SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus S    

ID / Description / Sequence
1 >lcl|NP_001001981.2|Plus1complement(20781..23123) NT_039198 U3 small nucleolar RNA-associated protein 14 homolog B Utp14b __SEG__ Chr1 {Mus musculus} MKPKMRPDPSSRANRPCEKKEAATMNMARNVTDLLALSQQEELVDLPENYPLSTSEDEGDSDGEGKRQKLLEAVSSLGRKNKWKLAERSEASRMVSEFNVTSEGSGEKLV
LSDLLGSATALSSVAAVKKQLHRVKSKTLTPPLNKEEADRALREAAFSKTSQMLSRWDPVVLKNRQAEQLIFPMEKEPPAVAPIEHVFTDWKVRTPLEQEVFNLLHKNKQ
PVTDPLLTPVETASIRAMSLEEAKIRRAELQRMRALQSYYEARARREKRIKSKKYHRALKKGKAKKALKEFEELWKDCPNAALQELEKMEKARMTERMSLKHQGSGKWAK
SKAIMAKYDPEARKAMQEQLAKNRELTQKLQVVSESEEEDGCTEEGIVSVSHGMDDLQMNADGVNPWMLSSCNSNAKRGEIKTDPEQMPEFVAHVSSESEGDERPVAEEL
VLKERSFQERVDPNNAKLMDGQETEDSDSQEVLQKLNKESHQSDNQKVSSEENVLHIQREDLASEKLLVLQRLERAHVLEQQGELSKEEHYPKKGLSRPLLKGDWKEMKP
LTNPDASGGKKKKEQMIDLRNLLTANSSPVRSLAVPTIQQLEDEVETDHKQLIREAFAGDDVIREFLKEKREAIETNKPKDLDLSLPGWGEWVGMGLKPSAKKRRRFLIK
APESSPRKDKNLPNVIISEKRNIHAAAHQVRALPHPFTHQQQFERTIQNPIGYMWNTQRTFQKLTVPKVGTKLGHIIKPIKAENVGYCSSTRSDLSILQSSQKCLSRKQQ
KQLKKLSSAD*
2 >lcl|NP_001001981.2|Plus1complement(20781..23123) NT_039198 U3 small nucleolar RNA-associated protein 14 homolog B Utp14b __SEG__ Chr1 {Mus musculus} MKPKMRPDPSSRANRPCEKKEAATMNMARNVTDLLALSQQEELVDLPENYPLSTSEDEGDSDGEGKRQKLLEAVSSLGRKNKWKLAERSEASRMVSEFNVTSEGSGEKLV
LSDLLGSATALSSVAAVKKQLHRVKSKTLTPPLNKEEADRALREAAFSKTSQMLSRWDPVVLKNRQAEQLIFPMEKEPPAVAPIEHVFTDWKVRTPLEQEVFNLLHKNKQ
PVTDPLLTPVETASIRAMSLEEAKIRRAELQRMRALQSYYEARARREKRIKSKKYHRALKKGKAKKALKEFEELWKDCPNAALQELEKMEKARMTERMSLKHQGSGKWAK
SKAIMAKYDPEARKAMQEQLAKNRELTQKLQVVSESEEEDGCTEEGIVSVSHGMDDLQMNADGVNPWMLSSCNSNAKRGEIKTDPEQMPEFVAHVSSESEGDERPVAEEL
VLKERSFQERVDPNNAKLMDGQETEDSDSQEVLQKLNKESHQSDNQKVSSEENVLHIQREDLASEKLLVLQRLERAHVLEQQGELSKEEHYPKKGLSRPLLKGDWKEMKP
LTNPDASGGKKKKEQMIDLRNLLTANSSPVRSLAVPTIQQLEDEVETDHKQLIREAFAGDDVIREFLKEKREAIETNKPKDLDLSLPGWGEWVGMGLKPSAKKRRRFLIK
APESSPRKDKNLPNVIISEKRNIHAAAHQVRALPHPFTHQQQFERTIQNPIGYMWNTQRTFQKLTVPKVGTKLGHIIKPIKAENVGYCSSTRSDLSILQSSQKCLSRKQQ
KQLKKLSSAD*
3 >lcl|NP_001005419.2|Plus1complement(9342138..9342908) NT_039500 2-aminoethanethiol dioxygenase Ado __SEG__ Chr10 {Mus musculus} MPRDNMASLIQRIARQACLTFRGSSTGSEGPAPGFPENLSLLKSLLTQVRAEDLNIAPRKALPQPLPRNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPGMHGMLK
VLYGTVRISCMDKLDTGAGHRRPPPEQQFEPPLQPLEREAVRPGVLRSRAEYTEASGPCVLTPHRDNLHQIDAVDGPAAFLDILAPPYDPEDGRDCHYYRVVEPIRPKEA
SGSACDLPREVWLLETPQADDFWCEGEPYPGPKVLP*
4 >lcl|NP_001028312.2|Plus1complement(28106992..28107348) NT_039413 succinate dehydrogenase assembly factor 1, mitochondrial Sdhaf1 __SEG__ Chr7 {Mus musculus} MSRPSRLQRQVLSLYRELLRAGRGTPGAEARVRAEFRQHASLPRTDVLRIEYLYRRGRRQLQLLRSGHATAMGTFVRPRGPAEEPGDATAPGTRLDDGGAPKNSCEDTGA
RETRSDGR*
5 >lcl|NP_001028512.2|Plus1complement(54174807..54175709) NT_039649 leucine-rich repeat-containing protein 30 Lrrc30 __SEG__ Chr17 {Mus musculus} MGTKQSRASSNDKDPKRLLLGKRQKFSSWDDTLLLGKDPRSLLKRGMRHVSFSLVTKGMTDIPDFLWGLLEVQKLNLSHNQLRVLPPEVGRLTRIVVLNLCGNCLKSLPR
EVSLLQSLKVLFLNMNCLAEVPAELSLCRNLEVLSMSHNCLSQLPASFADLSRLRKLNLSNNYFAHIPLCVFSLKELDFLHVGSNRLENIAESIQCLASLQIFIAESNNI
HSFPRSLCLVTSLELLNLNNNDIQTLPDELYLLCRLGRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLYSYLKDKKHN*
6 >lcl|NP_001028664.2|Plus1complement(31080197..31081867) NT_039706 melanoma antigen, family B, 4 Mageb4 __SEG__ ChrX {Mus musculus} MPRGQKSKARAREKRRLVQDEAQELQDAQAKAGEKGKSPSCSNQDSGDAVASTSTAGFPQKSKSQGEAPTTTARKGGACRRSRKSTRGPREESTSCTRVPRFSENPQNDL
LTRKTGMLMQYLLCKYKMKQPASKGEMLKVINRRFKEQLPEILKKASERIQLVFGLEVKEIKPNGGYYTLVSKLDPSVGNALTTSLPFPQNGLLMPLLGVIFLNGNRASE
AEIWEFLNVLGIYDGKVHIIFGEPRKLITRDLVKEKYLVYQKEANSDPPSFEFLWGPRAYAETTKMKILEFLAEVNETVPQAFPTHYEEALRDQEERAQAEAVGSPGTSA
KDKAEAKVTLVDSSCKYQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTLGSSRKYKAKSKVPLVDSSCKDQAESKVTLVDSCKDQAESKVTLVDSSCKDQAESK
VTLVDSSCKDQAESKVTLVDPSCKDKAKSKVTLGSSHKYKAKSKVTLVDSSCKDQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTLGSSRKYKAKSKVPLVDSS
GKDKAV*
7 >lcl|NP_001074399.1|Plus1complement(37088819..37090882) NT_078575 ataxin-1-like Atxn1l __SEG__ Chr8 {Mus musculus} MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQTGARVSLGGDGTEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTF
NVASSLIQHPGIHYPPVHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATTHLPHFVPYASLLAEEATPPPQAASPAQSFNKSSSATSPPGQLPHHSNTQPL
DLAPGRMPIYYQMSRLPAGYTLHETSTAGASPILTPQEGQSALEAAAANGQRQRERNVRRESEALDSASSKGESQGLVPVVECMADGQLFSGSQTPRVEVAAPAHRGTPD
TDLEVQRVVGALASQDYRVVAAQRKDEPSPLNLSHHNLDHQGEGRGSARNPTELVEKSQARVFYPQSHQEPVKHRPLPKAMVVANGNLVPTGTDPSLLPVGSEILVASSL
DLQARATFPDKEPTPPPVTSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGW
SSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLGTPRERPERTVLGPRDLCDSEGKNQPSGEGSRVGEPSQPEPGAQACWPAPSFQRFSMQGEE
ARAAMLRPSFIPQEVKLSIEGRSNAGK*
8 >lcl|NP_001074697.1|Plus1complement(16855531..16857525) NT_039207 tetratricopeptide repeat protein 30A2 Ttc30a2 __SEG__ Chr2 {Mus musculus} MAGLSNSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPTF
YSRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFFAALQASGYQPDVSYNLALACYSNRHYAPALKHIANIIERGIRQ
HPELGVGMTTEGIDVRSVGNTVVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEVVIKAVNEYDETLEKYIPVLMAQAKIYWNLENYP
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCEIFGRNIPAVIEQPLEEERMHIGKNTVTYESRQLKALIYEII
GWNM*
9 >lcl|NP_001074945.1|Plus115382895..15383584 NT_039706 predicted gene 14725 Gm14725 __SEG__ ChrX {Mus musculus} MFNAAQSRIDRMAMEDGITPEQAFTNQTTAAGNPSMGPLRPHKRSNIPVSAPAESPTQATHKPCKLVSSYNDTEYPSATIDMDVPGYERTSHSCYLRYGRTLSSYDPCRY
ILNAALSVITAWENTLEEEEEEEEEEEMEEEDEDEEDEEMEEEDEDEEEEMEEDEEEEDKEGEDEEEEYYTMEEEEYEEYEEYEEECEDDDDHYTENNCIICALFKFIRM
LFSPGRGTA*
10 >lcl|NP_001075141.1|Plus1complement(7830664..7831656) NT_039267 family with sequence similarity 43, member B Fam43b __SEG__ Chr4 {Mus musculus} MLPWRRNKFVLVEDEAKRKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAVGRIWARCGPGGGTKM
KLTLGPHGIRMQPSERSSGASGGRRPAHAYLLPRITYCAADGRHPRVFTWVYRHQARHKAVVLRCHAVLLARAHKARSLARLLHQTALAAFSDFKRLQRQSDARHVRQQH
LRAGGAAASVPRAPLRRLLNAKCAYRPPPGERGRGAPRLSSIQEEDEEEDAEEEDTRDSEEGALQRERPEVLSLARELRTCSLRGAPAPPPPAQPRRWKAGSRERAGQAR
*
11 >lcl|NP_001078975.1|Plus1complement(17211855..17212832) NT_039706 melanoma-associated antigen 10 Magea10 __SEG__ ChrX {Mus musculus} MPRPRKRRRCMVEGQPEAQSVAVTMEEDSSSSSSTYSSSFPSSFSSTSSSYALTSGNSEEGCAASRASSPHSPPGAGSSCTAMISSPRSQVSADSEGEDSPGSSQALPCG
TSLSTGEIDVKVDELVKYLLLKYLMQEPVSKAEILSNIIRNYQDHFAVIFREALECMQLVFGLELKEIDPASHTYILTIALELTYDGMMTDVQGIPKTGLLIMVLSIIFM
EGNCVSEDMVWSILNNIGLYAGNEHFIYGEPRKLITDNFVQEGYLEYRHVPGSNPPFYEFLWGPRAYAETTKMKILTFLTSINGSDPRSFPVWYAEALRDEEQQE*
12 >lcl|NP_001092280.1|Plus152007939..52008484 NT_096135 peptidyl-tRNA hydrolase 2, mitochondrial isoform b Ptrh2 __SEG__ Chr11 {Mus musculus} MLSKFLTMEYLVHPGTLSLAAGVACGMCLGWGLRSHLGMFPQNSTSEANRDTETGTEASILGESGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSPQVLKEW
EYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKLY*
13 >lcl|NP_001094920.1|Plus135721588..35722580 NT_039706 hypothetical protein LOC212952 Gm44 __SEG__ ChrX {Mus musculus} MPRGQKSKLNARERRHRARNYAQASEGAEETVVATEESSPKSCGTSEMPEKKSVSTVTVDLFSISDDSFIDLEDAEDLFRDYHTISHQDILTQKVFVLVQILLKNYKTKQ
LTTIEDMMQVIDEEEMDDFPEILRKAAERLADVFAVELREVESSRRVYDLISKLKLPNNGRVRAGQGFPKTGFLMTVLGIIFMNGNCAGEEDIWRTLRSMGIYSGKKHQI
FGEPRKLITQNFVKLKYVECRQVANSKPPRYEFLWGPKAYAETNKMAILKFVAKVNEISPSYFKDLYKEALKDDQGKNQGNHNVSSAIHLKDRAFSFVMCPRLAFSNVEV
*
14 >lcl|NP_001094954.1|Plus15820335..5820694 NT_039700 brain protein 44-like protein 2 Gm4984 __SEG__ ChrX {Mus musculus} MAAVAALMRKTLDYLKTKEFRDYITSTHFWGPVANWGLPLAAFKDMKAPPDIISGRMTTALIFYSMAFMRFAYRVQPRNYLLLACHFSNVLAQSIQAGRFLKHQYGGGAK
AKATNPPAK*
15 >lcl|NP_001095067.1|Plus117864960..17865337 NT_039472 hypothetical protein LOC638580 Gm7244 __SEG__ Chr9 {Mus musculus} MGLAVDPNRAVPLRKRKVKAMEVDTEERPKDLVRKPCVVKDLEAEASLPEKKGSTLSLDLLIDYVHYMVENHEEDDKAMARDKKNYYQETPKRIPNKVDVYKPFYPMECQ
AFIDDSLQNKKMGVD*
16 >lcl|NP_001104610.1|Plus1complement(3642822..3643700) NT_039687 LRRC10-like protein ENSP00000367315 Lrrc10b __SEG__ Chr19 {Mus musculus} MGIAESTPDELPSDAEEQLRSGEQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPPDFA
QLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPP
RVADTVFLVGEGAVERMAERDEPIPRQPARRPTRAFDDEEEEDLLIGGAGPRALGPTRDSLRALEAPPGLGT*
17 >lcl|NP_001108150.1|Plus136221946..36222980 NT_039706 hypothetical protein LOC278167 Gm5072 __SEG__ ChrX {Mus musculus} MPRGNKSKSRSRAKRQQMRGEKPKLQGAQPTGKEEGKAASPALDQGDGPSSSDRGTAQESQEAASHISPELNVSHPVHDVGAEGSFAGVDERRANVSIIADAIQCARRDP
LTRKASKVLHYLLEKYQKDEQPVEGEMLKLIGRKYKVHFPQILEKATYQLELVYGLELKVDNPATHSYVLVSKLPILPGADVGGRRELPKTGLILTILGMIFMKGNRATE
EEVWQFLHMQGIYPGRRHLIFGEPRNFITKVLVEQNYVEYRQVPGSDPPTHEFLWGPRAHEESTYRKVMDILAKIKSAIPSYYPQQYEETLSNQAERAARRDEAGGFHAA
RIPSHAQASSSSHI*
18 >lcl|NP_001123358.1|Plus1complement(204054..204608) NT_039229 hypothetical protein LOC100039043 Gm10731 __SEG__ Chr3 {Mus musculus} MTTNTSTTTTATVARSISSFTDPHHFPSHNHIIRMASASQGHFDAYEALDLTEFAKKQPWWRKLFGQESRSAGEKYSVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGG
FFLLQLANHTGYIKVDWSRVEKDMKKAKEQLTIRKSAQIPTEVKSKAEEVVCFVKKNVLVTGGFFGGFLLGMAS*
19 >lcl|NP_001136424.1|Plus1complement(150682..151857) NT_039250 hypothetical protein LOC74645 Fam46c __SEG__ Chr3 {Mus musculus} MAEEGSSTKDSESFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSGNPISEHFHPTVIGESMYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPSATNVTCYYQPAPYVSDGNFNNYYIAHPPITYSQPYPTWLPCN*
20 >lcl|NP_001136424.1|Plus1complement(150682..151857) NT_039250 hypothetical protein LOC74645 Fam46c __SEG__ Chr3 {Mus musculus} MAEEGSSTKDSESFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRGRLEEAGINVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSGNPISEHFHPTVIGESMYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPADQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFSDEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPSATNVTCYYQPAPYVSDGNFNNYYIAHPPITYSQPYPTWLPCN*
21 >lcl|NP_001156576.1|Plus152649760..52650932 NT_039706 hypothetical protein LOC213449 Fam46d __SEG__ ChrX {Mus musculus} MSEIRFSNLTWDHIVTLDRVLHEVIPIHGRGNFPTLEVKPKDIIHIVKDQLIKQGIVVKDTRLNGSTASYILASHNGISYKDLDIIFGVDIPSDEEFHVVKDAVLSCLFD
FLPKGVKKEKITLKTMKEAYVQKMVKICNNHDRWSLISLSNNNGKNVELKFVNSLRRQFEFSVDSFQILLDSMLDFYSVPNAKLTKESCPVVVAESMYGDFQEAMIHLKY
KLISTRKPEEIRGGGLLKYSNLLVRDFKPACQTEIKTLERYMCSRFFIDFPDVAEQQKKIESYLHNHFIGEAKNKYDYLMTLHGVVNQSTVCLMGYERRQTLNMITLLAL
KVLGEQNILPSTDNVTCFYQPAPYLVLEGGYPSYYVASGLPLVYFQPCHTVQFPVQNGMM*
22 >lcl|NP_001164450.1|Plus173121..73606 NT_111920 chch domain containing protein Gm6222 __SEG__ ChrX {Mus musculus} MLRGSRSCTSQVTPPASRSCTSQVTPLASQAPQMRAAPLRAPAAQPPAAAAPSAVGSPAAAPQMAQMATTAAGVAVGSAVGHTLGHTITGGFSGGGSAEPAKPDITYQEP
QGAQLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFKEVLRQCRIANGLI*
23 >lcl|NP_001164450.1|Plus173121..73606 NT_111920 chch domain containing protein Gm6222 __SEG__ ChrX {Mus musculus} MLRGSRSCTSQVTPPASRSCTSQVTPLASQAPQMRAAPLRAPAAQPPAAAAPSAVGSPAAAPQMAQMATTAAGVAVGSAVGHTLGHTITGGFSGGGSAEPAKPDITYQEP
QGAQLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFKEVLRQCRIANGLI*
24 >lcl|NP_001170827.1|Plus1complement(23595253..23595516) NT_039170 bladder cancer associated protein Gm3852 __SEG__ Chr1 {Mus musculus} MYCLQCLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNRFLYHCSDSTLPESAHDPSVVGT*
25 >lcl|NP_032571.2|Plus1complement(62821265..62822257) NT_039207 melanoma antigen family B, 3 Mageb3 __SEG__ Chr2 {Mus musculus} MPRGQKSKSRSRAKRQQSRREVQVVQPTAEEAGSSPVDLSAGSSFPGGSAPQGVKNPGSFGAGVSCTGSGIGGRNATVLPDTKSSDGTQAGTSIQHTLKDPIMRKASVLI
EFLLDKFKMKEAVTRSEMLAVVNKKYKEQFPEILRRTSARLELVFGLELKEIDPSTHSYLLVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHG
VGVYAGKKHLIFGEPEEFIRDVVQENYLEYRQVPGSDPPSYEFLWGPRAHAETTKMKVLKVLAKVNGTVPSAFPNLYQLALRDQAGGVPRSRVQGKGVHSKAPSQKSSNV
*
26 >lcl|NP_033370.2|Plus153274848..53276065 NT_039500 pleckstrin homology-like domain family A member 1 Phlda1 __SEG__ Chr10 {Mus musculus} MRRTPAAERLSELGFPPRRGRQEPPFPLGVTRGWGGWPIEKRREGPRPVPFSERSPEDGREQPAHGSGILWRVRTRLSLCRDPEPPPPPPPLCLLRVSLLCALRAGGRGS
RWGEDGAGLLLLPPAGASGSLKAERSSSTPYAGRMLENSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQQQQQQQQPGQGTAEPSQPSGPTVASLEPP
VKLKELHFSNMKTVDCVERKGKYMYFTVVMTEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQPPQTQQIQPQPQPQIQPQPQPQIQPQPQPQ
PQPQPQPQPQPQPQQLHSYPHPHPHPYSHPHQHPHPHPHPHPHPHPHPYQLQHAHQPLHSQPQGHRLLRSTSNSA*
27 >lcl|NP_034348.2|Plus1complement(43331695..43333047) NT_039207 four-jointed box protein 1 precursor Fjx1 __SEG__ Chr2 {Mus musculus} MGRKMRGAAAAAGLWLLALSSLLTLWGGLLPPRTELPASRPPEDRLPPHPIQSGGPAPEPRFPLPPPLVWDARGGSLKTFRALLTLAAGADNPPRRHQDDRGRHEPSGLS
WPEERRAVHGGVFWSRGLEEQVPRGFSEAQAAAWLEVARGARVVALDRGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGA
QWVQVQEELRTAHWTEGSVVSLTRWLPNLTDVVVPEPWRSEDGRLRPLRDAGGELTNLSQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMHRATSNLHRGP
GGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARLLRLYSRHEPRFPELAELSEPHAQLLQRRLDFLAKHILHCKAKYGRRPGDLIT
LRGREGLGYE*
28 >lcl|NP_034889.1|Plus1complement(36844637..36845779) NT_039706 melanoma antigen, family B, 1 Mageb1 __SEG__ ChrX {Mus musculus} MFSWKASKARSPLSPRYSLPGSTEVLTGCHSYPSRFLSASSFTSALSTVNMPRGQKSKTRSRAKRQQSRREVPVVQPTAEEAGSSPVDQSAGSSFPGGSAPQGVKTPGSF
GAGVSCTGSGIGGRNAAVLPDTKSSDGTQAGTSIQHTLKDPIMRKASVLIEFLLDKFKMKEAVTRSEMLAVVNKKYKEQFPEILRRTSARLELVFGLELKEIDPSTHSYL
LVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHGVGVYAGKKHLIFGEPEEFIRDVVRENYLEYRQVPGSDPPSYEFLWGPRAHAETTKMKVLE
VLAKVNGTVPSAFPNLYQLALRDQAGGVPRRRVQGKGVHSKAPSQKSSNM*
