SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul S    

ID / Description / Sequence
1 >lcl|NP_001165573.1|Plus1complement(395852..396817) NW_001121139 necdin NDN __SEG__ Chr7 {Macaca mulatta} MSEQSKDLSDPNFAAEAPSSEVHSSPGVPEGVPPSETLAEPQSPPLGPTAAPQAAQPPQAPSDEDDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVL
VKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLR
PWKKHSTFGDVRKLITEEFVQQNYLKYQRVPYVEPPEYEFFWGSRASREITKLQIMEFLARVFKKDPQAWPSRYREALEEARALREANPAAHCPRSSVSED*
2 >lcl|XP_001081966.1|Plus1complement(117193..117441) NW_001108682 DPH3 homolog ZCSL2 __SEG__ Chr1 {Macaca mulatta} MAVFHDEVEIEDFQHDEDSETYFYPCPCGDNFSITKEDLENGDDVAMCPSCSLIIKGIYDKDPFVCAETVPAPLANIELVKC*
3 >lcl|XP_001082331.1|Plus140236..40898 NW_001118166 hypothetical protein LOC693622 LOC693622 __SEG__ Chr5 {Macaca mulatta} MEKFLQIAPHSLAIVLGPAEAPAGERPGAARPAPPAQPRQLARHHIGYEIFADFKAENMQHFWNKKVTAAVAETFFLGWIDEQVLLIQGKEEHLEALREGWTRRALRPPS
GFHIRCLGECGRRAPVPSLPAGLRPCRAAAGAPPCPSPPRAQPRLPWVPASLPGEEPGALCERGIGELPGTERRQPSHSPCAAPACLREPPRWRAVPGAARWAPRLGGRL
*
4 >lcl|XP_001082471.1|Plus1complement(87536..87856) NW_001095962 coiled-coil domain-containing protein 56-like LOC695732 __SEG__ Chr10 {Macaca mulatta} MAASGAGDPLDAKRGEAPFAQRVDPTREKLTPEQLYSMRRAQLAQWQRVLPQRQTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS*
5 >lcl|XP_001082555.1|Plus1complement(3543440..3543868) NW_001218107 mitochondrial intermembrane space import and assembly protein 40 CHCHD4 __SEG__ ChrX {Macaca mulatta} MSYCRQEGKDGIIFVTKEDHETPSNAEMVADDPNDPYEEHGLILPHGNINWNCPCLGGMASGPCGEHFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDE
DEEEEREKKPAEQVEETAPTEATATKEEEGSS*
6 >lcl|XP_001083034.2|Plus1791506..791907 NW_001114281 transmembrane protein 60-like LOC693679 __SEG__ Chr3 {Macaca mulatta} MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVF
IPLWALLTGALTELGYNVFFVRD*
7 >lcl|XP_001083342.1|Plus184322..84642 NW_001109282 coiled-coil domain-containing protein 56-like LOC695277 __SEG__ Chr1 {Macaca mulatta} MAASGAGDPLDAKRGEAPFAQRIDPTGEKLTPEQLYSMRPAQLAQWQKVLPRRRTRNIVTGLGIGALVLALYGYTFYSISQERFLDELEDEAKAVRARALARASGS*
8 >lcl|XP_001083529.1|Plus12128914..2129381 NW_001121000 FUN14 domain-containing protein 1-like LOC696024 __SEG__ Chr6 {Macaca mulatta} MATRNPPPQEYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVPGWCAGFLFQKVGKLAATAVGGGFLLRQIASHSGYVQTDWKRVEKDVNKAK
RQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS*
9 >lcl|XP_001083679.1|Plus175784..76905 NW_001108627 defects in morphology protein 1 homolog isoform 2 DEM1 __SEG__ Chr1 {Macaca mulatta} MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESNALVNMPGPSSESLGKDDKPISLQNWKRGLDILSPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEK
AAVLDTGASIHLARELELHDLVTVPVTTKEDAWAIKFLNILLMIPALQSEGHIREFPVFGEVEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQKKKDCFQVSL
YKYIFDAMVQGKVTPASLIHHTKLCPEKPLGPSVLRHARKGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLGTEIVAFEEKEVRAKVQHYMAYWMGHR
EPQGVDVEEAWKCRTCTYADICEWRKGSGVLGSTLGPQAKKAK*
10 >lcl|XP_001083988.1|Plus12382563..2382907 NW_001096630 transmembrane protein 14D-like TMEM14D __SEG__ Chr11 {Macaca mulatta} MEKGPFPLVPLHWFGFGYTALVVSGGIFGYVKTGRVLSLAAGLLFGSLAGLGSYQLSQDPRKVWVFLAATSVTFVGVTGMRSYYYGKIMPVGLIAGASLLMAAKVGVRML
MTSV*
11 >lcl|XP_001084616.1|Plus1674464..674910 NW_001095133 gametocyte specific factor 1-like isoform 3 GTSF1L __SEG__ Chr10 {Macaca mulatta} MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMAICKYNACHVVPIKKLEEHEAVCVNRSSVEEEDTENPLKVSLPSSEQNGDPQQVSPCLPSPDIWNVDGAN
CQHMFVLKTFVPQKLVCENDTKESAREISPQKILRPGQ*
12 >lcl|XP_001084660.1|Plus1complement(1867..2322) NW_001115293 coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial CHCHD2 __SEG__ Chr3 {Macaca mulatta} MPCGSRSRTSRMAPKASRTPQMRAAPRPAPVAQPPAAAPPSAVGYSAAAPGQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPGRPDIPYQEPQGTQPVQE
QQPCFYEIKQFPECAQNQGDIKLCEGFSEVLKQCRLAHGLA*
13 >lcl|XP_001084745.1|Plus1complement(560654..561706) NW_001099020 putative transmembrane protein 185B-like TMEM185B __SEG__ Chr13 {Macaca mulatta} MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASVGAGVWARNPRYRAEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTH
FWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITI
VVPLLTFEVLLVHRLDGHNTFSYISIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLHHEDSEDAEETSVPEAPKIAPIFGKKARVVI
TQSPGKYVPPPPKLNIDMPD*
14 >lcl|XP_001084846.1|Plus1complement(2034193..2035011) NW_001218119 centromere protein V-like LOC696195 __SEG__ ChrX {Macaca mulatta} MGRVRNRATAQRRRRKRPGDPPAGCAAIAVMGASRAQCPRVQVGVGSHAAAKRWLGRLRRKRRWRRVREAGPRNPLPSTPLPDPPAPAESPEELDLGAQRERWETFRKLR
GLSCEGAAKVLLDTFEYPGLVHHTGGCHCGAVRFAVWAPADLRVVDCSCRLCRKKQHRHFLVPASRFTLLQGADSIITYRSNTHPALHSFCSRCGVQSFHAAVSDPRVYG
VAPHCLDEGTVRSVVIEEVGGGDPGEKAAEEPKAIHKTSSQSAPACPREQEQ*
15 >lcl|XP_001085214.1|Plus11369603..1370058 NW_001099020 coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial CHCHD2 __SEG__ Chr13 {Macaca mulatta} MPCGSRSRTSRMAPPASRTPQLRAAPSPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQ
QQPFFYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA*
