPNTTQFIMNQIYEDMRQQEKVERQQEALRAQKATVS
GEASPARSSGNDAPPGGSKETWGLQETLYGFVQNPSLAFSPNPEENQSLAPLLVEEEEEKKNDDEEEYDQEVCDAKEASEEEEEVEDEEEEVEEAEYVEEGEEEEEEELE
EEEEVLEENEQRGEEFHLPLEMPLSIFIEAEEKRENFISCTFLNPEQIIPKVPQESLFMAQDFNC*
61 >lcl|XP_510046.2|Plus13237739..3239664 NW_003457850 lysine-specific demethylase NO66-like LOC453015 __SEG__ Chr14 {Pan troglodytes} MDGLQASAGPLRRGRPRRRRKPQPHSGSVLALPLRPRKIRKQLRSVVSRMAALRTQTLPSEDSEDSRVESTADDLGDALPGGAAVAAVPDAARREPYGHLGPAELLEASP
AARSLQTPPARLVPASAPPARLVEVPAAPVRVVETSALLCTAQHLAAVQSSGAPATASGPQVDNTGGEPAWDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYR
RLWEREAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYLT
PPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLAV
QAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHM
LQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLRSYPEFVRVGELPCDSVEDQLSLATMLYDKGLLLTKMPLALN*
62 >lcl|XP_510257.2|Plus1complement(186824..187789) NW_003457922 necdin NDN __SEG__ Chr15 {Pan troglodytes} MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVL
VKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLR
PWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED*
63 >lcl|XP_510676.1|Plus1complement(596392..596991) NW_003457951 ribonuclease P protein subunit p25 RPP25 __SEG__ Chr15 {Pan troglodytes} MENFRKVRSEEAPAGGGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLP
PGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPTSKRSLGEPAAGEGSAKRSQPEPGATDEDQTA*
64 >lcl|XP_511408.1|Plus1complement(3094686..3095804) NW_003458272 zinc finger protein 830 ZNF830 __SEG__ Chr17 {Pan troglodytes} MASSASARTPAGKRVVNQEELRRLMKEKQRLSTSRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHREKVAELKGAKEASQGSPASSAPQSVKRKAPDADD
QDVKRAKATLVPQVQPSTSAWTTNFDKIGKEFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSVLPNDFFSTNPPKAPII
PHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKN
KLKEILTIKELQKKEEENADSDDEGELQDLLSQDWRVKGALL*
65 >lcl|XP_511805.2|Plus146306..47340 NW_003458273 WD repeat domain phosphoinositide-interacting protein 3 WDR45L __SEG__ Chr17 {Pan troglodytes} MNLLPCNHHRNGLLYAGFDQDHRCFACGMENGFRVYNTDPLNEKEKQEFLEGGVGHVEMLFRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRD
RIVVVLDSVIKVFTFTHNPQWLHILKTCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLSCSALKLQGTRIATASEKGTLIRIFDTSSGHL
IQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDLKRNKQSSLASASFLPKYFSYKWSFSKFQVPSGSPCICAFGTQPNAVIAICADCSYYKLLFNPKGECIR
DVYAQYLEMTDDKL*
66 >lcl|XP_511857.2|Plus17496887..7497960 NW_003458335 uncharacterized protein C17orf59-like LOC455096 __SEG__ Chr17 {Pan troglodytes} MESSRGRPGPETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEEAENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGSQGTPSGAGSRRGAPGAEHEPSLSSRH
KNPAPPEGKPASGRDCRRGGPGGGMDVEQQEEEDNDEEAAAGSRAGRSFSSRLQDSRSLDGLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANN
LQLKIRLSGAPPPPPSAPARPCPAPAPTPTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELER
ALQPVQGLARQVRDIRRTLEVLEALCK*
67 >lcl|XP_513169.2|Plus1168826..169815 NW_003456507 protein FAM43B-like LOC456591 __SEG__ Chr1 {Pan troglodytes} MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKM
KLTLGPHGIRMQPCERSAAGGSGGRRPAHAYLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARAHKARALARLLRQTALAAFSDFKRLQRQSDARHVRQQ
HIRAGGAAASVPRAPLRRLLNAKCAYRPPPSERSRGAPRLSSIQEEDEEEEEDDAEEQEGGVPQRERPEVLSLARELRTCSLRGAPAPPPPAQPRRWKAGPRERAGQAR*
68 >lcl|XP_516919.2|Plus1complement(1565860..1566792) NW_003456895 melanoma-associated antigen F1 MAGEF1 __SEG__ Chr3 {Pan troglodytes} MLQTPESGGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDL
KILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMED
FVQQRYLSYRRVPHTNPPEYEFSWGPRSHLEISKMKVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASARAGIHLW*
69 >lcl|XP_516959.1|Plus1193071..194345 NW_003456900 protein FAM43A-like LOC460945 __SEG__ Chr3 {Pan troglodytes} MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMK
LTVSAQGIRMVHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHT
IPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQQEQELQEEEEEEQPEGCPEEEENRAAEGDPAEEEAAEAQRALVVAMHFECGDLLDTLENGRGEALGGGG
GSLGPGAGPPPLLLGSASDMKAELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSGQADGASADEPHSG*
70 >lcl|XP_518308.2|Plus11280143..1281342 NW_003457108 NFKB activating protein-like NKAPL __SEG__ Chr6 {Pan troglodytes} MPPVSRSSYSEDIVGSRRRRRSSSGSPPSPQSRCSSWDGCSRSHSRGREGLRPPWSESDVGALYLFSRSGSRGRLPRFRNYAFASSWSTSYSGYRHHRHCYAEERQSAED
YEKEESYRQRRLKERERIGELGAPEVWGPSPKFPQPDSDEYTPVEDEEEVTHQKSSSSDSNSEEHRKKKTSRSRNKKKRKNKSSKRKHRKYSDSDSNSESDTNSNSDDDK
KRVKAKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTMDLIGPEAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGS
FECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYKKTKGKDDK*
71 >lcl|XP_519250.1|Plus128741139..28741939 NW_003457184 metallo-beta-lactamase domain-containing protein 1-like MBLAC1 __SEG__ Chr7 {Pan troglodytes} MRTEPLCGASPLLVPGDPYSVMVLLQGYAEPEGVGDAVRADGSVTLVLPQTRGPASSHRESPRGSGGAEAALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDVTLV
VGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRV
LVVADVVVPGHGPPFRVLREASQPETEGGGNSQQEPVVGDEEPALH*
72 >lcl|XP_520285.2|Plus12846565..2846975 NW_003457485 transmembrane protein 203-like TMEM203 __SEG__ Chr9 {Pan troglodytes} MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLSTYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTR
ELWFGLITSPLFILLQLLMIRACRVN*
73 >lcl|XP_521312.3|Plus1complement(2150759..2151856) NW_003459259 melanoma-associated antigen 10 MAGEA10 __SEG__ ChrX {Pan troglodytes} MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSSSSSSSSCYPLIPSTPEEVSAADETPNPPQSAQIACSSPSVVASLPLDQSDEGFSSQKE