29 >lcl|NP_035012.2|Plus12491089..2492066 NT_039428 necdin Ndn __SEG__ Chr7 {Mus musculus} MSEQSKDLSDPNFAAEVPDCEMQDSDAVPVGIPPPASLAANLAGPPCAPEGPMAAQQASPPPEERIEDVDPKILQQAAEEGRAHQPQSPARPIPAPPAPAQLVQKAHELM
WYVLVKDQKRMVLWFPDMVKEVMGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDRVALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRI
LGLRPWKKHSTFGDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARALREANLAAQAPRSSVSED*
30 >lcl|NP_036144.2|Plus1complement(380141..382939) NT_039589 G protein-regulated inducer of neurite outgrowth 1 Gprin1 __SEG__ Chr13 {Mus musculus} MRDCCSSPKAIPAPPRHALDQSLGMDPRHTSSSGAAEGASCSERPAGSLACPSPNCSPLPETPRAHGALTSDNSGTTLFGKPEPMSSAEATPTASEIRNPVFSGKMDGNS
LKQADSTSTRKEEAGSLRNEESMLKGKAEPMIYGKGEPGTVGRVDCTASGAENSGSLGKVDMPCSSKVDIVSPGGDNAGSLRKVETISSGKMDPKTENVMHSRRERPGST
GEGDLVSLRENDMKPPDNTDSASTKKTDPEFSGKLTPGSSGKTELVSSVTVAPVTSENVNPVCSGGAGPAAVGNSETLSSVKKDPQLLGKKEAVSSGEGGSVSVRMAETV
SARQPEGMFPAKTDSTSSNSTGPSGRADPVSLRNSELVSPVKPERLSSGQAERVSLVKTETLSSGKEDPRSSRRVDHTTVTGNMQTSQKGNPESSGKTDLGSSSSGDTRS
LGTWGSLSAAKAEVTEGKGDPQPWKKASLPASEKTDPLASSKAGSASQGKAETVSPGEVDAMTLGKTVPTSSGKTALVSPGKVDLMTSERAEGIPELQASEKGNPVNSTR
VDTGATGSTEPKSGVKVITQIPGATSPGKVETPSLQKEQPQLSEKTDPSRKVDPPTTVEPVSLGKADSASPSPRKAESQTSAKTVPQAPDKATSSLRQSDGTPYSSAQPQ
RDTRSIGSLPEREPSASTSQKDLAAAAAQKSPSAEAAAPPPGPRTRDNFTKAPSWDAGAPPPREDAGTQAGAQACVSVAVSPMSPQDGAGGPAFSFQAAPRAPSPAPRPP
SRRDAGLQVSLGAAETRSVATGPMTPQAAAPPAVPPVFPEVRVRPGSVLAAALAPQEATEPVRDVSWDEKGMTWEVYGASMEVEVLGMAIQKHLERQIEEHGRQGAPAPA
PPPAVRAGPGRAGSVRTAPAEGAAKRPPGLFRALLQSVRRPRCCSRAGPTAE*
31 >lcl|NP_038807.4|Plus12520031..2523885 NT_039428 MAGE-like protein 2 Magel2 __SEG__ Chr7 {Mus musculus} MSQLSTNLGDSSPPESPVPAVHSRPTVLMRAPPASSRAPPVPWDPPPVDLQAPMAAWQAPQPAWEAPEGQLPAPVAQLAQPPGLGAPMVQAPPLGGGMAKPPTPGVLMVH
QPPPGAPMAQSSTPGVLMLHPSVTGAPLAHPPPPGTPMTHPPGTSMAHPPPPPPPPPPPPPPGTPMTHPPPPGTPMGHHPPPGNPMTHPPPGNPMVHPLTHGAPMVHGGP
HGTPMPHVPITGTPIAQQPTPGVLMAQQLTPGVLMVQPPAPGAPMVQPPPQAALMTQPAPSITPMAKPPGPGVVMIHPPGARGPIIQTPVSGAPMAQTVLPPGQPLATWA
PQGQPLILQIQSQVIRAPPQVPSVPQAPQVQLATPPGWQATTPNWQVTPQGWPATPLTWQATQVTWQAPTIAWQATQPGRQGHSTIRTGHTPIRPGPAPLLRQIPPMIRQ
IQPVMRQAPPLIRQVPIRPAPHGIASQPQLWQVLPPPPPLRQAPQARLLLPRVPGTGQVSTVPPVAQIHLVPQSGPQVPQTVLPAQLSIPIPVPQAAAQSAPRTVHCPPI
IWQAPKGQAPVPQELPVPQELPVPQELPVPQEVPVPQEIPVPQEIPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPQELPVPLEFQEVQQAQAVGW
RAPKVPPHFWQPVSAQEAQEQATQIAHVEQQQPFQGAPASSKALQTQLPTHQAQASGLQAELPSVQLQPSWQGPLPMLQAQPGASATLANFPRGSTRSRMAPSGEPGPSS
LEPRGPPRERRAPARDKKGPPKERMFIGATFCAPRGASASRAYVPTAWKNLPATSETFPATSRVFPSTSHFQPASSNAFRGPSAASESPKSLPFALQDPYACVEALPAVP
WVPYPDGNASSACKSVPAILMVAAAAPQASATAAEASKSSEPPRRPGKATRKKKHLEPKEDNCGHRLSSRDWRGPRTWGNPSHSDWEIQRAMQLLGDRESLYTPQGLNDW
GCPNTSRMPRSLEGPSTSRDQEFCGDSGGSQTWMASEVPSVSRGSSAAQEDPDRESQPLSPLDERANALVQFLLVKDQAKVPVQLSEMVNVVIREYKDDSLDIINRANTK
LECTFGCQLKEVDTKTHTYIIVNKMAYPQCNLLASYLERPKFSLLMVVLSLIFMKGYCIRENLLFSFLFQLGLDVQETSGLFRITKKLITSVFVRHRYLEYRQIPFTEPA
EYELLWGPRAFLETNRVHILRFLAALYENQPQIWSCQYLDSLAELEYKDANAAAEESHDSDDDAHDPTSSPHPH*
32 >lcl|NP_038887.2|Plus13061227..3062426 NT_082868 zinc finger HIT domain-containing protein 2 Znhit2-ps __SEG__ Chr19 {Mus musculus} MEPAGLCGFCPAGEALPARYTCPRCNAPYCSLRCYRAHGACAEDFYRDQVLRELRGRSASPSRLAGALRRLREQREAEDEPEEAGLGPGARPGGLSGLWERLTPAEKAAF
ERLLSRGEAGRLLPPWRPWWWGRGTGPRLLEELDHAANRDLAEPEPAPARTALQSGDDAAAAEPFAEDSCAARPLALPARIPALASLSRSPASPLVRFQLPNVLFAYAHT
LALYHGGDDDALLSDFCATLLDVSGALGAQQVFGSTEEALQAAAHVLEAGEHPPGPLGTRGAMQEVARILLGEGPVNQKGYTLTALGHLAQTLGRARKQAVIGGERDRLY
RARKKCQFLLAWTNENEAALTPLALDCARAHRAHAVTAEEMATLTGELERLWGGPVPPTPRTLIEELPG*
33 >lcl|NP_058612.3|Plus1complement(98424928..98425191) NT_039207 bladder cancer-associated protein Blcap __SEG__ Chr2 {Mus musculus} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
34 >lcl|NP_064399.1|Plus1complement(13939238..13940200) NT_039718 melanoma antigen family A, 1 Magea1 __SEG__ ChrX {Mus musculus} MADSRNTQYCSLQESAQAQQELDNDQETMETSEEEEDTTTSNKVYGSGIPSPPQSPQRAYSPCVALASIPDSPSEEASIKGSGGLEDPLYLLHNAQNTKVYDLVDFLVLN
YQMKAFTTKAEMLESIGREYEEYYPLIFSEASECLKMVFGLDMVEVDPSVHSYILVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKGNYVSEEIIWEMVNNIGLCGG
RDPYIHKDPRKLISEEFVQEGCLKYRQVPNSDPPSYGFLWGPRAFAETSKMKVLQFFASINKTHPRAYPEKYAEALRDEIYRTKAWILNRCSNFSDLLTF*
35 >lcl|NP_064400.1|Plus1complement(13878096..13879058) NT_039718 melanoma antigen family A, 2 Magea2 __SEG__ ChrX {Mus musculus} MADSHNTQYCSLQESAQAQQELDNDQETMETSEEEEDTTTSNKVYGSGIPSPPQSPQRAYSPCVALASIPDSPSEEASIKGSGGLEDPLYLLHNAQNTKVYDLVDFLVLN
YQMKAFTTKAEMLESIGREYEEYYPLIFSEASECLKMVFGLDMVEVDPSVHSYILVTALGITYDGMMTDVLGMPKTGILIAVLSVIFMKGNYVSEEIIWEMVNNIGLCGG
RDPYIHKDPRKLISEEFVQEGCLKYRQVPNSDPPSYGFLWGPRAFAETSKMKVLQFFASINKTHPRAYPEKYAEALQDEIDRTKAWILNRCSNSSDLLTF*
36 >lcl|NP_064401.2|Plus1complement(13799015..13799977) NT_039718 melanoma antigen family A, 3 Magea3 __SEG__ ChrX {Mus musculus} MADSHNTQYCNLEESAQAQQELDNDQETMETSEEEEDTTTSNKVYGSAIPSPPQSPQRAYSPCVALASIPDSPSEEASIKGSEGLEDPLHLLHNAQNTKVYDLVDFLVLN
YQMKAFTTKAEMLENIGREYEEYYPLIFSEASECLKMVFGLDMVEVDSSVHTYMLVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKGNYVSEEIIWEMLNNIGLCGG
RDPYIHKDPRKLISEEFVQEGYLEYRQVPNSDPPSYGFLWGPRAFAETSKMKVLQFFASINKTHPRAYPEKYAEALQDEIDRTKTWILNRCSNSSDLHTF*
37 >lcl|NP_064402.1|Plus1complement(13903904..13904866) NT_039718 melanoma antigen family A, 5 Magea5 __SEG__ ChrX {Mus musculus} MADFHNTQYCNLQESAQAQQELDNDQETMETSEEEEDTTTSNKVYGSGIPSPPQSPQRAYSPCVALASIPDSPSEEASIKGSEGLEDPLYLLHNAQNTKVYDLVDFLVLK
YQMKAFTTKAEMLESIGREYEEYYPLIFSEASECLKMVFGLDMVEIDPSVHSYILVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKGNYVSEEIIWEMLNNIGLYGG
RNPYIHKDPRKLISEEFVQEGYLEYRQVPNSDPPSYGFLWGPRAFAETSKMKVLQFFASINKTHPRAYPEKYAEALQDEIDRTKAWILNRCSNSSDLLTF*
38 >lcl|NP_064403.1|Plus1complement(13774553..13775530) NT_039718 melanoma antigen family A, 6 Magea6 __SEG__ ChrX {Mus musculus} MADFHNTQYCNLEESAQAQQESDNDQETMETSEEEEDTTTSNKVYGSAIPSPPQSPQRAYSPCVALASIPDSPSEEASIKGSGGLEDPLYLLHSAQNTKVYDLVDFLVLN
YEMKAFPTKAEMLESIGREYEEYFPVIFSEASECLKMVFGLDMVEVDPSVHSYMLVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKGNYVSEEVIWEMLNNIGLCGG
RDPYIHKDPRKLISEEFVQEGYLEYRQVPNSDPPIYGFLWGPRALAETSKMKVLQFFASINKTHPRAYPEKYAEALRDEIERTKAWILSRCSNFSDHSSVLPFPF*
39 >lcl|NP_064404.1|Plus1complement(13836621..13837583) NT_039718 melanoma antigen family A, 8 Magea8 __SEG__ ChrX {Mus musculus} MADSHNIQYCNLQESAQAQQELDNDQETMVTSQEEEVTTTSNKVYGSGIPSPPQSPQRAYSPCVALASIPDSPSEEASIKGSEGLEDPLYLLHNAQNTKVYDLVDFLVLN
YEMKAFPTKAEMLESIGREYEEYYPLIFSEASECLKMVFGLDMVEVDPFVHSYMLVTALGITYDGMMTDVQGMPKTGILIAVLSVIFMKGNYVSEEIIWEMLNNIGLCGG
RNPYIHKDPRKLISEEFVQEGYLEYRQVPNSDPPSYGFLWGPRAFAETSKMKVLQFFASINKTHPRAYPEKYAEALQDEIDRTKAWILNRCSNFSDLLTF*
40 >lcl|NP_064676.2|Plus153297..54244 NT_039744 melanoma antigen family A, 4 Magea4 __SEG__ ChrX {Mus musculus} MENPDNTHYCSLQGSARSQRELDNVQATIAVVDEEEATPTSKKVYSSGIPSPPQSPQRASSPLVILASVPEGPSEEASTNQVEEQEDPLCMLYNAQNIKLYELATFLFFK