16 >lcl|XP_001085573.1|Plus1complement(828897..829787) NW_001101664 presqualene diphosphate phosphatase PPAPDC2 __SEG__ Chr15 {Macaca mulatta} MPSPRRSVEGRPLGVSASSSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATGVDPTCARLRASESPVHRRGSFPLAAAGPSQAPPPPLPEEDRMDLNPSFLGIALRSLLAI
DLWLSKKLGVCAGESSSWGSVRPLMKLLEISGHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVDKYSFPSGHATRAA
LMSRFILNHLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVVFGFFLGYMQYSIVDYCWLSPHNAPVLFLLWSQR*
17 >lcl|XP_001085870.1|Plus1complement(1345489..1346610) NW_001218195 melanoma-associated antigen C2 MAGEC2 __SEG__ ChrX {Macaca mulatta} MPPIPGVPFHNVDDDSPASVESEDWVDAQDPTDEEEEEASSISSSTFYLVFSPSSFSSSSSLILGGPEEEVPSDVIPSLPESTPSSPPQSPPQGPSQSPLSSCCSSFSWS
SFSEESSSQKEEDTSTCQGLPDSESSFTHTLDEKVAELVAFLLLRYKAEEPVTEAEMLMIVIKYKDYFPVILKRAREFMELLFGLALIEVGPDHFSVFANTVDLTDEGSD
DEGMPENSLLIIILSVIFIKGSFASEEVIWEVLNAIGVYAGREHFIYGEPRELLTKVWVQGQYLECREVPNSSPPYYEFLWGPRAHSESIKSKVLEFLAKLNNTVPSSFP
SWYKDALKDVEERAQAMTDTTDDATVMATESLSVMSSNLPFSE*
18 >lcl|XP_001085982.1|Plus15630867..5631832 NW_001104501 UPF0364 protein C6orf211 homolog LOC697395 __SEG__ Chr17 {Macaca mulatta} MKIASLSIIQSPPIDYFDVFKESKEQNFYESQESVIALCTYLQQLIKTIEDLDENQLKDEFFKLLQISLWGNKCDLSLSGGENSSQKTDVLNSLEDLKPFILLNDMEHLW
SLLSNCKKTREKASVTRVYIVLDNSGFELVTDLILANFLLSSELATEVPFYGKTIPWCVSDTTIHDFNWLIEQVKHGNHKWMSKCGADWEEYVKMGKWVYHDHIFWTLPH
EFCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTGDRKWEFSVPFHQALNGFHPAPLCSVRTLKAEIQVGLKPGQGEQLMASEPCWWTSGKYGIFQYDGPL*
19 >lcl|XP_001087950.1|Plus11606025..1606285 NW_001116522 splicing factor 3B subunit 5 SF3B5 __SEG__ Chr4 {Macaca mulatta} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*
20 >lcl|XP_001088161.1|Plus1396423..396662 NW_001102971 UPF0197 transmembrane protein C11orf10 homolog isoform 1 LOC696112 __SEG__ Chr16 {Macaca mulatta} MELEAMSRYTSPVNPAVFPHLTVVLLTIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV*
21 >lcl|XP_001088552.1|Plus12234856..2235140 NW_001116480 multiple coagulation factor deficiency protein 2-like LOC700155 __SEG__ Chr4 {Macaca mulatta} MYLTEGVINKPEVEMSPQELQLHYFKMHDYDGNDLLDGLELSIAITHVHKEKGSEQAPLMSEDELINIRDGVLRDDDKNNDGYIDYAEFAKSLQ*
22 >lcl|XP_001088807.2|Plus134886..36001 NW_001097664 EP300-interacting inhibitor of differentiation 3 EID3 __SEG__ Chr11 {Macaca mulatta} MSVEKASRKGDDEKGEEQLVVIPSSEYAAKPAAAEGAPMKMDVAVRVTGCSDDLSSGDADIDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVNSANNSLTEALEE
ANVLFDGVSRTREAALDAQFLVMASDLGKEKAKQLNSDLNFFNQLAFCDFLFLFGGLNWMEGEPDDLSDCDDNIALSFWKAMEKEATSWMVKAETFHFVFGSFKLEPSAP
KPRLEHQKKVRKMEENGNMPTKLRKLDLSSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRLPILEPMNVNQMG
EGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITYSSY*
23 >lcl|XP_001088976.1|Plus1complement(8151672..8152316) NW_001122891 UPF0428 protein CXorf56-like LOC698255 __SEG__ Chr8 {Macaca mulatta} MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVXXXXXXXDRSRVIDAAKHAHKFCNTEDEETMYLRRPGGIERQYRKKCAKCGLPLFYQFQPKNAPVTFIVDGA
VVKFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAEREAKKAKMKGTLIDNQFK*
24 >lcl|XP_001089072.1|Plus1complement(5882453..5883028) NW_001118156 pre-rRNA-processing protein TSR2 homolog LOC698741 __SEG__ Chr5 {Macaca mulatta} MAGAAEDARALFRAGVCAALEAWPALQITVENGFGGVHSQEKAKWLGGAVEDYFMRNADLELDEVEDFPGELLTNEFDTIVEDGSLPQVSQQLQTMFHHFQRGDGAALRE
MASRITQRKRKVTATALKTARETDEDEDDVDSVEDMEVTAPNDGAATDGVCSQPEPSDPDAQTIKEEDIVEDGWTIVWRKK*
25 >lcl|XP_001089085.2|Plus1complement(631..1044) NW_001121499 ATP synthase subunit s, mitochondrial-like LOC706761 __SEG__ Chr7 {Macaca mulatta} NIVNKLVIIVKANCFFSLANRVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQTDYNHLPTGPLDKYKIQAIDATNSCIMSIGFDHMGNYPVILLIGNADDFAVTIL
LQLTHNYSHRYVLFAHFSIVKFISSWV*
26 >lcl|XP_001089355.2|Plus1complement(834546..834968) NW_001218103 coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial-like LOC701053 __SEG__ ChrX {Macaca mulatta} MAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPASPDITYQEPQGTQLAQQQQPCFYEIKQF
LECAQNQGDIKLCEGFNEVLKQCRLANGLA*
27 >lcl|XP_001089729.1|Plus1239992..240402 NW_001101634 transmembrane protein 203-like isoform 2 LOC706164 __SEG__ Chr15 {Macaca mulatta} MLFSLRELVQWLGFATFEIFVHLLALLVFSVLLALRVDGLVPGLSWWNVFVPFFAADGLSTYFTTIVSVRLFQDGEKRLAVLRLFWVLTVLSLKFVFEMLLCQKLAEQTR
ELWFGLITSPVFILLQLLMIRACRVN*
28 >lcl|XP_001089932.2|Plus1complement(8487282..>8487881) NW_001122913 protein midA homolog, mitochondrial-like LOC701637 __SEG__ Chr8 {Macaca mulatta} HVEMFPDAGVITKELSQCIALTGGAALVADYGHDGTKTDDFRGFCGHKFHDVLIAPGRADLTANVDFSYLQRMAQGKVASLGPIKQHTFFKNMGIDVQPKVPLDKSNETS
IRQQLLQGYDMLMNPKKTGERLNIFALLLHQRLQGGRNQMNVCQSKRYASPVAGFSELVWQLYLSLNILPFGLPRKSKQRKHISYIAGK*
29 >lcl|XP_001090257.1|Plus1complement(1134..1580) NW_001108877 hcp beta-lactamase-like protein C1orf163-like LOC701973 __SEG__ Chr1 {Macaca mulatta} GLAQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHDGQVNEDGQPDLGKARDYYTRACDGGYASSCFNLSAMFLQGAPGFPKDMDLACKYSMKACDLGHIWACANASRM
YKLGDGVDKDEAKAEVLKNRAQQLHKEQEKGVQPLTFG*
30 >lcl|XP_001090429.1|Plus152651..52983 NW_001102926 transmembrane protein 93 isoform 1 TMEM93 __SEG__ Chr16 {Macaca mulatta} MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
*
31 >lcl|XP_001090820.1|Plus13000828..3002756 NW_001121212 lysine-specific demethylase NO66 C7H14orf169 __SEG__ Chr7 {Macaca mulatta} MDGLQASAGPLRRGRPRRRRKSQPHSGSVLALPLRPRKIRRQVRGTVPTMAQVLRAQTLPSKDSEDSRVESTAEDLGDTLPGGAAVAAVPDAARREPYGHLGPAELLEAS
PAARSLQTPPARLVPASAPPAGLVEVPAAPARVMETSALLCTAQHFAAAQSSGASATASGPQVDNTGGEPAWDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFY
RRLWEREAVLVRRQDHTYYQGLFSTADLDLMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLCPQAFSTTVWQFLAVLQEQFGSMAGSNVYL
TPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLA
VQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVH
MLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLRSYPEFVRVGDLPCDSVEDQLSLATMLYDKGLLLTKMPLALN*
32 >lcl|XP_001092141.1|Plus12712752..2713786 NW_001218103 melanoma-associated antigen B18-like LOC700524 __SEG__ ChrX {Macaca mulatta} MPRGQKSKLRAREKRHQARCENQDLGATQAPVAEGESSSSANLLFGDRPQNLPAAETLSIPEALQGAPSTTNTIAPVSCTSSNEGASNQDEKSLGSSREAEGWQEDPLSK
KVVSLVHFLLQKYEKKEPITKGDMIKFVIRKDKGHFNEILKRASEHIELAFGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFMNGNRAPEEAV
WEIMNVMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPDSDPPRYEFLWGPRAHAETSKMKVLEFVAKMHDTVPSAFPSCYEEALRDEEQRAQARVAARAHTAAMAN
ARSRTTSSSFSHAK*
33 >lcl|XP_001092839.1|Plus1complement(3637357..3638169) NW_001124214 2-aminoethanethiol dioxygenase ADO __SEG__ Chr9 {Macaca mulatta} MPRDNMASLIQRIARQACLTFRDSGGGRGASDRGAASGPEAPMPPGFPENLSKLKSLLTQVRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIP
LHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDC
HYYRVLEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP*
34 >lcl|XP_001093392.1|Plus12854030..2854689 NW_001218124 melanoma-associated antigen H1 isoform 2 MAGEH1 __SEG__ ChrX {Macaca mulatta} MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEAL
VWKVLGKLGMQPGRQHSIFGDPKKIVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGYSAP*
35 >lcl|XP_001093396.1|Plus1complement(891588..892202) NW_001108638 transmembrane protein 53-like isoform 1 LOC705023 __SEG__ Chr1 {Macaca mulatta} MVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLYRYVLELLQTRRFCHLRVVGTIFDSAPGDSNLVGALRALAAILERRAAVLRLLLLVAFALVVVL
FHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVPARDVERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVHC*
36 >lcl|XP_001093535.2|Plus14401525..4402568 NW_001218103 melanoma-associated antigen B10-like LOC705164 __SEG__ ChrX {Macaca mulatta} MPRGQKSKLRAREKRRQAREEPEPLMDAQATARVGIEFSSSSSAHFSSAIQSSTAPKTTSNPHGPQRATSTTTTAAAVSYLRSNESINNQTEERPRSSQALAANEHMTRS
PVDEKVFILVHYLLYKYQMKELIIKAAMLRDIVQIPRRYFSEILRKVSDHLEMVFGLDLKEVDPDRHIYFLINKLVPTYDAKLSDDRRVPRTGLLMTILGVIFTNGNCAT
EEQIWQVLNVMGLYEGRRHFIFGEPKKIITQDFVRENYLQYQQVPNSDPPRYQFLWGPRAHVETTKMKVLEFLAKIHDTVPSAFPTWYEEALKDEEERAQARLAARARIK
AVANARSQAILSRFSHP*
37 >lcl|XP_001093624.1|Plus14389463..4390506 NW_001218103 melanoma-associated antigen B10-like LOC702416 __SEG__ ChrX {Macaca mulatta} MPRGQKSKLRAREKRRQARGGLEDLIDALAILEEEEEYPPSPSSCLKDVSQSSLDGTANNPHGLWEALSISTSATAASHTRHTEGVNDQMEERPRCTQDLAATDNFPRGP
LGEKVIMLVHYLLYKYQMKEPITKADMLRNVTHMCKSQFPVILRRASEHLELIFGLDLKEVEPNKHIYVLINKLDLDCDARLSDETSVPKTGLLMTVLGIIFTKGNCAAE
EEIWKVFNMMGLYDGIEHFIFGEPRKLLTKDLVKENYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNNTVPSEFSTWYTEALQDEEERARARVAAKARISA
TAGARSKVKSSNSSQLQ*
38 >lcl|XP_001094148.1|Plus1complement(2399172..2399516) NW_001105685 transmembrane protein 14D-like isoform 1 TMEM14D __SEG__ Chr18 {Macaca mulatta} MEKSPFPLVPLHWFGFGYTALVVSGGIVGYVKTGRVPSLAAGLLFGSLAGLGSYQMSQDPRNVWVFLAATSVTFVGVMGLRSYYYGKIMPVGLIAGASLLMAAKIGVPML
MTSD*
39 >lcl|XP_001094313.1|Plus11142431..1143387 NW_001218104 melanoma-associated antigen B2-like LOC703594 __SEG__ ChrX {Macaca mulatta} MPRGQKSKLRAREKRRKARDETQGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAAAAAAGVSSTKSKKGAKSQGEKNASSSQASTSTESSSEDPL
TRKAGMLVQFLLYKYKIKESVTKGEMLKIVGKRFREHFPEILKKASERLSLVFGLELNKVKPNGHTYTFNSKVDLTDEECLLSTWDFPRSGLLMPLLGVIFLNGNSATEE
EIWEFLNMLGVYDGEEHLVFGEPRKLITQDLVEEKYLEYKQVPNSDPPRYQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPAHYEEALRDEGKAGV*
40 >lcl|XP_001094440.1|Plus11158139..1159179 NW_001218104 melanoma-associated antigen B3-like LOC703705 __SEG__ ChrX {Macaca mulatta} MPRGQKSTLRAREKCQRTWGQIQGHQGAQMTATQKKKVSFSSPLILEATIQKKSAGRSGSVLKKPQRALSTTTSVDAYHKKSYKGANSKIEKKQSFSQGLSSTVRSRTDP
LTIKTNMLVQFLMEMYKMKKPIMKADMLKIVQKRHENHFPEILKKASFNMEVVFGVDLKKVDSTKDSYVLVSKMDLPNNGTVTRGRGFPKTGLLLNLLGVIFMKGNCATE
EKIWEFLNKMRIYDGKKHFIFGEPRKLITQDLVKLKYLEYRQVPNSDPARYEFLWGPRAHAETSKMKVLEFWAKVNQTVPSAFQFWYEEALRDEEERVQAAATFNDGSSA
MGRKCSKVKASSSSHA*
41 >lcl|XP_001094745.1|Plus1complement(246527..247459) NW_001099007 protein IMPACT-like LOC700324 __SEG__ Chr13 {Macaca mulatta} MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQMMLPNEYSGTAPLIYQLSAPWLKGLECADLSNSLEEIYIQNIGESILYLWVEKIR
DVLIQTSQTTEPGPDVKKKTEEEEVECEDDLILARQPEGSVKALDFDISETRTEVEIEELPPIDHGIPITDQRSTFQAHLAPVVCPKQVKMVPSKLYENKKIASATHNIS
AYRIYCEDKQTFLQDCEDYGETAAGGRLLHLMEILNVKNVMMVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEESSKVLGKNKK*
42 >lcl|XP_001094809.1|Plus11172672..1173715 NW_001218104 melanoma-associated antigen B1 isoform 3 MAGEB1 __SEG__ ChrX {Macaca mulatta} MPRGHKSKLRAREKRRKAREETQGLKVAEATAAEKEECPSSSPVLGDTPASSLAAGIPQKPQGASPTTTAAAAVSCTESDEGAKGQGEENASSSQGTTSTEKSVKDPVAW
EAGMLMHFMLHKYKMREPIMKADMLKFVDEKYKDHFPEILNRASHRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGVIFLNGNSATEEEI
WKFMNMLGAYDGEEHLIYGEPRKFITQDLVKEKYLKYKRVPNSDPPRYQFLWGPRAYTETTKMKVLEFLAKVNGTTPRDFPSHYEEALRDEEERARVRSSVRARRRTTAA
SFRGRSRAAFSNSSQPM*
43 >lcl|XP_001095043.1|Plus11164195..1165238 NW_001218104 melanoma-associated antigen B4-like isoform 2 MAGEB2 __SEG__ ChrX {Macaca mulatta} MPRGQKSKLRAREKRQRTRAQTQDLKVGQATAAEKEESPSSSSSVLGDTPSSSLALGIPQKPQREPRTTPAAAAMSGTGPDEGEESQDEENASSSQASTSTERSLKDPLT
RKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPTNDGNQSSAWSLPRNGLLMPLLSVIFLNGNCAGEEE
IWEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAYAETSKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERTGARPRVAARRGTTA
VTSTYSRATSSSSSHPM*
44 >lcl|XP_001095272.1|Plus1complement(2912815..2913759) NW_001218199 melanoma-associated antigen 2 isoform 2 MAGEA2 __SEG__ ChrX {Macaca mulatta} MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQHTASSSSTLVEVTLGEVPAAESPGPTQSPQGASSFSTTINYTLWSQSDEGSSNQEEEGPRMFPDLESEFQAALS
RKVTELVHFLLLKYRAREPFTMTEMLESVMRNCQYFFPVIFSKASEYLQLVFGIEVMEVVPVGHLYILVTCLGLSYDGLLGDNQIMPKTGLLIIVLAIIAIEGDSVPEEK
IWEELSVLEVFDGREDSVFAHPRKLLTQDLVQENYLQYRQVPGSDPACYEFLWGPRALVETSYVEVLYHMLKISGEPHISYPPLHEWALREAEE*
45 >lcl|XP_001095416.1|Plus1complement(582920..584632) NW_001095149 thrombomodulin THBD __SEG__ Chr10 {Macaca mulatta} MLGVLLLGVLTLAGPGFPAPVEPQPGGSQCVEHDCFALYPGPATFLDASQICNRLRGHLMTVRSSVAADVISLLLSGDRGVSRRLWIGLQLPPGCGDPKPLGPLRGFEWV
TRDSNTSYSRWARLDLNGAPPCGPLCVAVSAAGATAPGEPVWEEQQCDVKADGFLCEFYFPATCRPLAVKPGAATAAVSITYRTPFAARGADFQALPVGSSAAVAPLGLE
LMCAAPPKAVQGHWAREAPGAWDCSVENGGCEHACNTIAGAPRCLCPAGAALQADGRSCTHSCNNLCEHFCVPNPDKPDSYSCMCETGYRLAADQHRCEDVDDCLLVPSP
CPQRCVNKQGGFECHCKPGYDLVDGECVEPVDPCFKANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPNTRGNCECPDGYILDDGFMCSDIDEC
ENGGYCSGVCLNLPGTFECICGPDSARVRLIGKDCDSAEVDGGDDGSGEPPRGPTPGCTSSPPAVGRVHSGVLIGISIASLCLVVALLALLCHLRKKQGAARAKMEYKCA
APSKEVVLQSVRTERKPQRL*
46 >lcl|XP_001096410.1|Plus1912611..913603 NW_001110969 protein FAM43B-like LOC705659 __SEG__ Chr1 {Macaca mulatta} MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKM
KLTLGPHGIRMQPCERGTAGGSGGRRPAHAYLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVLLARAHKARALVRLLRQTALAAFSDFKRLQRQSDARHVRQQ
HLRAGGAAASVPRAPLRHLLNAKCAYRPPPSERSRGAPRLSSIQEEDEEEEEEDDAEEREGGAPQHERPEVLSLARELRTCSLRGVPAPPPPAQPRRWKAGPRERAGQAR
*
47 >lcl|XP_001096489.2|Plus1803661..803924 NW_001095136 bladder cancer-associated protein-like isoform 1 LOC708044 __SEG__ Chr10 {Macaca mulatta} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
48 >lcl|XP_001096765.1|Plus14987067..4988155 NW_001112540 putative protein FAM172B-like LOC701808 __SEG__ Chr2 {Macaca mulatta} MTQELSFQKFIEQSDLLGELKYDFNEKAEFRHTETQRPFVFNYYENVLEKNSKRYQALGHLLEQYIYELLEKVCKLQKVYIPPEADEEEPRSFFFMSEKALTNHHSALLV
LLQDHGVFRAGQWSQQAIVHHGLQHGSQIPCIQMALQAHYDVMVLNPNDNFVELKMEKEWQGLLTQNIESSSLKMVPGGSFFSLQHPPKCIPKRCSNTPEEHMAYIWDYF
ISKTEGKDIAFIVHGYGGLVFMDLLVRRRWEVMSKVYAVALIDSEHHVGHQLGSDVQLLAWIKHHCREWVTSPKPLDKPAATVFKKEFPMVSAGTEKYSLAPSSSLQSIF
KYFKKALKARTTINFSQMPIVTRGSTKRKQSA*
49 >lcl|XP_001096859.1|Plus1complement(7407616..7409613) NW_001098160 tetratricopeptide repeat protein 30B-like isoform 2 TTC30B __SEG__ Chr12 {Macaca mulatta} MAVLSGAQIPDGEFTVVVYRLIRDARYAEAVQLLGREPQQSPRTRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YHSRVLRLQAAIKYSEGDLPGSRILVEQLLSGEEGEESGGENETDGQVSLGCLLYREGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIR
QHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDASPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENY
PMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDNPNRKMYHLCIVNLVI
GTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEI
IGWNI*
50 >lcl|XP_001096939.2|Plus11354144..1355409 NW_001114272 UPF0415 protein C7orf25-like isoform 1 LOC708455 __SEG__ Chr3 {Macaca mulatta} MSAHSMLCERIAIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLTHLRAIVESAENLEEVVSVLHVFGYTDTFGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASHQQPVQYSNPHIIFAFYNSVSSPMAEKLKEMGISVRGDIVAVNALLDHPEELQPSESESDDEGPELL
QVTRVDRENILASVAFPTEIKVDVCRRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERATML
IKRINVVSDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKDYTTDSEH*
51 >lcl|XP_001097223.1|Plus15831518..5832789 NW_001112574 protein FAM43A-like LOC708207 __SEG__ Chr2 {Macaca mulatta} MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMK
LTVSAQGIRMVHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHT
IPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQQEQELQEEEEEEEHPEGCPEEEENHAAEGDPAEEAEAQQALVVAMHFECGDLLDTLENGRGEALGGGGG
SLGPGAGPPPLLLGSASDMKAELSQLISDLGELSFGNDVRTLQADLRVTRLLSGDSTGSESSIEGGGPDATSATAGDSSGQADGASADESHSG*
52 >lcl|XP_001097293.1|Plus1complement(7472094..7474091) NW_001098160 tetratricopeptide repeat protein 30A-like isoform 3 TTC30A __SEG__ Chr12 {Macaca mulatta} MAGLSGAQIPDGEFTAVVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGENETDGQVNLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIR
QHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAVITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENY
PMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMYHLCIVNLVI
GTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHMIVIHDSVIQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEI
IGWNK*
53 >lcl|XP_001097423.1|Plus13100647..3101573 NW_001112555 melanoma-associated antigen F1 MAGEF1 __SEG__ Chr2 {Macaca mulatta} MLQTPESRGLPVPQAEGEKDGGHDGETRARTASQQRPKEELGAGREEGAAEPALTRKGARALAAKALARRRACRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDL
KALFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINRLKPLEEEEEEEDLGGDGPRLGLLMMILGLIYMRGNRAREAQVWEMLHRLGMQPSKYHFLFGYPKRLIMEDFV
QQRYLSYRRVPHTSPPEYEFSWGPRSNLEISKMKVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASARAGIHLW*
54 >lcl|XP_001098246.1|Plus1complement(63510..65081) NW_001218147 melanoma-associated antigen E2 MAGEE2 __SEG__ ChrX {Macaca mulatta} MSLVSQNARRCNAEITADYSDGRGEIQATNASGPPTPMLVVDVPQCPQAPINPQCVNTSQAVQDTNDLEVLIDEQSRRLGALRVHDPLEDRSIALVNFMRMKSQKEGSIQ
QSEMLEFLREYSDQFPEILRRASAHLDRVFGLNLRVIDPQADTYNLVSKRGSQITDRIVESLDMPKASLLALVLGHILLNGNRAREESIWDLLLKVDMWDKPQRINNLFG
NTRNLLTTDFVRMRFLEYWPVYGTNPLEFEFLWGSRAHSEITKMEALKFVSDAHDEEPQSWPEEYNKALEADKTKERSLTAGLEFWSEDTMNDKANDLVQLAISVSEELL
PIHQDELLAHTGKEFEDVFPNILNRATLILDMFYGLSLIEVDTSEHIYLLVQQPESEEEQVMLESLGRPTQEYVMPILGLIFLMGNRVKEANVWNLLRRFSVDVGRKHAI
TCKLMRQRYLECRPLSYSNPVEYELLWGPRAHHETTKMKVLEYMARLYRKRPQDWPEQYREAVEDEEARAKSEATTMFFLGPM*
55 >lcl|XP_001098366.1|Plus1complement(6881205..6883274) NW_001111354 ataxin-1-like LOC709805 __SEG__ Chr20 {Macaca mulatta} MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSANHTPSSDASEWSRGVVVAGQSQAGTRVSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTF
NVASSLIQHPGIHYPPIHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQAPSPAHSFNKAPSATSPPGQLPHHSSTQPL
DLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQSALEAAAANGGQRPRERNLVRRESEALDSPNSKGEGQGLVPVVECVVDGQLFSGSQTPQVEVAAPAHRGT
PDTDLEVQRVVGALASQDYRVVAAQRKEEPSPLNLSHHPPDHQGEGRGSARNPAELAEKNQACGFYPQSHQEPVKHRPLPKAMVVANGNLVPTGTDSGLLPVGSEILVAS
SLDVQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQ
GWSSCSPGRTTQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLGPPRARPERTVLGPRELCDSEGKSQPAGEGSHVVEPSQPEPGAQACWPTPSFQRYGMQG
EEARAALLRPSFIPQEVKLSIEGRSNAGK*
56 >lcl|XP_001098427.1|Plus1complement(148655..149071) NW_001116526 protein FAM136A-like LOC702859 __SEG__ Chr4 {Macaca mulatta} MAELQQLRVQEAVDSMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQGHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDQAKDSIDAGSKELQVKQQLDSC
VTKCVGDHMHLIPTMTKKMKEALLSIGK*
57 >lcl|XP_001098743.1|Plus1349692..352529 NW_001218148 melanoma-associated antigen E1 MAGEC2 __SEG__ ChrX {Macaca mulatta} MSLVSQNSRRRRRRVAKATAHNSSWDEMQAPNAPGFPADMPGSDVPQGPSDSQILQGLCASEGPSTSVLPTSAEGPSTFVPPTISEASSASGQPTVSEGPGTSLLATPSE
GLSTSGPPTISKGLCTSVTLAASEGRNTSRPPTSSEEPSTSVPATPGEGTSTSVPPTASEGPSTSVVPTPDEGPSTSVQSTAGEGPSTSVPLTATEGLSTSVQDTPDEGL
STSVPPTATEGLSTPVPPTPDEGPSTSMPATPGEGRSTSMLPAASDGQSISLVPTPGKGSSTSGPPTATEGLSTSVQPTAGQGPSTSVPPTPGEGLSTSVPPTATEGLST
SVPPTPGEGPSTSVLPTPGEGRSTSVPPTASDGSDTSVPPTPGEGPSTLVQPTASDRPGSSVLPNPGEGPSTLFSSSASVDRNPSKCSIVLPSPRVTKASVDSDSEGPKG
AEGPIEFEVLRDCESPNSITIMGLSTSRVAITLKPQDPMEQNVAELLQFLLVKDQSKYPIRESEMREYIVKEYRNQFPEILRRAAAHLECIFRFELRELDPEARTYILLN
KLGPVPFEGLEESPNGPKMGLLMMILGQIFLNGNQAKEAEIWEMLWRMGVQRERRLSIFGNPKRLLSVEFVWQRYLDYRPVTDCKPVEYEFFWGPRSHLETTKMKILKFM
AKIYNKDPMDWPEQYNEALEEDAARAFAEGWQALPHFRRPFFEEAAAEVASPDSEVSSYSSKYAPHSWPESRLESKARKLVQLFLLMDSTKLPIPKKGILYYIGRECSKV
FPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEETEEIVDSPNRPGNNFLMQVLSFIFIMGNHARESAVWAFLRGLGVQSGRKHVITCRYLSQRYIDSLRVPDS
DPVQYEFVWGPRARLETSKMKALRYVARIHRKEPQDWPQQYREAMEDEANRADVGHRQFFVHNFR*
58 >lcl|XP_001099236.1|Plus13055339..3056556 NW_001116480 NFKB activating protein-like NKAPL __SEG__ Chr4 {Macaca mulatta} MPPVSRSSYSEDILGSRRRRRSSSGSPPSPRSRCSSGDGRSRSHSRGREGLRPPWSESDVGALYPFSRSGSRELPPGLRNYAYPSSSSTSYSGYRYHHHYYAEERQWAED
YEKEKEENYRQRRLKERERIGELGAPEVWGPSPKFPEPDSDEHNPSEDEEEIMHQKRSGSDSNSEEHRKKKTSRSRNKKTRNKKSSKRKHRKYSVSDSNSDSDTNSNSVD
DKRVKAKKKEKKKKHKTKKYKKMKNKKTKKESSDSSCKDSEELSEDTWMEQPNMADTMDLIGPEVPIIPTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLT
SEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYKKTKGKDDK*
59 >lcl|XP_001099410.1|Plus1complement(204472..205110) NW_001100356 programmed cell death protein 10-like LOC708095 __SEG__ Chr14 {Macaca mulatta} MRMTMEEMKNEAETTSMVSTPLSAVMYPVFKELERVNLSAAQTLRAAFIKTEKENPGLTQDIIMKILEEKSVEGNFMESLLRMAADDIEEYMIEWPEPEFQDLNEKARAL
KQILSKIPDEINDRVRFLHTIKDIASAIKELLDTVNNVFKKYQYQNRRALEYKKKAFVKYSKSFSDTLKMYFKDGKAINVFVSANRLIHQTNLILQTFKTVA*
60 >lcl|XP_001099496.2|Plus12087779..2088732 NW_001218199 melanoma-associated antigen 4-like LOC710825 __SEG__ ChrX {Macaca mulatta} MSLEQKSQHCKPEEGVEAQEEALGLVGAQAPATEEKEAAASSSSPLVPGTLEEVPAAGSTGPPQSPQGASALPSTVNFTCWRQPNEGSSSQEEEGPSTSPDPESLFREAL
SKKVDELVHFLLLKYRAKELVTKAEMLERVIKNYKHCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGGNHIFPKTGLLIIVLGTIAMEGDSASEE
EIWEELSVMDVYDGREHSVYGEPRKLLTQEWVQENYLEYRKVPGSDPARYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLREAALREEEEGV*
61 >lcl|XP_001100757.1|Plus16519989..6521860 NW_001105662 transmembrane protein TTMA-like LOC707565 __SEG__ Chr18 {Macaca mulatta} MIATGGLLRISARKQDPLRPPSQIPKRKRKAKKRRKNDVVVVKGKLKLCSISGLIALCGILVLLVGIAMAVVGYWPKATGANREGGKQLPPAGSSHRVPTTANSSGSGSK
NRSRSHPRAPGGVNSSSAGAPRSTPPARVASPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLRDLYSTVIDVHSLRAKDLAA
AAAAAAAAAASSSSSAPPAAAPGAIPLNGFLSYVQSRGLELKPGSCGGAGDAFGAAAMLAKGSWPPHPAALSGGRPRGAASPPDLASSPRCPREPASLAEAVYSVYRERS
GVAGRRRAAAATATTAAAASSCSSPAPCSPPESWGRQSTASSLVDSSLSAFALLPLQGDRDRDGDAEGASCSWQRPPGERGSLEIPRGEVDLSLTNLRGAEGSMRGASQE
LEEPEGAVAARAARGQGGRLPRTGRYAALRRRSTSGLPDYRVPPSPEPPPSPGSADPDSSPLAKAASPSPPLRLEGSPPTRRDSGSSQSDDPSSSNKGYTPLREAGTSSE
SVLDAVASQTRDSMAAPVPGAEQSSPEGASQEPLTAEQPQPVQRQFTNKEKLFMISRSHAIGVEEGELESTGI*
62 >lcl|XP_001100760.1|Plus1831667..832014 NW_001106510 succinate dehydrogenase assembly factor 1, mitochondrial-like LOC711822 __SEG__ Chr19 {Macaca mulatta} MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTEEPGGVGSQPDDGDGPRNPHDSTGAPET
RPDGR*
63 >lcl|XP_001101885.1|Plus1complement(605642..606241) NW_001121180 ribonuclease P protein subunit p25 RPP25 __SEG__ Chr7 {Macaca mulatta} MENFRKVRSEEAPAGGGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLP
PGPTQGQTPGEPVASLSVLKNVPSLAILLSKDALDPRQPGYQPPNPDPGPSSPPAAPTSKRSLGEPAAGEGSAKRSQPEPGAADEDRTA*
64 >lcl|XP_001102061.1|Plus11456440..1457276 NW_001114199 metallo-beta-lactamase domain-containing protein 1-like LOC711102 __SEG__ Chr3 {Macaca mulatta} MRTEPLRGASPLLVPGDPYSVVVLLQGYAEPEGVGDAVRADGSVTLVLPQTRGPASSHRKSPRGSGGAEAALEDAACGPILVDTGGPWAREALLRALAGQGVAPGDVTLV
VGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEGQPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVVVAGDVFERDGDEDSWQALSEDPAAQERSRKRV
LVVADVVVPGHGPPFRVLREAAQTETEGGGNSEQEPVVGERSPPRTDQPREGLDSCKP*
65 >lcl|XP_001102987.1|Plus12060438..2061607 NW_001218154 protein FAM46D-like LOC708542 __SEG__ ChrX {Macaca mulatta} MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSIASYILASHNGISYKDLDIIFGVELPSNEEFQVVKDAVLGCLLD
FLPKGVKKEKISPDIMKEAYVQKFVKVCNGHDCWSLISLSNNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYPVVVAESMYGDFQEAMTHLQH
KLISTRKPEEIRGGGLLKYCNLLVHGFKPACMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLMTLRGVVNESTVCLMSHERRQILHLITMMAL
KVLGELNILPNTEKVTCFYQPAPYFVAEAGYPTYVTSEPPPIIFQPYYPLHFHGSNGMG*
66 >lcl|XP_001103255.1|Plus18347071..8347454 NW_001108982 brain protein 44 isoform 2 BRP44 __SEG__ Chr1 {Macaca mulatta} MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGTAGASQ
LFRIWRYNQELKAKAHK*
67 >lcl|XP_001103561.2|Plus119151506..19153383 NW_001101665 recQ-mediated genome instability protein 1-like isoform 1 RMI1 __SEG__ Chr15 {Macaca mulatta} MNVTSIALRAETWLLATWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYCQIQKLRGKN
TTNDLVTAETQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIFGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDPVLSV
IPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTMGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSMHFMDGELDDFSLEEALLLEETVQKEQ
METKELQPLTFNRNADRSTERFSHNPNTMNTFSLTCKNGNNNWSEKNVSEQMTNEDKSFDCPSVRDQNRSIFSVHRNVPLAHDFTNKDKNLETDNKIKQTSSSDGHSLNS
KILDREVVNYVQKRSSQISNENDRHLQTCSLRLPENSINFSIAMDLYSPPFIYLSVLLASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEIL
TSLIGFSVPEMKQLKKDPLQYQKFLEGLQKCQRDLIDLCCIMTISFNPSLSKAMVLALQNVNTEHLENLKKRLNK*
68 >lcl|XP_001104161.1|Plus12760942..2761433 NW_001124233 alba-like protein C9orf23-like LOC714421 __SEG__ Chr9 {Macaca mulatta} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGGLEGGSARHVVFSGSGRAAGKAVSCAEIVKWRVPGLYQLTKLRFLQTEDSWVPASPDTGLDPLTV
RCHVPAVWVLLSRDPLDPNECGYQPPRAPPGLGSMPSSSCGPRSRRRARDTRS*
69 >lcl|XP_001104234.2|Plus14716418..4717593 NW_001108782 protein FAM46C-like isoform 1 LOC714457 __SEG__ Chr1 {Macaca mulatta} MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPNATNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN*
70 >lcl|XP_001105949.1|Plus19513055..9513504 NW_001124107 oligosaccharyltransferase complex subunit OSTC-like LOC715641 __SEG__ Chr9 {Macaca mulatta} MENLYRVLFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVASMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAP
NIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG*
71 >lcl|XP_001106440.1|Plus12049480..2051792 NW_001104442 u3 small nucleolar RNA-associated protein 14 homolog C-like isoform 1 UTP14C __SEG__ Chr17 {Macaca mulatta} MNVNRVAESLLALSQQEELVDLPKNCPLSENEDEGDSDGERKHQKLLEAISSLDGKNRRKLAERSEASLKVSEFNVSSEGSGEKLVLADLLEPVKTTSSLATVKKQLNRV
KSKKVVELPLNKEKIEQIHREVAFGKTSQVLSKWDPIVLKNQQAEQLAFPLGKEQPAIAPIEHALSGWKARTPLEQEIFNLLHKNKQPVTDPLLTPMEKASLRAMSLEEA
KMHRAELQRARALQSYYEAKARREKKIKSKKYHKVVKKGKARKVSKELEQLQKVNPTVALEELEKFENARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKN
KELTQKLQVASEIEEEEGGTEEVEELLVPHVVNEVQMNVEGPNPWMLRSCTSDTREAATQEDPEQLPEPATHEVSESEGERPVAEEEILLRDFEERRSLRKRSELNQDAE
PAGIQETKDSSSQEVLSELRALSQKLKENHQSRKQKASSEGTVPQVQREEPAPEEEAPLLLQRPERVQTVEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKE
KKEKEQLINVQNFLTTQSPSVRSLAVPTTIEELEDEEERDQRQMIKEAFAGDDVIRNFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSTKKRRQFLKAPEGPPRKD
KNLPNVIISEKRNIHAAAHQVQVLPYPFTHHRQFERTIQTPVGSTWNTQRAFQKLTTPKVITKPGHIIKPIKAEDVGYRSSSRSDLSVIQWNPKQITTRHSKELKKNSVG
*
72 >lcl|XP_001106761.1|Plus1complement(196519..196947) NW_001114201 inactive Ufm1-specific protease 1-like LOC713302 __SEG__ Chr3 {Macaca mulatta} MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGAGLHGELEKIYSHFAGGGGPVMVGGDADARSKALLGICIGSGTEDYVLVLDPHYWGTPKSPSELQAAGWV
GWQEVSAAFDPNSFYNLCLTSLSSQQQQHTLD*
73 >lcl|XP_001107455.1|Plus1complement(3537661..3537981) NW_001100395 COX assembly mitochondrial protein homolog LOC707027 __SEG__ Chr14 {Macaca mulatta} MALDRADQHLRHVEKDILIPKIMREKAKERYSEQVQDFTKCCKNSGVLIVVKCRKENSALKECLTAYYNDPAFHEECKMEYLKEREEFRKTGIPAKKRLQKLPTSM*
74 >lcl|XP_001108290.2|Plus15497076..5498590 NW_001102965 phosphatidylinositol-glycan biosynthesis class W protein-like PIGW __SEG__ Chr16 {Macaca mulatta} MSQKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSHTWKTRFFIDFVVLIVPMVATLTIWASFILLELLAVIIFGAGLFYQIYRRRTCYARLPFQ
KILEKFLNISLESEYIPAISCFRVITSAFTAIAILAVDFPFFPRRFAKTELYGTGAMDFGVGGFVFGTAMVCLEVRRRKCMEGSKLHYFTNSLYSVWPLIFLGIGRLAII
KSIGYQEHLTEYGVHWNFFFTIIVVKLITPLLFIIFPLNKSWIIALSVTVLYQLALDFTSLKRLILYGTDGSGTRIGLLNANREGIISTLGYVAIHMAGVQTGLYVHKNR
SHIKDLIKVACFLLLAAISLFISLYVVQVNVEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTSKKHSEYLIPEAERMEPRLCL
ITALNRKQLIFFLLSNITTGLINLMVDTLHSSTLWALFVVNLYMFSNCLIVYVLYLQDKTIQFW*
75 >lcl|XP_001109245.1|Plus1443026..443838 NW_001121225 WD repeat-containing protein 25-like LOC717591 __SEG__ Chr7 {Macaca mulatta} MASLVAYDDSDSEAERETAGSFDATGQMKDTSGVAGPPEKDFASGTLDVPKAGVQPTKHGSCEDPGGHRLPLAQLGRSDRGSCPSQRLQWPGKEPQVTFPIREPSRSSLW
TSHVPASHIPLAAARFKQVKLSRNFPKSSFCAQSESETVGKNDSSFRKKKCEDCVVPYTPKRLRQLQALSTETGNSKEMEPQGPPAGRAPAPLYVGPRVSEFIQPYLNSH
YKETTVPRKVLFHLRGHRGPVNTIQWCPVLSKSHMLLSTSMDKTFKVRLE*
76 >lcl|XP_001109266.1|Plus1complement(2923690..2924229) NW_001102965 peptidyl-tRNA hydrolase 2, mitochondrial-like isoform 1 LOC711736 __SEG__ Chr16 {Macaca mulatta} MPSKSLVMEYLAHPSALGLAIGVACGVCLGWSLRVRFGMLPKSKTSKTHTDTESEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEY
CGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY*
77 >lcl|XP_001109487.1|Plus1complement(70066..70884) NW_001218563 centromere protein V-like LOC717718 __SEG__ ChrX {Macaca mulatta} MGRVRNRATAQPRRRKRPADPPAGCAAIAVTGASRAQCPRVQVGVGSHAAAKRWLDRWRRKRRWRRVRKAGPRDRLPSAPPRDPRGPARSPKELDLGAQRERWETFRKLR
GLSCEGAAKVLLDTFEYLGLVHHTGGCHCGAVRFAVWAPADLRVVDCSCRLCRKKQHRHFLVPASRFTLLQGADSIVTYRSDTHPALHSFCSRCGVQSFHAAVSDPRVYG
VAPHCLDEGTVRSVVIEEVGGGDPGEEAAEEPKAIHKTSSQSAPACPREQEQ*
78 >lcl|XP_001109764.1|Plus1complement(343504..344403) NW_001121145 melanoma-associated antigen G1-like LOC712714 __SEG__ Chr7 {Macaca mulatta} MLQKPRNRGRSGGQAERDSDWSRGGNSGASRAGEHARARRDGFAEEAPSTSRGPGGSQGSQGARRSQASPAVGPRTQKQQELKVSELVQFLLIKDQKKIPIKRADILKHV
IGDYKDIFPDLLKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEVRGDQGTPTTGLLMIVLGLIFMKGNTVKETEVWDFLRRLGVYPTKKHFIFGDPKKLITE
DFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGSAPSS*
79 >lcl|XP_001111295.1|Plus121180784..21181602 NW_001116511 uncharacterized protein C18orf19 homolog LOC714503 __SEG__ Chr4 {Macaca mulatta} MQWNVPRTVSRLARRTCLEPHNAGLFGRCQNVKGPLLLYNADSKVVLVQGLQKQWLNLSAAQCVAKERRPLDAHSPQPGVLRYKQGKQHVSFKRVFSSSATAQGTPEKKE
EPDPLQDKSISLYQRFKKIFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLEGTSFTVKYLRSHG
YMSTPPPIKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE*
80 >lcl|XP_001112215.1|Plus1complement(2646316..2646924) NW_001100360 coiled-coil domain-containing protein 85B CCDC85B __SEG__ Chr14 {Macaca mulatta} MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*
81 >lcl|XP_001112330.1|Plus114095581..14096540 NW_001101663 ubiquinone biosynthesis protein COQ9, mitochondrial-like isoform 3 LOC715179 __SEG__ Chr15 {Macaca mulatta} MAAAAAVSGALGRAGWKLLQLRCLPVTRCRPALVPHAFHASAVGLRSSDEQKQQPPPSFSQQRSETQGAGKPDPESSHPPPRYTDQGGEEEEGYESEEQLQDRILTAALE
FVPTHGWTAEAIAEGAQSLGLSSAAASVFGRDGSELILHFVTECNARLTRVLEEEQKLVQLGQAEKKKTDQFLRDAVETRLRMLIPYIEHRPQALSVLMLPHNIPSSLSL
LTSMADDMWHYAGDQSTDFNWYTRRAMLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR*
82 >lcl|XP_001112372.2|Plus1complement(914631..915704) NW_001102932 uncharacterized protein C17orf59-like LOC716995 __SEG__ Chr16 {Macaca mulatta} MESSRGRPGPETDLLAVAEQQAAIFGGGPGRTSSEPPSGLRVSGEEEAENVGGANRHPRTSPKTSSCGVVHRPEREALEKEPGPQGTPSGAGSLSGAPGAEHEPSPSFRH
KDPAPPEGKPASGRDCRRGGPGGGMDVEQQEEEDNDEEAAAGGRASRSFSSRLQDSRSLDGLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANN
LQLKIRLSGAPPPPPSAPARPCPAPAPTPTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELER
ALQPVQGLARQVRDIRRTLEVLEALCK*
83 >lcl|XP_001113549.2|Plus14179814..4180980 NW_001102959 zinc finger protein 830-like LOC715130 __SEG__ Chr16 {Macaca mulatta} MPRRTETRIALGLVAKMASSASARTPAGKRVVNQEELRRLMKEKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHREKVAELKGAKEASQGSSA
SSAPQTAKRKAPDADGQDAKRAKATLVPQVQPSTSALPTNFDKIGKEFIRTTSSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDASKPLSDAQGKEHSVSSSREVTSSV
LPDDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIEC
YRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENADSDDEGELQDLLSQDWRVKGALL*
84 >lcl|XP_001114311.1|Plus1696694..697908 NW_001100361 zinc finger HIT domain-containing protein 2 ZNHIT2 __SEG__ Chr14 {Macaca mulatta} MEPVGPCGFCPAGEAQPARYTCPRCNAPYCSLRCYRTHGTCAENFYRDQVLRELRGRSASPSRLASALRRLRQQRDTEDEPGETGLSPGPAPGGLSGLWERLAPAEKTAF
ERLLSRGEAGRLLPPWRPWWWKRGAGPWRLLEELDDVPGSDAAGLEPALARTPPESMNDAFAAELAAAELVLGDVPGACTPAIPTRIPTLVSLSRGPVSPLVRFQLPNVL
FAYAHTLALYHGGDDALLSDFCATLLGVSGALGAQQVFASAEEALQAAAHVLEAGEHPPGPLGTRGAMHEVARILLGEGPTNQKGYTLAALGDLAKTLGRARKQAVLREE
RDHLYRARKKCQFLLAWTNENEAALTPLALDCARAHQAHAVAAEEVAALTGELERLWGGPVPPAPRTLIEELPG*
85 >lcl|XP_001115170.1|Plus124797861..24798655 NW_001112571 proteasome assembly chaperone 2-like LOC717110 __SEG__ Chr2 {Macaca mulatta} MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLSMSKIGYFYTDCLVPMVGNNPYATAEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWV
KSSGYARVIVLSSSHSYQRNDLQLHSTPFRYLLTPSMQRSVQNKIKSLNWQEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMVVLLKFISEGDNMPDALGL
VEYLNEWLQIIKPLSDDPTASTSRWKIPSSWRLLFGSGLPPALF*
86 >lcl|XP_001116318.1|Plus11228835..1229257 NW_001218093 UPF0308 protein C9orf21-like LOC720662 __SEG__ ChrX {Macaca mulatta} MAAPARVTRQVSGGAAPVPAPSSPNRGQPLATALAELPVLDARRQRVPFGALFRERRAVVVVVRHFLCYICKEYVEDLAKIPESFLQEANVTLIVIGQSSYHHIEPFCKP
TGYSHEIYVDPEREMYKRLGMKRGEEIAAS*
87 >lcl|XP_001117314.1|Plus1complement(<34..180) NW_001097876 TP53-regulated inhibitor of apoptosis 1-like LOC721227 __SEG__ Chr11 {Macaca mulatta} MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQ
88 >lcl|XP_001117648.1|Plus1complement(<1402..1974) NW_001122200 complex I intermediate-associated protein 30, mitochondrial NDUFAF1 __SEG__ Chr7 {Macaca mulatta} MALFHKVLRGTYILRKCSKPTSALHPLLGIRFADYSSSLQKPVASPGKASSQRKTEGGLQGHHQKEVALDITCPEEKPDVSFDKAIRDEAMDHFRRLKDEIVNHWKGPEG
RPLQEALLEQAKVVWQFRGKEDLDKWRVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESARSGYCAMISRIPR
89 >lcl|XP_002799106.1|Plus1complement(5556593..5558446) NW_001098167 secretogranin-2-like LOC706499 __SEG__ Chr12 {Macaca mulatta} MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIEKLRQQAHKEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDW
MRIILEALRQVENEPQSVPKENKPHALNSEKNFPIDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMD
EEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENTEKNEQINDEVKRSGQLGIQEEDLRKESKDQLSDDVSKVITYLKRLVNAAGSGRLQNGQ
NGERATRLFEKPLDSQSIYQLIEISRNLQIPPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNKMLSKSGYPKTVGRAGTEALPDGLSVEDILNLL
GMESAANQKTSYFPNPYNQEKVLPRLPYGPGRSRSNQLPKAAWMPYVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEH
LNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYLDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM*
90 >lcl|XP_002799374.1|Plus1646502..646957 NW_001099004 FUN14 domain-containing protein 2-like LOC100428810 __SEG__ Chr13 {Macaca mulatta} MAASSEGNFEGDIESVDLAEFAKQQPWWRKLFGPECGLSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHSGYIKVDWQRVEKDMKKAKEQLKI
RKSNQIPTEVRSKAEEVVSFVKKNLLVTGGFFGGFLLGMAS*
91 >lcl|XP_002800146.1|Plus11913076..1913567 NW_001101662 chromosome 9 open reading frame 23 ortholog C15H9orf23 __SEG__ Chr15 {Macaca mulatta} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTV
RRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS*
92 >lcl|XP_002800428.1|Plus15347686..5347904 NW_001102959 transmembrane protein 167A-like LOC100430718 __SEG__ Chr16 {Macaca mulatta} MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFIQ*
93 >lcl|XP_002800608.1|Plus1764259..764540 NW_001102977 DDB1- and CUL4-associated factor 7-like isoform 2 LOC717186 __SEG__ Chr16 {Macaca mulatta} MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVGRAGPRNPAGGERAPGAPFPGRSPGPRTLLRTRLRAMERFQCLALC*
94 >lcl|XP_002800863.1|Plus1complement(5394501..5394962) NW_001104503 AIG2-like domain-containing protein 1-like isoform 1 LOC706006 __SEG__ Chr17 {Macaca mulatta} MALVFLYGTLKRGQPNHRVLWDGAHGSAAFRARGRTLDPYPLVIAGEHNIPWLLHLPGSGRRVEGEVYTVDERMLRFLDDFENCPALYQRTALRVQLLEEGAPGAEEPPA
PTTVQCFVYSRATFPPEWAQLPHYDSYDSEGPHGLRYNPRENR*
95 >lcl|XP_002803213.1|Plus13221292..>3221567 NW_001114168 transmembrane protein 14C-like LOC100425934 __SEG__ Chr3 {Macaca mulatta} MQDTGSVVPLHWFGFGYAALVASGGIVGYVKAGSEPSLAAGLLFDSLAGLDAYQLSQDPRNVWIFLATSGTLAGIMGMRFYHSGKFMPADLI
96 >lcl|XP_002803944.1|Plus1complement(9045585..9047060) NW_001116523 transmembrane protein 200A-like TMEM200A __SEG__ Chr4 {Macaca mulatta} MIATGGVITGLAALKRQDSARSQQHVNLSPSPATQEKKPIRRRPRADVVVVRGKIRLYSPSGFFLILGVLISIIGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNEGG
VVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQRQMNGMYTGLMGETEVKQNGSSCASRLAANTIASFSGFRSSF
RMDSSVEEDELMLNESKSSGHLMPPLLSESSASVFGLYPPSSKTTDDKTSGSKKCETKSIVSSSISAFTLPVIKLNNCVIDEPSIDNITEDADNLKSRSRNLSMDSLVAP
LADTSESFQPVSTVLPRNHSIGESLSSQYKSSMALRPGTGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRNNSKGYMKLENKEDPM
DRLLVPQVAIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETRF*
97 >lcl|XP_002805522.1|Plus1172632..173066 NW_001122913 transmembrane protein 50B-like LOC100424791 __SEG__ Chr8 {Macaca mulatta} MAGFLDNFRWPECECIDWSEKRNAVASVVAGILFFTGWWIMIDAAVAYSKPEELNHAFHTCGVFSTLAFFMINAVSNAQVRGDTYESGCLGRTGARIWLFIGFMLMFGSL
IASMWIHFGADVTQTNTLICKSGKLKSYGPEITS*
98 >lcl|XP_002806482.1|Plus1<54426..55013 NW_001218199 melanoma-associated antigen 8-like LOC706478 __SEG__ ChrX {Macaca mulatta} RKYQIKEPVTKAEMLESVIKNYKNHFPEIFSKASECMQVIFGIDVKEVDPAGHCYVLVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMKGSCAPEEAIWEALSVMGLY
DGREHSVYWKLRKLLTQDWVQENYLEYRQVPGSDPVRYEFLWGPRALAETSYVKVLEHVARVNARVRISYPSLHEEALGEEKEGV*