ESPSTLQALPDSESLPRSEIDEKVTDLVQFLLFKYQTKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKT
GILILILSIIFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEAL
KDEEERAQDRIATTDDTTAMASASSSATGSFSYPE*
74 >lcl|XP_522056.1|Plus1complement(576461..577672) NW_003457685 zinc finger HIT domain-containing protein 2 ZNHIT2 __SEG__ Chr11 {Pan troglodytes} MEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFYRDQVLGELRGRSAPPSRLASALRRLRQQRETEDEPGEAGLSSGPAPGGLSGLWERLAPGEKAAF
ERLLSRGEAGRLLPPWRPWWWNRGAGPRLLEELDNAPGSDAAELEPASARTPPDSVKDASAAEPAAAERVLGDVPGACTPVVPTRIPAIVSLSRGPVSPLVRFQLPNVLF
AYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEALQAAAHVLEAGEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAQTLGRARKQAVAREER
DHLYRARKKCQFLLAWTNENEAALTPLALDCARAHQAHAVAAEEVAALTGELERLWGGPVPPAPRTLIEELPS*
75 >lcl|XP_524230.3|Plus1332660..333007 NW_003458502 succinate dehydrogenase assembly factor 1, mitochondrial-like SDHAF1 __SEG__ Chr19 {Pan troglodytes} MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTEEPGGVGSQPDDGDSPRNPHDSTGAPET
RPDGQ*
76 >lcl|XP_525608.2|Plus1complement(18641812..18642144) NW_003457154 PHD finger-like domain-containing protein 5A-like LOC470223 __SEG__ Chr6 {Pan troglodytes} MAKHHPDLIFCHKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
*
77 >lcl|XP_525713.1|Plus1complement(5173726..5174133) NW_003456689 tRNA methyltransferase 112 homolog LOC470331 __SEG__ Chr2A {Pan troglodytes} MKLLTHNLLSSHVRGVGSRGFPLCLQATEVRICPVEFNPQLTWHHTWHVSYVVHMIPKVEWSAFLEAADSLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQC
PESGRMFPISRGIPNMLLSEEETES*
78 >lcl|XP_527232.2|Plus1complement(6765774..6766409) NW_003457102 39S ribosomal protein L48, mitochondrial MRPL48 __SEG__ Chr6 {Pan troglodytes} MSRTLEKVLCLRNNTIFKQGFSLLRLRTSAEKPIYSVGGILLSTSPPYKTKPTHAIGKYKHLIKAEEPEKKRKVEVKLINLGTDDEYGVLNIHLPAYDMTLAESYAQYVH
NFCNSLSIKVEESYVMPTKTTEVLWLQDQGSKTFLDSVLTTHERVVQMSSLSAMFAEIFLEIIQSSLPEGVRLSVKEHTEEDFKGRFKARPELEERLAELN*
79 >lcl|XP_528911.1|Plus11146181..1147212 NW_003458812 melanoma-associated antigen B18 MAGEB18 __SEG__ ChrX {Pan troglodytes} MPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSSAYLLFGDRPQNLPAAETPSIPEALQGAPSTTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKENPLNKK
VVSLVHFLLQKYETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYNETTSDEEKIPKTGLLMIALGVIFLNGNRAPEEAVW
EIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWGPRAHAETSKMKVLEFVAKMHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANA
RSRTTSSSFSHAK*
80 >lcl|XP_528913.1|Plus11183465..1184562 NW_003458812 melanoma-associated antigen B6 MAGEB6 __SEG__ ChrX {Pan troglodytes} MPRGHKSKLHTCEKRQETNGQPQGLTGPQATAEKQEESHSSSSSSRACLGDCRRSSDASIPQESQGVSPTGSPDAVVSYSKSDVAANGQDEKSPSTSRDASVPQESQGAS
PTGSLDAGVSGSKYDVAAEGEDEESVNASEKAIIFKRLSKDAVKKKACKLVQFLQKKFEKKESILKADMLKRVRREYEPYFPQILNRTSEHLVVAFGVELKEMDSSGESY
TLVSKLGLSSEGSLSGDNALPKSGLLMSLLVVIFMNGNCATEEEVWEFLGLLGIYDGILHSIYGDARKIITEDLVQDKYVVYQQVYNSDPPCYEFLWGPRAYAETTKMKV