YQMKAFTTKAEMLESIGREYEEYYPLIFSEASECFKLVSGIGMIEVDPFVQSYILVPALGLTYDGMLTDVQSKPKTGILIVVLGAIFTQGNCVSEEIIWKMLNNIGLYGG
RHLYIHQDPRKFISEEFVHEGYLEYRQVPNSDPPSYEFLWDPRAFAETTKMKVLEIFASITMTDPRAYTEKYAEALRDETERAQARIIQQIVLQL*
41 >lcl|NP_064676.2|Plus153297..54244 NT_039744 melanoma antigen family A, 4 Magea4 __SEG__ ChrX {Mus musculus} MENPDNTHYCSLQGSARSQRELDNVQATIAVVDEEEATPTSKKVYSSGIPSPPQSPQRASSPLVILASVPEGPSEEASTNQVEEQEDPLCMLYNAQNIKLYELATFLFFK
YQMKAFTTKAEMLESIGREYEEYYPLIFSEASECFKLVSGIGMIEVDPFVQSYILVPALGLTYDGMLTDVQSKPKTGILIVVLGAIFTQGNCVSEEIIWKMLNNIGLYGG
RHLYIHQDPRKFISEEFVHEGYLEYRQVPNSDPPSYEFLWDPRAFAETTKMKVLEIFASITMTDPRAYTEKYAEALRDETERAQARIIQQIVLQL*
42 >lcl|NP_075728.1|Plus1complement(5014760..5015599) NT_039428 melanoma-associated antigen G1 Ndnl2 __SEG__ Chr7 {Mus musculus} MLQKPRGRGRPSTQADPERDWGGAGEEGPSTSRAAGGSSQGSRASLSAPTVGPRTQKQLELKVAELVQFLLIKDQKKIPIKRTDILKHVVGDYRDVYPNLLKLAAERLQY
VFGYKLVELEPKSHSYILINMLEPVEADAEMRGDQGTPISGLLMIVLGLIFMKGNTITETEVWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDY
ELQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPTQYCEALADEESRARPATASAPATSS*
43 >lcl|NP_076122.2|Plus142616856..42618667 NT_039551 lysine-specific demethylase NO66 2410016O06Rik __SEG__ Chr12 {Mus musculus} MDELPNGNGAALLKRGRGRRRRHPQSQPRGASVLALPLRPRKIRRHRKSAAASRVAALRARALRSEDSDSKVAVASVRGKRKRPAELLEASRSAEPRPVSARPRSASATL
PSRVEGWAALSRNLGTAAPPPPGSHADEPGRPRASPLQQVLTELNGIPSSRRRAARLFEWLLAPLPPDHFYRRLWEREAVLVRRQDRSYYEGLFSTADLDSMLRYEDVQF
GQHLDAARYVDGRRETLNPPGRALPAAAWSLYRAGCSLRLLCPQAFSPTVWQFLAVLQEQFGSMAGSNVYLTPPDSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRDPSEE
LALTSSPNFSQEDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAVLPLAVQAAIEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFM
EKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVHGLPVRWEAGEPVNVGAQLTTETQVHMLQDGVARLVGEGGRLFLYHTVENSRVYHLEEPKCLEIH
PQQADAMELLLRSYPEFVRVGDLPCDSVEDQLSLATMLYDKGLLLTKTPLVPS*
44 >lcl|NP_076263.1|Plus13756167..3757129 NT_039706 mage-k1 4930550L24Rik __SEG__ ChrX {Mus musculus} MSHIQRHDPGFEDQLEEEVPAAEEVGTWEKVAAAESSQETASSSASSQASASSKASEGSGGEAEGGQSTSKACLRTKLMLNSKFQKKVIDLVKFLSSKYVTNEPVTEAEI
LKSVGKKHKGYYSLIFKHACECLEVVCGIEVKEVDALNHTYLLLKVLDLTYDGRISNEEGIPKTGLLVLVLGIIFMEGNRASEKKIWEVLNIVGVYPDQHDFICGNPRKF
ITEDLVLENYLVYQPVPYSDPPSYEFLWGPRAQAETSKMKVLQFFCKVAGSNPASFTALYKEALEDEEERARALLASTAISTAVDNSGSGDKPSSVSHSE*
45 >lcl|NP_076270.3|Plus1complement(2502867..2503751) NT_082868 mage-g2 protein 1700020D05Rik __SEG__ Chr19 {Mus musculus} MSVSPPGHMLQKTRSRSHPGAQLWSPSDCCPGVSREIARASGHPDASQDTPGTPSPSFRQVQATSAPELWTQKQLELKVAELVQFLLIKDQRKIPIKQSGIMKHVVRDYK
NIFPDLLKLAAERLHYVFGYKLVELDPKSNAYILINALEPVGKDGELRGYQRTPTTGLLMIILGLILMNGHSIPENDVWCFLRRLGVYPTKKHSVFGYPKKLITEDFVKQ
RYLEYRRIPHTDPVDCELQWGPRANLETSKMKVLKFVAKIHNQDPKDWPTQYCEALADEQRRVRPEPNGPALTS*
46 >lcl|NP_076277.1|Plus1complement(11887154..11887810) NT_039718 melanoma-associated antigen H1 Mageh1 __SEG__ ChrX {Mus musculus} MPRGRKSRRRRNAKAAEENRNNRKSQASEASETPMAASVAPSTPEEYLSGPEEDTSTLEKASSTPSEASSTALVQKPVTRSNFQGTKKSLLMSILALIFIMGNSAKEALV
WKVLGKLGMQPGRQHSIFGDPKKVVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGYSAP*
47 >lcl|NP_079594.1|Plus1complement(38494751..38495083) NT_096135 transmembrane protein 93 Tmem93 __SEG__ Chr11 {Mus musculus} MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
*
48 >lcl|NP_079775.2|Plus124660839..24661966 NT_039500 EP300-interacting inhibitor of differentiation 3 Eid3 __SEG__ Chr10 {Mus musculus} MSKEKCSLTGGKEKRGELVRSLAWQHLVKQEEEEAVKKEEKEEGEDEEEEGSDSSSDDPNPEPPCMHPDLLELVVDREKCRKIRRQYRQLIYTVQQNREDIVNTASDTLS
EALEEANVLFDGVSRTREAALDAQFLVLASDLGKEKAKQLNTDMNFFNPIAFCDLLLLFVGFNWVEEECKEFSDCDDSIVLSFWGMLHEEATSWMLQAETFHFIFGSFKA
ERSARKPRLGCHKRACKMEGSGDMPTKLRRLDVHANQETTEKEVERILGLLQTYFQKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRLDQDRLPILEPTN
VSQVDDESDSYSYCRKQGVISLSLQDWKNIVSTFEISEAMIKNSY*
49 >lcl|NP_079779.2|Plus143096994..43097446 NT_039621 hypothetical protein LOC66346 1700029P11Rik __SEG__ Chr15 {Mus musculus} MAAWRLSLCARSLSAIRRLQAAPLCWKSSSSRAVVARSAAARKEQEEPTVQWMEDPDPEDENVYLKNPHFHGYDDDPKVDALNMHAVFFFGFSIALVLGTTFVAYVPNYK
MIEWARREAAMLVKHREASGLPIMESNYFDPTKINLLEDD*
50 >lcl|NP_079995.2|Plus1complement(10385782..10386969) NT_039578 NFKB activating protein-like Nkapl __SEG__ Chr13 {Mus musculus} MSPVSRSRPNEDTLGSQKRRRFSESPPSALQTSRSPRGGGFGSLLSGPEGLQPPRGAQGVRPLHPISRPRSGERPLPLGIRTLACSSSPICGGYRYHHNYAGDPSWAEDQ
EKEKEESYRQRRLKERERIGELGAPEVWGLSPKIPEPDSDEHTPAEDEVKNQKSSSSDFTNEEKRTKTSHSTKKKRKKKPSKRKHKKYYDSSSDCHSSSDSDKKKVKTKK
KEKKKKHRAKQLKKKRTKKEYNDISCKASERDLPEDAWMEQSMSAESMDLIGPEAPVIHTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECS
GYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK*
51 >lcl|NP_080013.1|Plus1complement(25731603..25732520) NT_039353 hypothetical protein LOC66740 4931417E11Rik __SEG__ Chr6 {Mus musculus} MACFGLYCGKTLLFKNSSTEIYGECGACPRGQRTNDQKYCQPCTDPPELYDWLYLGFMAMLPLVSHLLCIQWNAKNSNSRGVFFQQVSALLECSMAAVVTLLVSNPVGTL
VIHSCRVLMLSDWYTMLYNPSPDYITTVHCTQEAVYPLYTIVFVYYAFCLVLMLLLRPLLVKKIQWHLYVSNQLESMYAALYFFPGLTVLQAVAGGLLYYAFPYIVLVAS
LANLAVYLVFAKVESYSDLIKKDRLLVLFSQWFLHAYGLMALSRGQQLEQDLLLLTLVPAPTLFYFFTIKFTKPSRIIIEGTKEH*
52 >lcl|NP_080160.2|Plus148082752..48083843 NT_096135 zinc finger protein 830 Zfp830 __SEG__ Chr11 {Mus musculus} MASSTSTRTPAGKRVVNQEELRRLMREKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHRERVAELKGAKGATQGPSTGTVPQATKRRATDVES
QDAKKAKASAGPQVQPSTSASSANLDAARAAPSKPGLGLLPDYDDEEEEEEEGGGEERRDSSKHLPDAQGKEHSLASPRETTSNVLPNDPFNTNPPKAPLVPHSGSIEKA
EIHEKVVERRENTAEALPEGFFDDPEVDAKVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEVLTIK
ELQKKEEENVDSDDEGELQDLLSQDWRVKGALL*
53 >lcl|NP_080627.2|Plus166809040..66810854 NT_039649 tetratricopeptide repeat domain 39D Ttc39d __SEG__ Chr17 {Mus musculus} MSRFQRHEDNDEYLLSTFSLSEGEHDRMVRVTRSHNLKDSEAEDKFEDAHEIIPVATTMSLLSSLEECTTGLYLFLNNRFSDAINLIHPWSKNSSYHALIYSMFMVVKAI
LTFEPQDIQIGMNAAKEALKTCNNFRKKPRIVTLSRLMSRQGIKSIKEEELHAEVCYAECLVLKSAITFIQDDSLLSFLKSGVNVGSSYQIYKDCQQVLELMPENQSKTH
RHLIGGIKFGVGVFNLMFSLVPPKSLKLLNMVGYSGDREVGLALLHDSASEPHINNILSVFTLLFYYNYVRVVVGVEKASTAATESLFLIYLEKFPNCVVLKFFRARFNM
LNGNFESAKLKLQECIITQNEWKQVHHLCYWELMWCHIFLQNWKQAYNYASLLFQHSRWSKAIYIYSKAIILALIPPDCVDSENESLSSYFLRVDSLRIKILGSSVPIEK
FIAEKSQRYGTTTGWFTAQPLLEFIYAWSGFRVMSKKIELISSWLLIIDKGKELLSENPNEEYGIDDMSLLNLLKGLCLKHLGKHLKAEHYFIRVIRKEKMLKYDHYLVP
YSYYELGMLHYLKGDYANAMKNLDNIKNYKDYSMEARLQFRAHIALEQIAKLEK*
54 >lcl|NP_080906.1|Plus1complement(103954144..103954599) NT_039207 gametocyte-specific factor 1-like Gtsf1l __SEG__ Chr2 {Mus musculus} MEPESIEICPYNPHHRIPLSRFQYHLASCRKKNPKKAKKMASCKYNACHVVPIRKLAEHEATCVNRSSVEEEDTLGPLQVSLPQPQNQDTLQVRWLSNPDIWNVDGANCH
PMFVLKSFVPQKLVCESDIQESRGGDQCPEDPQTRTRKANF*
55 >lcl|NP_081554.2|Plus1complement(10109613..10110104) NT_166289 alba-like protein C9orf23 homolog 2810432D09Rik __SEG__ Chr4 {Mus musculus} MEQYRRAGSVELPASSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSTRHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTSPDTGLDPLTV
RRHVPAVWVLLSRDPLDPSECGYQPPGAPPGLGSIPSPSCGPRPRRRARDTRS*
56 >lcl|NP_081632.1|Plus124910..25563 NT_039315 ufm1-specific protease 1 Ufsp1 __SEG__ Chr5 {Mus musculus} MTAALPSTLELLKDVHLGLPVPCHDPARLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPGGQSSGVPGLPALQGALEAMGDKPPGFRGSRNWIGCVEASLCLEH
FGGPQGRLCHLPRGVGLRGEEERLYSHFTTGGGPVMVGGDADAQSKALLGICEGPGSEVYVLILDPHYWGTPKNRCELQAAGWVGWQKVKSVFDSNSFYNLCFTRNL*
57 >lcl|NP_081664.2|Plus1complement(50195370..50196881) NT_096135 phosphatidylinositol-glycan biosynthesis class W protein Pigw __SEG__ Chr11 {Mus musculus} MSQKQLKEAFVRNLSGTSVLEVTQGLCFPAFCILCRGLWIIFSQHVCSFSNTWSTRFLMDFVVLIVPLVITLTVLSSFILLENLTVIVWGAWLLYQIYHRRTCYAKVPVQ
KVFANFLKISLESEYNPAITCYRVINSVFTAIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFIFGAAMVCPEVRRKSIEESRFNYLRKSLYSVWPLVFLGMGRLVIIK
SIGYQEHSTEYGIHWNFFFTIIVVRLVTSLLLIIFPLNKSWIVAVSITVVYQLALDYTPLKRILLYGTDGSGTRVGFLNANREGIISTLGYVTIHMAGVQTGLYVLKGRA
QVRDWIKATCWVFSVAVGFFISLHIVQVNIEAVSRRMANLAFCLWVVASSLMLLSCLLLSGIILSFAQFLIKGSLVPCSWKLIQSPTTHKNHSESLILEAEKNQPSLCLI
TALNRNQLFFFLLSNITTGLINLTMDTLHTGALWTLVVLSIYMFTNCLVIYVLDLQGKTIKFW*
58 >lcl|NP_081788.2|Plus19014723..9015634 NT_039706 hypothetical protein LOC70696 3830417A13Rik __SEG__ ChrX {Mus musculus} MEPTENNQNFNLWDIPRAQTEERGPGSTQDPIAEAEEVEAIATAPGDVPAGGTPSSPQSAQGDPSPPTAMGSISGASFENPLSEVSGAESPSQDGLNEKIIDLVRFLLVK
FRRMELTNKEEMIVKTMGDYEEHYSVIFSKAAECMKLIFGVDMLEVDPFVHSYFLHPALGITYDGMLHGVIGVPKTGLVILVLCVIFIENNCVREEVFWHAMNILGMQAG
IDHFIFGEPRSLITEDFVEEGYVEYRQVPNSNPPCFEFLWGARAYAETTKMKILEFYASIVRQDPRSYPEKYAEALREEQERA*
59 >lcl|NP_082281.2|Plus134378178..34379260 NT_096135 hypothetical protein LOC71923 2310047M10Rik __SEG__ Chr11 {Mus musculus} MEAAQGRLGPEPELSVGAEHQAATFSGRPSRTPSKPPSVRTLSGEEEAESVGVSSRHPRASPKTWSGSIAHGPELDTWEDKPSSRATPSGARGRRGVPGSEHAPPPSSWY
PEPEPSEDQPSALRVCRRGSPGGVEMNVELPQQEGDDDDDEDEEAAAGRAGRSFPSRLQDSRSLDGLSGACGGGGSSSSGETGAGGGRRATISSPLELEGTVSRHGDLTH
FVANNLQLKIRLSGAPPPVPPASVRPCLTPAPTPTIPPIDPDVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEE
LERALQPVQGLARQVRDIRRTLEVLEALCK*
60 >lcl|NP_082301.1|Plus1complement(24453133..24454224) NT_039706 melanoma-associated antigen B16 Mageb16 __SEG__ ChrX {Mus musculus} MSQSSEECAADQGQTCEETQKLQVAAASIDVEEPCSSPHLMATSLKDQTSEETQVSKDVEEPCSSSQLLMASDQDDSEDETASTSSDLQHPYDSSSESTEDLDDQEVQGS
PVIPPDQSDSTDLPVMTVDGKVDFLVNYMLYKYQVKEVMSMNDIMTLIVREDEDRFHEILMRASERMEMVFGLDVKEVDPINHCYALFIKLGLTYDGMRNDEYSFPKTGL
LILILGVVFMKGNRATEEEIWEVLNPMGIYAGMTHFMFGDPRELITDEFVREQYLEYQPIANSDPIQYEYVWGLRAKAETSKMRVLEFVAKVHGSDPTVFLSQYEEALIE
EEERTLTMLLEHADSSSTSGESSSDTSSNFSQV*
61 >lcl|NP_082511.1|Plus1complement(16815772..16817766) NT_039207 tetratricopeptide repeat protein 30B Ttc30b __SEG__ Chr2 {Mus musculus} MAGLSSSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPAY
QTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEGVEDSGGESDYDGQINLGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQ
HPELGVGMTTEGIDVRSVGNTIVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRKLTIQVQDSRHSRDDESAKKAVNEYDETLEKYIPVLMAQAKIYWNFENYP
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELYGRNIPAVIEQPLEEERMHTGKNTVTYESRKLRALIYEII
GWNV*
62 >lcl|NP_082733.1|Plus1complement(21045349..21046470) NT_039264 defects in morphology protein 1 homolog Dem1 __SEG__ Chr4 {Mus musculus} MAETGEEETASAEASGFSDLSDSELVEFLDLEEAKESAVSLSKPGPSAELPGKDDKPVSLQNWKGGLDVLSPMERFHLKYLYVTDLCTQNWCELQMVYGKELPGSLTPEK
AAVLDTGASIHLAKELELHDLVTVPIATKEDAWAVKFLNILAMIPALQSEGRVREFPVFGEVEGIFLVGVIDELHYTSKGELELAELKTRRRPVLPLPAQKKKDYFQVSL
YKYIFDAMVQGKVTPASLIHHTKLCLDKPLGPSVLRHARQGGVSVKSLGDLMELVFLSLTLSDLPAIDTLKLEYIHQETATILGTEIVAFEEKEVKSKVQHYVAYWMGHR
DPQGVDVEEAWKCRTCDYVDICEWRRGSGVLSSSWEPKAKKFK*
63 >lcl|NP_082770.1|Plus1complement(251267..251821) NT_039229 hypothetical protein LOC73297 1700034I23Rik __SEG__ Chr3 {Mus musculus} MTTNTSTTTTATVARSISSFTDPHHFPSHNHIIRMASASQGHFDAYEALDLTEFAKKQPWWRKLFGQESRSAGEKYSVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGG
FFLLQLANHTGYIKVDWSRVEKDMKKAKEQLTIRKSAQIPTEVKSKAEEVVCFVKKNVLVTGGFFGGFLLGMAS*
64 >lcl|NP_083123.1|Plus1complement(36609117..36610217) NT_039706 melanoma antigen, family B, 5 Mageb5 __SEG__ ChrX {Mus musculus} MPRGQKNKHHRNRLKNKKHNQEKVHPQKDESQEKGHHKRDDFQDHKEARDNAAVEEKSSCSSPSVPGETLEKPPASKTSSDAGWLSCVSSPATVCGDELEFDDGTYFHCG
GNSLYSEYRTCQENPCKHCLDMYVNLVEQYVLYKFKMKKLIDRNELIDLIEPKYRYNFSDIFKRAFENIEIVFAASVIEIDSTNHVYDLVSKLKLPNKGRVCPGRGLPKT
GLLMTILAMIFMNGNSASEEDIWKFLNYMQVYPGRKHFIYREPRKLITQDFVKLKYLEYKQISLSDPPCYRFQWGPKAYTETTKMKVLEFMAKGSGVEPSTFSVQYTEAL
REENQKTKIRKWYPILAQKHCPGHSHQHVQKVMKPQ*
65 >lcl|NP_083127.1|Plus1complement(14154289..14155143) NT_039702 hypothetical protein LOC74279 1700080O16Rik __SEG__ ChrX {Mus musculus} MDPPDNSRNVNQDSTHSERETRDLEAGEEEASTSGDVLGSSQGAQRASFPSTAGVPSVEASGSQIEFYPDILRQQILNSKTIDLILFLILKYRRKQQTCKAEILYMVIRG
YEDHFPAIFTKASECLRLTFGLEIIERNPRVHSYSLVNALGLTYDGMLHGFRGVPKIGLLIIVLCIIFIQDNCASEQELWRILNNMGLYAGRDHFIYGDPGVLITEHFVQ
EGYLECRQVPGSDPPTREYLWGPRAHAETTKMKVLKHFASIVKQDPRSYPTRYADALKDEIDRT*
66 >lcl|NP_083180.3|Plus14050419..4052269 NT_039589 recQ-mediated genome instability protein 1 Rmi1 __SEG__ Chr13 {Mus musculus} MSVASAVLRVETWLLATWHVKVPPMWLEACVNWIQEENNNATLSQAQINKQVLEQWLLTDLRDLEHPLLPDDILELPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKN
TTNDLVSAETQSTPKPWEVRPSRMLMLQLTDGVTHIQGMEYQSIPALHSGLPPGTKILVRGCILFRLGVLLLKPENVKVLGGEVDGLSEENAQEKVLARLIGELDPTVPV
IPNNSIHNVPKVSGGLDAVLGPSDEELLASLDESEESAANNDVAMERSCFSTGTSSNTTPTNPSGFEPGCNISSRPKEKPPNQPTHFTDGEFDDFSLEEALLLEETVQKE
QMETKASQPLTLKENTGKCMEIFSHKPSSLNHTALIHKQGNSNFDEKTSEQMIHEDKFFDCASTRNHHKRFSAHDFTNDSKISEVDDAAQQTLSSSNVHCLRNKILNRKL
DLSEKSSQISKENGHPFQACSSRSFENNTYLSIGMDLHSPPFIYLSVLMARKPKEVTTVTVKAFIVTLTGNLSSSGGFWGVTAKVSDGTAYLDVDFIDEILTSMIGYSVP
EMKQLRKDPLKYKTFLEGLQKCQRDLIDLCCLMTISYDPSSCKGVVLELQDVGMEHVENLKKRLNK*
67 >lcl|NP_083198.1|Plus122150386..22151264 NT_039687 presqualene diphosphate phosphatase Ppapdc2 __SEG__ Chr19 {Mus musculus} MPSPRRTIEGRPLGSSGGSSVPGSPAHGGGSGGGRFEFQSLLNCRAGADPACARLRASDSPVHRRGSFPLAASGPAQAAPAPPPEDARMNLNPSFLGIALRSLLAIDLWL
SKKLGVCAGESSAWGSVRPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLMNLLFALLLDLLLVAVIKGLVRRRRPAHNQKDMFFTLSVDRYSFPSGHATRAALVSR
FILNHLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPHNVPVLFVLWNQQ*
68 >lcl|NP_084157.2|Plus1complement(18416158..18417633) NT_039492 transmembrane protein 200A Tmem200a __SEG__ Chr10 {Mus musculus} MIATGGVITGLAALKRQDSARSQQHINLSPLPATQDQKPVRRRPRADVVVVRGKIRLYSPSGFFLILGVLVSIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVVRNQGG
VVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRLKEQKQANGLYAGLLGDTEVKQNGSPCASRLAATTLASFSGMRNSF
RVDSSVEEDELMLTESKSLGHLMPPLLSDSAVSVFGLYPPPAKATDDKASSSKKCDTKSIVSSSISAFTLPVIKLNNCVIDEPSIDSITEVADNLKTRSRNLSMDSLVVP
LPSSGESFQPAVTLLPRNNSVGESLSSQYKSSVALGPGTGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVHAEQRKHPSWPRLDRSNSKGYMRLENKEDPM
DRLLVPQTAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETRF*
69 >lcl|NP_084464.3|Plus1complement(16859102..16861096) NT_039207 tetratricopeptide repeat protein 30A1 Ttc30a1 __SEG__ Chr2 {Mus musculus} MAWQSSSKVPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVTFLLDNPAY
QTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQ
HPELGVGMTTEGIDVRSVGNTVVLHQTALIEAFNLKAAIEYQLRNFEVAQETLTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEIIKKAMNEYDETLEKYIPVLMAQAKIYWNLENYP
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHMIVLCDGVVQECVQFLEYCELYGRNIPAVLEQPLEEERIHTGKNTVTYESRLLKALIYEVI
GWNM*
70 >lcl|NP_112448.1|Plus136161351..36162343 NT_039706 melanoma antigen, family B, 2 Mageb2 __SEG__ ChrX {Mus musculus} MPRGQKSKTRSRAKRQQSRREVPVVQPTAEEAGSSPVDQSAGSSFPGGSAPQGVKTPGSFGAGVSCTGSGIGGRNAAVLPDTKSSDGTQAGTSIQHTLKDPIMRKASVLI
EFLLDKFKMKEAVTRSEMLAVVNKKYKEQFPEILRRTSARLELVFGLELKEIDPSTHSYLLVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHG
VGVYAGKKHLIFGEPEEFIRDVVRENYLEYRQVPGSDPPSYEFLWGPRAHAETTKMKVLEVLAKVNGTVPSAFPNLYQLALRDQAGGVPRRRVQGKGVHSKAPSQKSSNM
*
71 >lcl|NP_444431.3|Plus149900057..49902813 NT_039706 melanoma-associated antigen E1 Magee1 __SEG__ ChrX {Mus musculus} MSLVSQNSRRRRGGRANARRNNGKGHPAAVPGPDVPRDRNDPKILQGLRASEGPGTSMLPTPREGPSASVPPTASEGSSAPRQFIISQGPNTSEMPTSRKGRGASRPPAV
SAGLNTAMSITASEGPNSPVPPTAPKGSKAYEHLPVSEGLAISEQRHSDGGPNMEPTLGEGPGISVPPTFSEESGISDEGLSIFMSPNISEGPGINEPYSVSEDPSTSVP
PTDSNGLGINLPPTFGEGLSISMLFSALEEPDIFAPPPSAEGLFASMSPPSGEIQSSWVSPIIMEGCNVNVPPTSKKGLRTSVPSAACESPSTSAEGLSSSLSSISAEGF
CSSLAPCAAEGSCELLPCGEGRSTSELHCLGEGSSTSQMSLAAEGPSASGMPTEANNPEEALSCCASERRNKSTSRALQKAKDPSVRPKREDRFLDFQVLRDSKNSNSIT
IMGLGTSRVALTLKPQDPMEQNVAELLQFLLLKDQTKYPIKESDMREFIDKDYRHQFPEILRRAAVHLECIFRFELKELDTEEHIYILLNKLGPVPFEGLEDVPNGPKMG
LLMMILGHILLNGNQAREADIWEMLWRFGVQRERRLSVFGNVKRLLSVEFVWQRYLDYRPLTDCVPVEYEFYWGPRSRAETTKMKILKFMAKIYNKDPMDWPALYNEALE
EDADRVVVNNFRVARPFRRPLFAEVAPELDASGSKYSPHSWPESRLESKARKLVQLFLLMDSTKLPIPKKGILYYIGRECTKVFPDLLNRAARTLNHVYGTELVVLDPRN
HSYTLYNRREMEDTEEIMDSPNRPGNNFLMQVLSFIFIMGNHARESAVWAFLRGLGVQNGRKHVITCRYLSQRYLDSLRVPDSDPVQYDFVWGPRARLETSKMKALRYVA
RIHRKEPEDWPEQYREAMEDEANRAEAGRRPLIVRNLR*
72 >lcl|NP_444436.1|Plus1complement(49634918..49636489) NT_039706 melanoma antigen, family E, 2 Magee2 __SEG__ ChrX {Mus musculus} MSLVSQNARQSSAETTADYSNSQGEMQATNASGPATSMLALEAPQGPEIPNDPQGASASQAVRDPSDIEVLIDEQSRRLGALRVHDPLEERSVALVNFMRMKSQNEGSIR
QSEMLEFLKEYSDQFPEILRRASAHLDRVFGLNLRVLDPQMDTYNLISKPGPQTTERLAETLDIPKAGLLALVLGHILLNGNRAREASIWDLLLKVDVIDGSQRINNQFG
NTRNLLTIDFVHMRFLEYWPVYGTNPLEFEFLWGSRAHSEITKMEALKFVAEAHDEEPWSWPEEYNKALEADKAKERSQAAGLEFWSEDTMNDKANELVQLAIGVTEELL
PIHQDELFANTGKEFQDVFPNILSRATLILDLFYGFSLIEVDTSEHIYLLVPQPESEEEQVMLESLGRPTQEYLMPILGLIFLMGNRVKEAKIWNLLQRFSVDVGRKHAI
TCKLMRQRYLECRPLSYSNPVEYELLWGPRAHHEITKMKALEYMARFYGKQPQDWPEQYREAVEDEEARARSEATAMFFFGSI*
73 >lcl|NP_598743.1|Plus13772628..3773227 NT_039474 ribonuclease P protein subunit p25 Rpp25 __SEG__ Chr9 {Mus musculus} MENFRKVRSEEAPAGDGDEGGSPNSGPFADLAPGAVHMRVKEGSKIRNLLAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLP
PGPTPGQTPSDPAASLSVLKNVPSLAILLSKDALDPRQLGYQPPNLSPGPSSPPTVSTSKRSLGESAAEEGTAKRSQPEPEAENEDRTA*
74 >lcl|NP_598828.3|Plus13555490..3556755 NT_039578 hypothetical protein LOC105351 AW209491 __SEG__ Chr13 {Mus musculus} MSAYSMLSDRIVMAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKIEAGKVAIKESHLQSTNLTHLKAIVESAENLEEVVSVLRVFGYTDTLGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASRQQPVQYSNPHIVFAFYNSVSSPMADKLKDMGISVRGDIVAVNSLLNHPEEFQLSESESDDEGQELL
QVTRVDRDNVLARVAFPTEIKVDVCKKVNLDITTLITYVSAMSYGGCHFVFKEKVLTEQAEQERKERVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERADVL
IKRISVVPDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEAFAVPLPKDLTDDSAH*
75 >lcl|NP_620085.2|Plus123665071..23666075 NT_039578 DNA segment, human D6S2654E Fam50b __SEG__ Chr13 {Mus musculus} MAQYKGTMREAGRAMHLIKKREKQKEQMEVLKQRIAEETIMKSKVDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALLREREMQLAKREQLEQRRIQLEMLREKERR
RERKRKISNLSFTLDEEEGDQEDSRQAESAEAHSAGAKKNLGKNPDVDTSFLPDREREEEENRLREELRQEWEAKREKVKGEEVEITFSYWDGSGHRRTVRMSKGSTVQQ
FLKRALQGLRRDFRELRAAGVEQLMYVKEDLILPHYHTFYDFIVAKARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDR
YTIR*
76 >lcl|NP_663441.1|Plus1complement(95725618..95726067) NT_039606 gamma-glutamylaminecyclotransferase A2ld1 __SEG__ Chr14 {Mus musculus} MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEVDEQMLRFLDDFEDCPSMYQRTALQVQVLEWEGDGDPGDSV
QCFVYTTATYAPEWLFLPYHESYDSEGPHGLRYNPRENR*
77 >lcl|NP_663486.2|Plus1complement(87510..88853) NT_039614 protein odr-4 homolog isoform 1 BC003331 __SEG__ Chr14 {Mus musculus} MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQCSSQKDYVILATRTPPKEEQNDNVKQPRARLDNLDEEWATEHASQVSRMLPGGLVVLGIFIITTLELADDFQNALRR
LIFSMEKSMNRKRLWNVTEDEVSERVTLHICSSTKKISCGTYDVQDPKSSARPADWKYQSRVSASWLSLDCTVHVNIHIPLSATSVSYTLEKNTKSGLTRWAKQIENGVY
LINGQVKGNDCDLLEGQKKSRGNTQATAHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLRGNVKCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDLLLNEIPE
KKNYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDHEIQIEDLEIAEEVNTACMTSSVNSEASLTNTSEEQQEQPKKNHRSENSAKHRCDRSTSCCSACCGH
LLPLLQ*L
78 >lcl|NP_666215.1|Plus134079410..34080462 NT_078297 transmembrane protein 185B Tmem185b __SEG__ Chr1 {Mus musculus} MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVIVGASVGAGVWARNPRYRTEGEACVEFKAMLIAVGIHLLLLMFEILVCDRVERGTH
FWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITI
VVPLLIFEVLLVHRLDDHNTFSYISIFIPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEVFPFLREYGNISYDLHHEDSEDAEDASVSEAPKIAPMFGKKARVVI
TQSPGKYVPPPPKLNIDMPD*
79 >lcl|NP_705768.4|Plus1complement(13076615..13078357) NT_039482 glycosyltransferase C85492 __SEG__ Chr9 {Mus musculus} MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALGQQSLDPVLGLKIDYPKALQILMEGGTHMVCTGRTHTDRICRFKWLCYSNEAEEFIFFHGNSSVMLPNLGSR
RFQPALLDLSTVEDHNAQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAQEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQL
KTLGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFTRFMTERLNVSHAGAPLGEEYILVFSRTQNRLILNEAELLLELAQEFQMKTVTVSLEDHTFAD
VVRLVSNASMLVSMHGAQLVTALFLPRGATVVELFPYAVNPDHYTPYKTLATLPGMDLQYVAWRNMIRENTVTHPERPWDQGGITHLDRAEQARILQSREVPRHLCCRNP
EWLFRIYQDTRVDIPSLMQSIRRVVKGRPGPRRQRWAISLYPGKVREARCQASVQGATEARLSVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYMLTLQNHTFTENI
KPFTTYLVWVRCIFNRSLLGPFADVLVCST*
80 >lcl|NP_766272.2|Plus1324433..325149 NT_166287 round spermatid basic protein 1 Rsbn1 __SEG__ Chr3 {Mus musculus} MFRSTRTTDQWRVGERLQCPAGHARAALARTADGGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHVGVSPRGVKRQRRASSGGSQEKRGRPSQDPPLAP
PHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPTVAAPLPAPGTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGSDGDPGACVPGDLKHKDKQENG
ERSGGVPLIKAPKRGESRR
81 >lcl|NP_776144.1|Plus1complement(36949097..36950080) NT_039706 melanoma-associated antigen B18 Mageb18 __SEG__ ChrX {Mus musculus} MPRGQKSKLRAREKRRQARAKNAQEKEASPGPFYGCPHQASPVASMPTSPNMPMGEQSTFSHSYTSTSDQNLDEKSSDDSEDTEDWCKDPINHKVVLLVQFLMEKYQKKE
VITKADMLKYVIKTSKNHFNEILKRASEHMELAFGIDLKEVDPNRHCYALFNKLEHTFDGVMGEEKMPSSGLLMIVLGVIFMNDNCVSETEIWNVLSMMGVYANRKHFIY
GDPKKVITEDMVQLKYLEYQQVPNSNPPSFEFTWGPRACAEISKMKILEFWAKIHDTTPDSFPTLYEAALKDEEERAQARAVARAHTAAMASPYSRATVCSSSHTNI*
82 >lcl|NP_776292.1|Plus1complement(240241..>240348) NT_109318 protein RCC2 Rcc2 __SEG__ Chr4 {Mus musculus} QVAMGYSHSLVIARDESEAEKEKLQRLPEYTPRTL*
83 >lcl|NP_778167.1|Plus127983208..27983579 NT_096135 membrane magnesium transporter 2 precursor Mmgt2 __SEG__ Chr11 {Mus musculus} MVAWLWKVLMGVGLFALTHAAFSAAQHRSHARLTEKKYEPLPADIVLQTLLAFALTCYGVVHTAGDFRDRDATSELKDMTFDTLRNRPSFYVFHRSGYRLFQRPDSTHSS
NLSASSSDLPLKF*
84 >lcl|NP_780311.2|Plus15431887..5432147 NT_039492 splicing factor 3B subunit 5 Sf3b5 __SEG__ Chr10 {Mus musculus} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN*
85 >lcl|NP_808269.1|Plus15279391..5279792 NT_165760 transmembrane protein 60 Tmem60 __SEG__ Chr5 {Mus musculus} MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVF
IPLWALLAGALTELGYNVFFVRD*
86 >lcl|NP_808546.1|Plus1924518..925300 NT_039315 metallo-beta-lactamase domain-containing protein 1 Mblac1 __SEG__ Chr5 {Mus musculus} MNGPVRTEPLHGEIPLLASSGSYSVVVLLRGYAEPQGAGDAVRADGTVTLVLPRGWASDSSRGLAPSADGGSKTALEEAVRGPILVDTGGPWARGALLEALATQGVAPED
VTLVVGTHGHSDHIGNLGLFPEAALLVSHDFCLPEGLYLPHGLCETQPLILGSGLQVWATPGHGGQRDVSVVVEGTSLGTVVVAGDVFERLGDEDSWQALSEDPVAQQRS
RERILSVADVVVPGHGAPFRVVRETVKSSEDLICEGKAVA*
87 >lcl|NP_941018.1|Plus1complement(2456789..2457397) NT_082868 coiled-coil domain-containing protein 85B Ccdc85b __SEG__ Chr19 {Mus musculus} MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAVGSGAGPTPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*
88 >lcl|NP_955762.1|Plus1complement(51617439..51619100) NT_039706 zinc finger CCHC domain-containing protein 5 Zcchc5 __SEG__ ChrX {Mus musculus} MVEDLAASYVTLKLENEILQAQVKRLMEENAALQAQIPELQKSGAVKEHEPLRKPSEAQEPPESPEFPAARESQNPWEPPATTEPGEPTKIREPREPSAISELREPPEIK
EPQEPPETNESGESSAITEFRGSPEIKEPHLPPKSKEYWGPQELPMVKESWEPPEALDSTAWKPPAVKESQEIQKALESPATQRPQASPRGYDLPAVCEAEPTDNQGTPA
LKELQSPQLHNPTNDEESQTVPEYQETSSQLEPLEHPPPQETLEPRVPQEPLDPSDAEEFLELSVPEESLEGLIVARTGTEQAQCELEATTLPLEYPLAFSEDFQKLSEF
LVQLTSYLRSRGYPTEAALVSFVGSFFSGEAGRMFQPLLDSQPPLVEQFERLLRALQDTFDNPESLEVANQGLPQLRQGEGLAPRYSTRFHLIAQELDLGESTLCIQFQE
ELASSIQNELSCTSPATNLSDVIIECVTLEEKASGGVDSSSSSSEEENGSEGPPTENQPVQATSNRPHLSEAERARRREGHLCLYCGHPGHFARDCPVKPHRVQQAGNME
ARR*
89 >lcl|NP_958761.1|Plus1complement(7267740..7269944) NT_039314 tripartite motif-containing protein 56 Trim56 __SEG__ Chr5 {Mus musculus} MNSKDSSPTLLEALSSDFLACKICLEQLHTPKTLPCLHTYCQDCLAQLDIGGQVRCPECREIVPVPAEGVAAFKTNFFVNGLLDLVKARAPGDVHSGKPTCALCPLVGGK
SSGGPATARCLDCADDLCQACADGHRCSRQTHKHRVVDLVGYRAGWYDEEARERQASQCPQHPGEALCFLCQPCSQLLCKDCRLGPHIDHPCLPLAEAVRSRKPGLEELL
AGVDSNLVELEATRVAEKEALALLREQAASVGTQVEEAAERILKSLLAQKQEVLGQLRALVEAAEEATRERLTKIERQEQVAKAAAAFARRVLSLGLEAEILSLEGAITQ
RLRQLQDAPWTSGPTRCVLPQLELHPGLEDKNCHLLRLIFEEPKQSPKDSGKGGAGTQGGDEAQGQGDDRTKIGKQGGAQPLTPKEGKDQNPQEDDGVFIERGNRPNKKK
KCKGRGKSVSREPSPILRPNLEGSGLLPRPVFSWSFPTRMPGDKRSPRITGLCPYGPQEILVADEQNRVLKRFSLNGDYKGTVQVPEGCSPCSVAALQNAVAFSANAKLY
LVSPDGEIQWRRSLSLTQSSHAVAAMPCGDRVAVSVAGHVEVYKKDGSLATRFIPGGKASRGQRALVFLTTSPQGNFVGSDWQQNSVVFCDGLGQVIWEYKGPGLHGCQP
GSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGKYLVVSLSNGTIHVFRVRFPDS*
90 >lcl|XP_001001111.1|Plus1complement(6007143..6007682) NT_165760 protein archease-like Gm8539 __SEG__ Chr5 {Mus musculus} MKGGSKSTNSAIMAQEEDDVRDYNLTEEQKATKDKYPPVNRKYGYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLRTVEVETQGDDLQFLLFHFLDEWLY
KFSADEYFIPREVKVLNIDQKNFKLRFIGWGEEFSLSKHPQGTEVKAITYSAMQVYNEEKPEVFVIIDI*
91 >lcl|XP_001472073.2|Plus12647944..2649578 NT_039551 H/ACA ribonucleoprotein complex non-core subunit NAF1 Gm2027 __SEG__ Chr12 {Mus musculus} MEVVEATEQLQTLKFGGSGQGSAASPPPQERREAPPPGEQPPPPAPNSDPGGRPPPPPTPNWDAGGRPTPLAPSSDPSGRSPPPPTPNWDAGGRPPPPAPNSDPGGRPPP
PPAPNSDAGGRPPPPAPNLDPGGRPPPPPAPNSDPGGRPPLPSGVCVPGPNAAEPPPVLQASDSLDSDSDSETDSDSSSSSSSSSSSSSSCVSFPPVMSDGHEDVQVEKE
NKNFPLKTRDELLLNELPSVEELTIILPEDIALKPLGKVSSIIEQLVIIESVTNIPPVNEDTVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKINDTMYF
APSMKDFTQYIFTEKLKQDRGSDASWENDQEPPPEVLDFSDDEKEKEAKQRKKSQIQGRKNLKSELNEPCEDFGEVIQKWNAYSSSKGSHHREFSRGFARGRYSRRSHGR
PPPQQCYNSDHMTSQESLGFAPQRQDNPVMPHYPFPPPMFDMHIFPLPPPPPPPPTVSMGWSAPSMASHPELNLPYSLPPPPLPPPPPPPSPGENNSSHFGPYF*
92 >lcl|XP_001474228.1|Plus13126374..3126694 NT_039618 UPF0139 membrane protein C19orf56 homolog Gm2573 __SEG__ Chr15 {Mus musculus} MSTNNMSDPRRPTKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAIYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW*
93 >lcl|XP_001474578.1|Plus1complement(15263593..15264516) NT_039706 melanoma-associated antigen 11 Gm16441 __SEG__ ChrX {Mus musculus} MDPPENSQNSSVLDNTQSQSKAGDQEGTQVPIAGAREEETVAATSGDVSVGGMLGSSQSSQRASDPPTATGFIAGAPSAEGSHSPSMAGASAVFPTQEAINRKVVSLVHF
LLLKYRDNQIVTKAEMLAKITRAYEVSYHVIFTKASDCMWLLFGIDVTEVHHLVNSYSFVPALGITYAGMQHGVPGIPWTGLVIIVLCIIFLYDNCMSEEELWRILNNIG
LYAGTDHFLYGEPRRLITEHFVEEVYLEYRVVPGSLPPRHEFLWGPRACAETTKMKIWMFYASIVRQHPASNPFRYAEALIEELLRP*
94 >lcl|XP_001477052.1|Plus1complement(23049882..23050211) NT_166318 brain protein 44-like protein-like isoform 2 Gm3452 __SEG__ Chr12 {Mus musculus} MAGALVRKAADYVQSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA*
95 >lcl|XP_001477376.1|Plus1complement(6386242..6386634) NT_039700 protein LLP homolog Gm14535 __SEG__ ChrX {Mus musculus} MAKSLWSKWKRKMRAEKRKKNAPRELNRLKSILRVDGDALMKDVEEIATVVVAKPRQEKMQCEEGRCDGADEEKDDMKMETEIKRNRKTLLDQHGQYPVWMNQRQRKRLK
AKREKKRGKSRAKAAKGLAW*
96 >lcl|XP_001477733.1|Plus135947432..35947809 NT_039492 mitochondrial import inner membrane translocase subunit Tim16-like Gm9803 __SEG__ Chr10 {Mus musculus} MAKYLAQIIVMGVQVVGRAFARALRQEFAASQAAADARGRAGHQSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELR
IQAQEDREKGQKPKT*
97 >lcl|XP_001478161.1|Plus120317343..20317573 NT_078297 zinc finger protein 706-like Gm10193 __SEG__ Chr1 {Mus musculus} MACGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCKTQMPDPKTFKQHFESKHPKTPLPPELADVQA*
98 >lcl|XP_003084567.1|Plus1complement(103786309..103786722) NT_039207 CDGSH iron-sulfur domain-containing protein 3, mitochondrial-like LOC100504524 __SEG__ Chr2 {Mus musculus} MGFRRLSFPTDFIFLFPNHICLPALSKPYQRREISSWLARWFPKEPTKPVVAQKTHIRLELVAGKNYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKFKVQETRTVALCTC
KATRRPPYCDGTHKSEQVQKAEVGSPL*
99 >lcl|XP_003084838.1|Plus1complement(959525..959893) NT_039474 UPF0414 transmembrane protein C20orf30 homolog Gm7368 __SEG__ Chr9 {Mus musculus} MMPSHTNLATGLPSSKVKYSRLASTDDGYIDLQFTKSPPKIPYKAIALATVLFLIGTFLIIIGSLLLSGYISKGGGGGRPSRSCPHHRHFGVPTGILPFAHRLLCIQGLP
GLLLR*HSRL**L
100 >lcl|XP_003085189.1|Plus155383550..55385463 NT_039649 transmembrane protein 200C Tmem200c __SEG__ Chr17 {Mus musculus} MIATGGLLRISARKQDPLRPPSQVPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMAVVGYWPKANAANRGGSKQLLPVGSSHRIGAISNSSNGNKN
PAKSHSGTPGGANSSSVGGPWSPPPARSAATSSSSSSSSSSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLRDLYSTVIDVHS
LRAKDLAAAAAAAAAAAASSSAAAPGSASHGAAPLNGFLSYVQSRGLELKPGSCAGSADAFGAAAMLARGSWPHPTGLDGGSGETQEAGSPPDLASSPRCPREPPSLTEA
VYSIYRERSSRAGHRRTTVAAVAAATATVTAAASGGSSPAPCSPTGSWGRQSTTSSLVGSSLSAFALLPLQGDRDRDGDSEGASCSWHRPPGERGSRDLPRGELDLSLTD
LRGAEGGARWASCEPGEPEGAKTARTARGQGGRLPRTRRYAAWRRRSTSGLPDYRAPPSPEPPPSSSAENLDSGPSATAATPSLPLRPEEDSPRVRRDSHSSQSDDQSSS
NKGYTPLREADTSVESVVDVVAKKRLDCEDVTDPSTEHSSPEGPSPGPTRAEPLSVQRQFTNKEKLFLISRSHTPGVEDPELKKSSN*
101 >lcl|XP_003085309.1|Plus17127658..7128947 NT_039706 melanoma-associated antigen 11 4933402E13Rik __SEG__ ChrX {Mus musculus} MSRYGKHPRLSLEEGVNFQNPTETDDDDVVFPVLPTAEKDEREGEEEVLKEDEDGNKQETEEDNVEKEDEDEEKEKEEEKEESGDEVNEEEDETREEEDISSMILSSSNV
SLAAFSPPSPSSSSSSSIFSSSSSSSSLFSLFQSNLVENEGFAIGMLGLFQNAQSFFPLPTLGGNLDEAAGYQEESSGVIASPEDPDSLLDTVIQEKATDLVFLFIYKYR
VKEPITLTEMHEVVTKEYENHFPVIFIEASKCLEMTFGIDIKESDLVSSAYVLVNSLNLTYEDTLSDSDRLPRNAFLIVILGVIFIEGNCASEDRIWEFLKLVGVYDGEE
HFICGDPREFLTIHLVQQNYLEYREVPNSQPPCFEFLWGPRAYAETTKMKVLEFLAKMNGCDPSDFSIWYEEALRDEEERAWALNDSANTSPNAWFVER*
102 >lcl|XP_141933.2|Plus136454841..36455923 NT_039706 melanoma-associated antigen B4-like Mageb17-ps __SEG__ ChrX {Mus musculus} MPRGNKSKGRSRAKRQQTRGESQNLQGAQPTVEEEEAASPPLDQGNAPSSPGVRTPQESQEATSYGSPELDVPCSVHDVDAEGSDVAVGGSVTGAEERSAYASKIEAAIQ
SAHRDPLTRKATVLIQFMMEKFKVKEPFTQADMLRVISKKYRVHFTEILRRISVRLELVFGLELKEIDPSSQSYTLVGKLGLSTEGSLSSSSGLPKTGLLMTLLGVIFMK
GNRATEEEVWEFLKVVGIYPGKSHVIFGEPWEFITKDLVEENYVVYRQVPGSDPPSYEFQWGPRAYVETTKMKVLEVIAKINNTSPSFFTSMYEEAMIDEANRATRRVTA
MPGHVVDVRDVRTHRRSMAHSSSSKQWNVL*
103 >lcl|XP_142049.3|Plus153185301..53185993 NT_039706 polycomb group RING finger protein 6-like Gm378 __SEG__ ChrX {Mus musculus} MSLPSSSLAKPVVESSPEAQGGLGADKHERAEGAEEAKKTLWPAHPGLPPAGTTASLSGEEGQSSSGEVGTQECLASEPPQWEEGKAEEKAVVESEEKAAVESDQEERLI
PLSQMIPYISCFICKGYLIDAATITECLHTFCKSCIVKHFEHSNRCPKCNIIVHQAKPHKNLRMDPQLQSIVYKLVAGLEENEKKQRREFNKEHCLGPPEPAAVPQPGHS
SEENTKEVVE*
104 >lcl|XP_204404.1|Plus136463890..36464990 NT_039706 melanoma-associated antigen B5 Gm14781 __SEG__ ChrX {Mus musculus} MPRGQKNKHHRNRLKNKKHNQEKVHPQKDESQEKGHHKRDDFQDHKEARDNAAVEEKSSCSSPSVPGETLEKPPASKTSSDAGWLSCVSSPATVCGDELEFDDGTYFHCG
GNSLYSEYRTCQENPCKHCLDMYVNLVEQYVLYKFKMKKLIDRNKLIDLIEPKYRYNFSDIFKRAFENIEIVFAASVIEIDSTNHVYDLVSKLKLPNKGRVCPGRGLPKT
GLLMTILAMIFMNGTSASEEDIWKFLNYMQVYPGRKHFIYREPRKLITQDFVKLKYLEYKQISLSDPPCYRFQWGPKAYTETTKMKVLEFMAKGSGVEPSTFSVQYTEAL
REENQKTKIRKWYPILAQKHCPGHSHQHVQKVMKPQ*
105 >lcl|XP_485502.1|Plus1complement(1902262..1902723) NT_039268 coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like Gm13202 __SEG__ Chr4 {Mus musculus} MPRGSRSRTSRVTPPASRAPQRRAAPRRAPAAQLPAAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITYQEPQGAQLQNQ
QSFGPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCRIANGLM*
106 >lcl|XP_485592.3|Plus1complement(1582996..1583457) NT_039302 ORM1-like protein 2-like Gm5553 __SEG__ Chr5 {Mus musculus} MNVGVAHSEVNPNTLVMNSLGIWLAYIISVGLLHVVLLSIPFFSIPVIWTLTNVIHNLAMYIFPHTVKGTPFETPDQGKGQLLTHWGQMDYGLQFTSSRKFLSISPIILY
LLASFYTKCDAAHFLINTASLLSMLLPKLPQFHGVHLFGINKY*
107 >lcl|XP_889417.2|Plus1complement(32405032..32405343) NT_039207 UPF0139 membrane protein C19orf56 homolog Gm13770 __SEG__ Chr2 {Mus musculus} MSTNNMSDPRSPNKVLRYQPPSSECNRALDDPILDYMNLLSMIFSMCGLTLKLKWCAWVAVYCSFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW*
108 >lcl|XP_890423.1|Plus1complement(14545541..14545789) NT_039590 DPH3 homolog Dph3b-ps __SEG__ Chr13 {Mus musculus} MAVFHDEVKNKDFQYDEDLETYFCPCPCGDSLSITKEDLENGEDVAMCPKCSLIIKVIYDKDQFMCGEIVLAPSSNKELVRC*
109 >lcl|XP_891864.1|Plus11253407..1253799 NT_166306 UPF0727 protein C6orf115 homolog Gm6314 __SEG__ Chr7 {Mus musculus} MVAHQEVNWSSIVKVHQKRPFGLFLPRVQGSDPRSSSSSVKKEAIGESAMNVEHEVNLLVEEINRLGSKNADGKLSVKFGVLFQNDRCANLFEALVGTLKAAKRRKIVTY
TGELLLQGVHDDVDIVLLQD*
110 >lcl|XP_892764.2|Plus11357420..1358274 NT_039267 transmembrane protein 200B-like Tmem200b __SEG__ Chr4 {Mus musculus} MTAGSPGDGGARRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIAVAGYWPGRASHTHAPRTGRAHGPHERLRLLGPVIMGVGLFV
FICANTLLYENRDLETRRLRRGMLRAQALRPPDGPGWDALLPSPAHGSPGAVAEPETWDLAPRRGPSPVPSVRSLRSEPANPRSGLPALLHSYPLKGPGLPPPWGPRTQT
GHVIITVQPSGSCIEHSKSLDLGLGELLLGAPATRDCAHRSWPRLDRLSLGGYAKLGGDLGARV*
111 >lcl|XP_895456.1|Plus122221718..22222134 NT_039618 protein FAM136A-like Gm6624 __SEG__ Chr15 {Mus musculus} MAEVQQLRVQEAVDTMVKSVERENIWKMQGLMFLCSANCCEDTQASMQQVHQCMERCHAPLTQAQALVTSKLERFQDRLARCTMHCNDKAKDSMDAGTKELQVKRQLDSC
VAKCVDDHMHLIPTMTKKMKESLSSMGK*
112 >lcl|XP_897794.1|Plus13291560..3291937 NT_039268 tRNA methyltransferase 112 homolog Gm13072 __SEG__ Chr4 {Mus musculus} MKLLTHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFVARMIPKVEWAALVQAADTLNLAEVPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESGRLFPIS
RGIPNMLLNDEETET*
113 >lcl|XP_899832.1|Plus130078022..30078453 NT_039206 biogenesis of lysosome-related organelles complex 1 subunit 2-like Gm13540 __SEG__ Chr2 {Mus musculus} MAAAAEGVPATRREEQPPRDDAAVETAEEAKEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAELQPYLDQIN
MIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR*
114 >lcl|XP_900042.1|Plus115975936..15976286 NT_165773 protein lin-52 homolog Gm7020 __SEG__ Chr11 {Mus musculus} MGWKMASPTDGTDLEASLLSFEKLDCASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNI
LEKPKK*
115 >lcl|XP_910213.1|Plus1complement(16324367..16324756) NT_039264 protein LLP homolog Gm12952 __SEG__ Chr4 {Mus musculus} MAKSLRSKWKRKMRAEKRKKNAPRELNRLKSILRVDGDALMKDVEEIATVVVAKPLQEKMQCEEGRCDADEEKDDMKMETEIKRNRKTLLDQHGQDPVWMNQRQRKRLKA
KREKKQGKSRAKAEKGLAW*
116 >lcl|XP_981505.1|Plus12883380..2883841 NT_166289 coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like Gm12350 __SEG__ Chr4 {Mus musculus} MPRGSRSRTSRVTPPVSRAPQMRAAPQRAPAAQPPAAAATSAVGSPAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGGSAEPAKPDITYQEPQGAQLQNQ
QSFGPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQCRIANGLM*
117 >lcl|XP_993428.1|Plus1complement(977705..978073) NT_039207 brain protein 44-like protein 2-like Gm13570 __SEG__ Chr2 {Mus musculus} MAAVVALMRKTRDYFKTKEFRDYITSTHFWGPVANWGLPLAAFKDMKAPPDIISGRMTTALIFYSMAFMRFAYRVQPRNYLLLACHFSNVLAQSIQASRYLKHQYGGGAK
AKAAKATNPPAK*