LRVLAEGSNTSPGLYPHLYEEALIDEVERALRLRA*
81 >lcl|XP_528915.3|Plus11628080..1629123 NW_003458813 melanoma-associated antigen B10-like LOC473544 __SEG__ ChrX {Pan troglodytes} MPRGQKSKLRAREKRRQAREEPEPLMGAQATARVGRECSSSSSAHFRSTIQSSIAAKTTSNPHGPQRATCTTTTAAAVSYVRSNESTNNQTEERPRSSQALAANEHMTRS
PLDEKVFILVHYLLYKYQMKELIIKAAMLKDIVQIPRRYFSEILGKVSYHLEMVFGLDLKEMDPDRHIYFLINTLVPTHDAKLSDDRRVPRTGLLMTILGVIFTNGNCAT
EEQIWQVLNVMGLYEGRRHFIFGEPKKIITQDFVRENYLQYQQVPDSDPPRYQFLWGPRAHVETTKMKVLEFLAKIHNTVPSAFPTWYKEALRDEEERAQVRLAARAHIR
AVANARSKAIFSRFSHP*
82 >lcl|XP_528919.1|Plus1129319..130359 NW_003458814 melanoma-associated antigen B3 MAGEB3 __SEG__ ChrX {Pan troglodytes} MPRGRKSKLHARKKRQQTRGQIQDHQGAQITATNKKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVAVSYKKSYKGANSKIEKKQSFSQGLSSTVRSRTDP
LTMKTNMLVQFLMEMYKMKKPIMKADMLKIVQKSHKNRFPEILKKASFNMEVVFGVDLKKVDSTKDSYVLVSKMDLPNNGTVTRGRGFPKTGLLLNLLGVIFMKGNCATE
EKIWEFLNKMRIYDGKKHFIFGEPRKLITQDLVKLKYLEYRQVPNSNPARYEFLWGPRAHAETSKMKVLEFWAKVNQTVPSAFQFWYEEALRDEEERVQAAAMLNDGSSA
MGRKCSKAKASSSSHA*
83 >lcl|XP_528920.1|Plus1135538..136578 NW_003458814 melanoma-associated antigen B4 MAGEB4 __SEG__ ChrX {Pan troglodytes} MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDEGDKSQDEENASSSQASTSTERSLKDSLT
RKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNDGNQSSAWTLPRNGLLMPLLSVIFLNGNCAREEEI
WEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERAGAWPRVAARRGTIAM
TSAYSRATSSSSSHPM*
84 >lcl|XP_528984.3|Plus1complement(9291..10109) NW_003458924 centromere protein V-like LOC473612 __SEG__ ChrX {Pan troglodytes} MGRVRNRATAQRRRRKRPGDPPAACAAIAVMGASRAQCPRVQVGVGSHAAAKRWLGKLRRKRRWRRVREAGSRDPLPSAPLPDPPAPAESPKELDLGAQRERWETFRKLW
GLSCEGAATVLLDTFEYPGLVHHTGGCHCGAVRFAVWAPADLRVVDCSCRLCRKKQHRHFLVPASRFTLLQGAESIVTYRSNTHPALHSFCSRCGVQSFHAAVSDPRVYG
VAPHCLDEGTVRSVVIEEVGGGDPGEEAAEEHKAIHKTSSQSAPACPREQEQ*
85 >lcl|XP_529237.2|Plus11617878..1618921 NW_003458813 melanoma-associated antigen B10 MAGEB10 __SEG__ ChrX {Pan troglodytes} MPRGQKSKLRAREKRRQAREELEDLIDALAFLEEEEESPPSASACLKDVSQSSLDGASNNPHGLGEAQSTSTSATAASHTRHPEGVNDQMEERPRCTEDLEATDSFPRGP
VDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSKSQFPVILSRASEHLELIFGLDLKQVEPNKHIYVLVNKLDLGCDAKLSDETGVPKTGLLMTVLGIIFTNGNCVAE
EEVWKVFNTMGLYDGIEHFMFGEPRKLLTKDLVKENYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNNTAPSEFSDWYTEALQDEEERARARVAAKARISA
TAGARSKVKSSKSSQLQ*
86 >lcl|XP_530289.2|Plus1complement(1214323..1214586) NW_003458554 bladder cancer-associated protein BLCAP __SEG__ Chr20 {Pan troglodytes} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
87 >lcl|XP_530480.2|Plus1complement(746732..747262) NW_003456754 vacuolar protein-sorting-associated protein 25 VPS25 __SEG__ Chr2A {Pan troglodytes} MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKL
IYQWVSRSGQNNSIFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF*