SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab S    

ID / Description / Sequence
1 >lcl|NP_001229250.1|Plus110975358..10976410 NW_001867384 transmembrane protein 185B TMEM185B __SEG__ Chr18 {Equus caballus} MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVIAGASVGAGVWARNPRYRAEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTH
FWLLVFMPLFFVSPVSVAACVWGFRHDRSLELELLCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITI
VVPLLTFEVLLVHRLDGHNTFSYISIFVPLWLSLITLMATTFRRKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLHHEDSEDAEETSVPEVPKIAPMFGKKARVVI
TQSPGKYVPPPPKLNIDMPD*
2 >lcl|XP_001487903.1|Plus1complement(290347..291006) NW_001877041 melanoma-associated antigen H1-like LOC100050717 __SEG__ ChrX {Equus caballus} MPRGRKSRRRRNARAAEENRNSRKIQASEASETPMAISVIPSTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVARSNFQGTKKSLLMSILALIFIMGNSAKEAL
VWKVLGKLGMQPGRQHSIFGDPKKVVTEEFVRRGYLIYKPVPRSSPMEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGYSAS*
3 >lcl|XP_001488257.2|Plus1complement(24272816..24273895) NW_001877040 melanoma-associated antigen B3-like LOC100051850 __SEG__ ChrX {Equus caballus} MSRGQKRKLQTHEKRRQSQGGTQAPKGAQVTATKEEAFPSSSPPPFGVITPQGKPGARSHSALKKAQKALSTTTMSAAVSHTRSYEGANRKTAKKCSSYQAPLSTVQSQR
DPLTKVTGMLVQFLLHMLKMKKPIVKADMLKVVDKKYKSRFLEILKRASFSMEVVFGVDLKEVDSAKHSYILVNKMDLPNNGTVSCGRGFPKPGLLMNLLGVIFLKGNCA
TEEEIWKFLNQMRVYAGKKHFIFGEPRKLITQDLVKLKYLEYQQVPNSDPPRYEFLWGPRAHAETSKMRVLEFLAKINHTVPSAFESCYKEALRDEEERAQATGALRADT
DATASECCGPCLAAPPTSSEVEADSSLCG*
4 >lcl|XP_001488303.2|Plus123597623..23598711 NW_001877040 melanoma-associated antigen B1-like LOC100052033 __SEG__ ChrX {Equus caballus} MPRGQKSKRRAREKRRQARSKTQGPGSAQATAAEVEESPSSPVPGGTPSSSAAAGTSQGVPAPSSPAAGVSRPRSRVGAKSRVKKSENFSQASTSTESARNDLLTRKASM
LMEFLLEKYKMKEPIRKVDMLKLVHKRYKEDFPEILRRASERIELVFGLDLKEVKPNGQSYTLVSKLDVCDDGSMSDDWEYPKSGLLMPLLGVIFLNGNCASEEEIWGFL
NILGIYDGREHLIFGEPRKLITKDLVQQKYLEYRQIPDSDPPRFEFLWGPRAHAETSKMKVLEFLAKINGTTPSAFPFHYEEALREEEERAPARAAAGPATPATGSARPR
ARRRARPRARPRASPRASPRAMASSCSHPSEA*
5 >lcl|XP_001488370.1|Plus13102648..3103049 NW_001867412 transmembrane protein 60-like LOC100049981 __SEG__ Chr4 {Equus caballus} MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVF
IPLWALLAGALIELGYNVFFVRD*
6 >lcl|XP_001488640.1|Plus1complement(36994186..36994776) NW_001867387 chronic lymphocytic leukemia deletion region gene 6 protein homolog LOC100049937 __SEG__ Chr1 {Equus caballus} MAASGFCCLRCCRDAGTGHIPLKEMPAMQLDTQHMGADVVIVKNGRRICGTGGCLASVPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGQDVHSLVMRNDGALYH
NNEEKNRLPANSLPQEGDLVGITYDQVELNVYLNGKNMPCPASGIRGTMYPVVYVDDSAILDCQFSEFYHIPPPGFEKISFEQQIF*
7 >lcl|XP_001489388.1|Plus16826608..6828491 NW_001867394 recQ-mediated genome instability protein 1 RMI1 __SEG__ Chr23 {Equus caballus} MNITSIALRVETWLLATWHVKVPLRWLEACINWIQEENDNVNLSQAQVNKQVFEQWLLTDLRDLEHPLLPDGILEVPKGELNGFFALQINSLVDVGQPAYSQIQKLRGKN
TTNDLITAETQVTQKPWEAKPSRMLMLQLTDGVVQMQGMEYQSIPALYSDLPPGTKILIHGNISFRLGVLLLKPENVKVLGGEVDSLLEEYAQEKLLARLIGEPDPVASA
IPNNSNQSIPRITDVLDPALGPSDEELLASLDESDELAANNDTSLERICFSTGSSSNTVPIRQSSFEPGLVISPRPKEKSPNQSMHFSDGELDDFSLEEALLLEETVQKE
QMETKELQPLTLDRTMDETIERFSHKSKTLDNFSLICKNGNNNWNEKNSSEQMTNEDKSFICPSARDQNSSVFSVQRNVALPQDFTNKDKNSEIDDKVKQSISNSDGHSL
NNKILNGELVTYVPKRSSQISDENDRHLQTHSLRSSENSTNLSITMDLYSPPFIYLSVLMASKPKEVITVKVKAFIVTLTGNLSASGGIWSITAKISDGTAYLDVDFVDE
ILTSLIGYSVPEMKKLKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK*
8 >lcl|XP_001489877.2|Plus13168889..3169299 NW_001867407 membrane magnesium transporter 1-like LOC100055808 __SEG__ Chr30 {Equus caballus} MAPSLWRGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHNEGEFKDVDAASELKNKTFDAFRNHPSFCVFNHRGRVLFRPSDTTNSS
NQDALSSSTSLKLRKLESLRQNFYKL*
9 >lcl|XP_001490242.2|Plus111570369..11571388 NW_001877040 melanoma-associated antigen B17-like LOC100056445 __SEG__ ChrX {Equus caballus} MPRGQKSKLRARERRRQARAEDQGFGGAQATAAVEEESSSSSLPVSGGTPSSSPAAGTPQKSQRAQTASSSAAATFRTSSDESAHEENASSSQAPPSSESSCKDPLIRKT
GELVKFLLYKYKIKEPITKAEMLKIVNNKYKKHFPEILQRTTEHLELVFGLDLKEVNPSGRCYALVSKLDLSDEGGLSGSTGFPKNGLLMPLLGMIFMNGNRTTEEEMWK
FLNLLGVYEGRRHFIFGEPRKLITQDLVEQKYLEYRLVPNSDPPCYEFLWGPRAHDETSKMKVLEFWAKVNHSAPSSFQAQYEEALRDEEERARARAAARAAASARIRSR
AMAGRPSQP*
10 >lcl|XP_001492662.1|Plus1complement(42724059..42725036) NW_001867387 necdin-like LOC100060951 __SEG__ Chr1 {Equus caballus} MSEQSKDVCDPNFTAEPSNSEVYGSPGVPGGPSPPASQAATLAGPESPPLGPTDASLALPPSQAPSEEGDPKALQQAAEEGRAHQAPSAAQPSPTPPAPAQLVQKAHELM
WYVLVKDQKRMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFSLVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRI
LGLRPWKKHSTFGDVRKLITEEFVQQNYLKYQRVPHVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREADPTAHCPRSSVSED*
11 >lcl|XP_001493441.2|Plus120017304..20018341 NW_001877040 melanoma-associated antigen B18-like LOC100061469 __SEG__ ChrX {Equus caballus} MPRGQKSKLRAREKRRQARAETKGLEGAQATAAAEGESPSSACLPFGGEPQNLPAADIPSTPLAPQGAPSTTNTMAADSCTYPDEDSSQDEKNATSSKGTKGRSGDPLND
KVVLMVQFLLQKYQKKEPITKADMLKLVTKNYKPHFNEILRRSSEYMELAFGVDLKEVDPIRHWYALVNKLELTFDGTMNNEEGMPKTSLLMIVLSVIFMQGNCAPEEEV
WKVLNMMGVYADRKHFIYGEPRKIITEDLVQLNYLEYQQVPNSDPPRYEFLWGPRAHAETSKMKVLEFLARLHDTIPSAFPSWYEEALKDEEERARARAAARARTAAAMA
SARSRAMARNFSHTK*
12 >lcl|XP_001493542.2|Plus120081568..20082614 NW_001877040 melanoma-associated antigen B3-like LOC100061607 __SEG__ ChrX {Equus caballus} MSRGQKSKRRTREKHRHTQDDSQSDRNIQATAATEEEPPSSSSPVLEGNSQSLSAVESSSTSHGSWMASSTSINSPGIFGRISHEGDNNQGEERPHSSQVLLSTGNSCSD
ILNIKADLLAQYLLYKYKMKQPILKEDMLRLVHRNYEDQFAEILKRASELIELAFAVEVKEADSTSHSYDLVSKLKLPNNGRVRGGRGLPKTGLLMNILGMIFIKGNHVT
EEEIWKFLNMMQVYAGRKHYIYGEPRKLITKDLVRLQYLEYRQVPNSDPPRYEFLWGPKAHAETSKMEVLEFMAKINDTVPTTFPLQYEEALQDEEERALARVAARPGTT
GHCQACSRVASSSFSHPY*
13 >lcl|XP_001493831.2|Plus121386565..21387626 NW_001877040 melanoma-associated antigen B10-like LOC100062075 __SEG__ ChrX {Equus caballus} MPRGQKSKLRAREKRRQALEESQDLVRAQATEGVGEEFCSSSFPCCKVISQSLQAPVSCCNSQGLQRTTSTTTNAATVSYTRSNDGASNEEGPRSSQDPTATEPLHRSPL
DEKVFILVYYLLYKYQMKEPITKADMLRNVIQNYRNHFHEILKRASDHLELIFGLDTRELDPYKHIYVLINKLEPNCDGRVSDGSSLPKSGLLMLVLGVIFMKDNCATEE
QMWEVLNMMGIFAGRRHYIYGEPRKLLTQDLVKENYLEYRQVPNSNPPRYEFLWGPRAHAETSKMRVLEFVAKVHNTVPSAFPTWYEEALQDEEERARARAAARARTAAM
ASARSRAMAGVRSRATASSSSHP*
14 >lcl|XP_001493894.2|Plus121435663..21436703 NW_001877040 melanoma-associated antigen B18-like LOC100062173 __SEG__ ChrX {Equus caballus} MPRGQKSKLRAREKRRQAQIETQRLQDAQATEAEEGSPSSPSPSFGGSPKSSPSAGSGSKSQRSRRAPPTTNTSAGVSCTRSDEGAKNQDEERPSTSQASASTDDPHRTP
LDQKAILLVEFLLRKYNMRDPITKQDMMRQVIKKHKAHFHVILKKASELMVLAFGIDVKEVDPIRHRYVLVSKLQRTSDDRLRGEKIMPKTGLLMTILCVIFMKANCAAE
EDIWEVLNVMGIYADKKHYIYGDANKLITEDFVQERYLEYRQVPNSDPPRYAFLWGPRAHAETSKMKVLEFLAKLHDTVPSAFPAWYEEALRDEEERARARFASLLRIGT
TANVPSGVNLGSLSQL*
15 >lcl|XP_001495269.3|Plus1complement(13918604..13919869) NW_001867412 UPF0415 protein C7orf25-like LOC100064260 __SEG__ Chr4 {Equus caballus} MSAHSMLCERIAIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLTHLRAIVESAENLEEVISVLHVFGYTDTLGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASRQQPVQYSNPHIIFAFYNSVSSPMAEKLKEMGISVRGDIVAVNSLLGHPEEVQPSESESDDEGPELW
QVTRVDRENILASVAFPTEIKVDVCNKVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERATVL
IKRINVVPDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKGYTNDNEH*
16 >lcl|XP_001496466.1|Plus121966445..21967215 NW_001867363 polycomb group RING finger protein 5-like LOC100062658 __SEG__ Chr10 {Equus caballus} MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPRENGQDD
TSKVDRPKVDEEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGE
NFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG*
17 >lcl|XP_001497352.2|Plus1<493532..494341 NW_001867368 four-jointed box protein 1 FJX1 __SEG__ Chr12 {Equus caballus} ARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALARVEARGAQWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSEDGHLRPLRAAGGELANR
SQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQRATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGQDAAARL
LRLYRHHEPRFPELAALADPHAQLLQRRLDFLAKHILHCKAKYGRRPGI*
18 >lcl|XP_001498436.2|Plus1complement(50540041..50540532) NW_001867394 alba-like protein C9orf23 homolog LOC100068566 __SEG__ Chr23 {Equus caballus} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTSPDTGLDPLTV
RRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSTPGSSCGPRPRRKARDTRS*
19 >lcl|XP_001498607.1|Plus11317997..1318809 NW_001867372 metallo-beta-lactamase domain-containing protein 1-like LOC100068735 __SEG__ Chr13 {Equus caballus} MSSLVQTKPLRGETPLLVPGGPYSVVVLLQGYAEPEEGDAVRADGSVTLVLPQAWGPASSHEEPPPTGGEAKSALEEAARGPILVDTGGPWAREALLGALAGQGVAPGDV
TLVVGTHGHSDHIGNLGLFPAASLLVSHDFCLPGGRYLLHGLGEERPLRLGPGLEVWATPGHGGQRDVSVVVAGTALGTVMVVGDVFEREGDEDSWQALSEDPVAQERSR
KRVLDTADVVVPGHGALFRVVREASQPETKDPGNSRQDSVVGDKEPTMHG*
20 >lcl|XP_001498728.1|Plus151848375..51850810 NW_001867411 toll-like receptor 10-like LOC100064614 __SEG__ Chr3 {Equus caballus} MRHIRSIYVFCCIVMSACGWASKLPEERELTTNCSNMSLRKVPVDLTPTTTTLDLSYNLLSQLQSSDFHSVSELKVLILCHNRIQELDIKTFEFNKELRYLDLSYNRLKI
VTWYSLTGLRHLDLSFNDFDTMPISEETGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGLRTLSHYEEGSLPILNTTKLHIVLPMNTNFWVLLRDGIKTSKILEMT
NVDGKSQFASYETQQNLILENAKTSILLLNKVDLLWDDLLLIFQFVWHTSVEYFHIQNVTFGGKVYLDHNSFNYSNTVMRAIKLEHVHYRVFYIPQERVYLLFTKMGIEN
LTISDAQMPHMVFPTCPSKFQYLNFANNILTDDLFKRSIHLPHLKTLILKGNKLETLSLVSCFANNTSLKHLDLSQNLLQHENDENCWWPETLITMNLSSNKFADSVFRC
LPQSIQILDLNNNKIQTVPKEMIHLKSLRELNLAFNFLTDLPGCSHFRRLSVLNIEMNLILSPSLDFFQSCQEVKTLNAGRNPFRCTCELRDFIQLEKYSEGMMVGWSDS
YICEYPLSLKGTQLKDVHLPELSCNTALLIVTIVVVMLILGMAATFCCLHFDLPWYLRMLHQWTQTWHRVRKATQGQLKRNVQFHVFISYSERDSAWVKHELIPNLEKED
GSVLICLHEGNFDPGNSITENIINHTEKSYKIILVLSPDFVQSEWYRYELDFTHHSLCHENSNYIILILLEPIPLYCIPTRYPKLKALMEKKAYLEWPKDRRKCRLFWAN
LRAAIHVNLVETRETSELQTFIELNEESQGSAISLIRTDCL*
21 >lcl|XP_001499602.3|Plus11718202..1719218 NW_001877049 melanoma-associated antigen 11-like LOC100069829 __SEG__ ChrX {Equus caballus} MGELCKREEDHQDPREAQGLVDAQLSGAEEEEAISPSSSPSVPFLSTLEEVAAAVTRSPDQGSQSAWPSPTAMAATPWSQYGDNGSSSQDEEGPNAWEDPGDTDSSLQDA
LRLKVTDLVGFLLLKYRTKEPTTKAEMLNTVLRDYQDHFPVIFSEASECMQLVFGVDVKEVDPSDHAYVLVTTLGLTYDGMLRGEQIMPRTGLLAMLLGVILLEGNCPPE
EGIWEALSVMGVRAGREHFIYGEPRELLTHVWVQEQYVEYRQVPSSDPACYKFLWHPRAHAETSKMKVLEYLLRVSSRDPSPFLHLCEEAVSDEEEAPEPEGSQARSRPT
SSSFSCWA*
22 >lcl|XP_001499718.1|Plus1complement(55801974..55803743) NW_001867379 tetratricopeptide repeat protein 39B-like LOC100069973 __SEG__ Chr15 {Equus caballus} MSFTLSKRENDKEDDVTSFTLIKGENDKEEKFEDAYEFIPVATTMNLVSSLEECTTGLYLFLNNRFSDAINLIHPWSKNSIYHALLYSILTVVKGILTFDPEDIQNGTTA
AQEALKTCHSFRRKSRMISFSHLVSKQGIKAIREEELHAEVCYAECLILKATITFIQEDSVLNFLKSGISVGSSYQIYKDCQQVLTHLPNHQSKTHRHLVGGIKFGLGAF
NLILSLVPPKTLKILNMVGYSGDRELGLTLLNESASESHLNNILSLLTLLFYYSYIHVAFGVEKGHSSAIEDLFLIYLQKFPKCVILKFFQARFSMLKGNFENAQLALEE
CIFLQNEWKQIHHLCYWELMWCHIFLQDWKHAYYYADLLFHHSRWSKTMYLYSKAVLLALFPSDFVKSLGEDMNSLFIKVDSLKAKILGTSVPIEKFVAEKGQRYGTTTG
WFTAQPLLEFIYAWSGFRIMSKKLGLIKSWLSIIDKGEELLREHPNKEYGTDDISFLNLLKGLCLKHLGRYSMAEEYFNRVIQKEKLLKYDHYLVPYTYYELGVLYYLKG
DHANATKSLDNIKNYKDYSMEARLQFRAHIALEQIAKEK*
23 >lcl|XP_001500335.2|Plus127094663..27095388 NW_001867402 transmembrane protein 200B-like LOC100070615 __SEG__ Chr2 {Equus caballus} MAFAVPGYWPHCARASGPKDPNASAPPLNEQRREGRGAGRCHGTHERLRLLRPVIMGVGIFVIICANKLLYENRDKETRRIRQGVLRAQALRPPDGPAWDCALLPSPGPR
TPRAIGCAEPESWDLSPRRGTSPVPSVRSLRSEPANPRLGLPALLSSYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRL
DRLSLGGYAKLGGGGDLGARV*
24 >lcl|XP_001500500.1|Plus1complement(22024571..22026637) NW_001867410 ataxin-1-like LOC100054435 __SEG__ Chr3 {Equus caballus} MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTF
NVASSLIQHPGIHYPPIHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQASSPAHSFNKVPSATSPPGQLPHHSSTQPL
DLAPGRMPIYYQMSRLPAGYTLHETAPAGASTVLTPQEGQSTLEAAPANGQRQRERNLIRRESEALDSPNSKGEGQGLMPVVDCVVDGQLFSGSQTARVEVAVPAHRGTP
DTDLEVQRVVGTLASQDYRVVAAQRKDEPSPLNLSHHTPDHQSEGRGSARNPAEMAEKNQARGFYPQSHQEPVKHRPLPKAMVVANGNLVPAGTDPGLLPMGSEILVASS
LDMQARATFADKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQG
WSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLGPPRERPERTVLGPREQCDSEGKSQPSGEGSRMVEPSQPEPGSQACWPAPSFQRYSMQGE
EARAALLRPSFIPQEVKLSIEGRSNAGK*
25 >lcl|XP_001500821.1|Plus1complement(2448343..2449518) NW_001867420 protein FAM46C-like LOC100059755 __SEG__ Chr5 {Equus caballus} MAEESGSPRDCVSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSQLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSSNPISEHLHPTVIGESMYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPNATNVTCYYQPAPYVSDGNFNNYYVAHPPVTYSQPYPTWLPCN*
26 >lcl|XP_001501466.2|Plus119792720..19794462 NW_001867381 uncharacterized glycosyltransferase AGO61-like LOC100067004 __SEG__ Chr16 {Equus caballus} MHLSAVFNALLVSVLAAVLWKHVRLREHAATLEEELALSRQAPEPAPALRIDYPKALQILMEGGTHMVCTGRTHTDRICRFKWLCYSNEAEEFIFFHGNTSVMLPNLGSR
RFQPALLDLSTVEDHNTQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAQEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQL
KTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGAPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDYAFAD
VVRLVSNASMLVSMHGAQLVTALFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDQAEQARILQSREVPRHLCCRNP
EWLFRIYQDTKVDIPSLIQSIRRVVKGRPGPRKQKWTVGLYPGKVREARCQAAVQGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYMLALQNHTFTENI
KPFTTYLVWVRCIFNKTLLGPFADVLVCNT*
27 >lcl|XP_001501558.2|Plus1complement(36760093..>36761280) NW_001867366 zinc finger protein 830-like LOC100071676 __SEG__ Chr11 {Equus caballus} GEEVTLSGIAGTEARLALGQGAKMASSSASGRTSAGKRVVNQDELRRLMKEKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHREKVAEVKGAR
EAAQGPSASAGPQPAKRRAPDAESQDAKRAKASAVPQVQPSTSALPTKFDKAGKESARAALSKASGLGLLPDYEDEDEEEEEGGGGEGKRGDASKQPADAQGREYSLSSS
REATSSRLPRDFADTNPPKAPLIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEIDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQIGE
IDEQIECYRRVEKLRNRQDEIKNKLKEVLTIKELQKKEEENVDSDDEGELQDLLSQDWRVKGALL*
28 >lcl|XP_001502492.1|Plus111210543..11210803 NW_001867409 splicing factor 3B subunit 5-like LOC100060669 __SEG__ Chr31 {Equus caballus} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*
29 >lcl|XP_001502564.1|Plus15516649..5517821 NW_001877044 protein FAM46D-like LOC100072545 __SEG__ ChrX {Equus caballus} MSEIRFSNLTWDQVVTLDQVLDEVTPIHGRGNFPTLEVKPKDIIHVVKDQLIEQGIIVKDSRLNGSTASYILASHNGISYKDLDIIFRVELPSDQEFQVVKDAVLGCLLD
FLPKGVKKEKITLKTMKEAYVQKMVKVCNKHDRWSLISLSNNTGKNVELKFVNSLRRQFEFSVDSFQIVLDPMLDFYSDKNAQLTKESYPVVVAESMYGDFQEAMTHLQY
KLICTRKPEEIRGGGLLKYSNLLVRDFKPACEAEIKILERYMCSRFFIDFPDVAEQQKKIESYLCNHFIGEEKSKYDYLMTLHGVVNESTVCLMGRERRQTLNMITLMAL
KVLGEQNILPNTDNVTCFYQPAPYFAANGGYPSYYVISGPPPVFFQPYYPLHFHVPNCTV*
30 >lcl|XP_001503330.1|Plus1complement(17643074..17644195) NW_001867402 probable exonuclease V-like LOC100053943 __SEG__ Chr2 {Equus caballus} MAETEEEEMVSAEASGFSDVSDSEFLEILDLDDSQESSASLSNPGPSSELPGKDGKLISLPKGKRGLDVSSPMERFHLNYLYVTDLSTQNWCEQQMIYGKEVPDFLVPEK
AAVLDTGASIHLARELEVHDLRTVPITTKEDAWAVKFLNMLLMIPTLQSEGRIREFPVFGEVDGVLLVGVIDELHYTAKGELELVELKTRRRPVLPLEAQKNKDYFQVSL
YKYIFDAMVQGKVTTASLIHHTKLHPEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLTLSDLPVIDILKIEYIHQETATVLATEVVAFEEKEVRGKVQHCMAYWMGHR
EPQGVDIEEAWKCRTCNYADICEWRQGGGVHSSTLEPQAKKAK*
31 >lcl|XP_001503791.1|Plus1complement(32523349..32523888) NW_001867366 peptidyl-tRNA hydrolase 2, mitochondrial-like LOC100071096 __SEG__ Chr11 {Equus caballus} MLSKSLVMEYLAHPGALSLAAGVVCGMFVGWGLRTHFGLTPESSVSKTDTETGTEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPQLLKEWEY
CGQPKVVVKAPDEETLVELLTHAKMLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPADLIDKVTGHLKLY*
32 >lcl|XP_001503850.1|Plus134631448..34632959 NW_001867366 phosphatidylinositol-glycan biosynthesis class W protein-like LOC100071410 __SEG__ Chr11 {Equus caballus} MSQKQMKEAFVSNHNGTSVLEITQGLCLPALCVLCRGLLIILSQHLCSSSHTWGTRFFIDFVILIVPLVATLTILSSFVLLEHLAVIIIGAGMFYHIYCRRTCYARIPVQ
KILEKFLKISVESEYIPAISCFRVINSAFTAVAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGTAMVSPEVRRKYMKGSTFYHLTKSLYSVWPLVFLGIGRLVVIK
SIDYQEHLTEYGVHWNFFFTLIVVKLITSLLLIIFPLNKSWIVAISITVLYQLALDFTPLRKLILYGTDGSGTRVGLLNANREGIISTLGYVAIHMAGVQTGSYVLKKRS
HIKDWIKVAYCILLTAISLFISLYIVQVNVEVASRRMANLAFCIWIVASSLILLSSLLLVDIILSFAKFLIKGAQVPCSWKLIQSPATNKKHSESLVSEAERREPSLCLV
TAMNRNQLIFFLLSNVTTGLVNLLVDTLHSSTLWALFVLNLYMFTNCLVIYVLHLQDKTIKFW*
33 >lcl|XP_001504320.1|Plus148569646..48571121 NW_001867364 transmembrane protein 200A TMEM200A __SEG__ Chr10 {Equus caballus} MIATGGVITGLAALKRQDSARSQHHVNLSPSPAAQEKKPVRRRPRADVVVVRGKIRLYSPSGFFLILGVLISIVGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNQGG
VVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRIKEQKHMNGIYTGLMGETEVKQNGSSCTSRLAANTIASFSGFRSSF
RMDSSVEEDELVLNESKSLGHLMPPLSSDSSVSVFGLYPPPSKTTDDKTSGPKKCETKSIVSSSISAFTLPVIKLNNCVIDEPSIDSITEDAENLKSRSRNLSMDSLVVP
LPNTAESFQPVSTMLPRNNSVGESLSSQYKSSVALGAGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRSNSKGYVKLENKEDPM
ERLLVPQATIKKDFTNKEKLIMISRSHNNLSFEHDEFLSNNLKRGTSETRF*
34 >lcl|XP_001504565.1|Plus126752284..26752523 NW_001867427 UPF0197 transmembrane protein C11orf10 homolog LOC100054666 __SEG__ Chr7 {Equus caballus} MELEAMSRYSCPGNRAVFLHLTMELLAIGMFFTAWLFVYEVSSTKYIQDIHKELLISLVALLFTDFGVLFLLLWVGVYV*
35 >lcl|XP_001504775.1|Plus146019231..46019563 NW_001867366 transmembrane protein 93-like LOC100060628 __SEG__ Chr11 {Equus caballus} MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
*
36 >lcl|XP_001504862.3|Plus1complement(49860087..49861151) NW_001867366 uncharacterized protein C17orf59 homolog LOC100062452 __SEG__ Chr11 {Equus caballus} MESPRGRPGPQADLLAPGEQQAAILGGGPSRTPSEPPSGLRLSEEEEAENVGGTSRHPRASPKTSSCSVVHPPEREAREDEPGRGGTPSGAGSCRGVPGPEHDPHGSSRR
KDPEPPEDKPASERACRRGSPGGGGMDAEQEEEDDEEVAAAGRVGRSFSSRLQDSRSLDGLSGACGGVGSAAGAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANNL
QLKIRLSGAPQPPPPAPARPCSMPAPTPAIPPIDPDVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQ
PVQGLARQVRDIRRTLEVFEALCK*
37 >lcl|XP_001504944.1|Plus126750125..26751348 NW_001867389 NKAP-like protein-like LOC100052393 __SEG__ Chr20 {Equus caballus} MAPTSGSRYPEDTPGSRRRRRSSSGSPPFAQARRSPWSGRSGSHSRGREGLRPRWGGTGVDTPHRLSRSGSRERLSGLRNYFFSSSSSTYCGGYRYHHHHYAGDRQWAED
CEKDKEESYRQRRLRERERIGEVGAPEVWGLSPKFPEPDSDERSPVEDEEVKTQESSISDSSLEEKKKKKTIRSKNKKKRKKKSKRKHRKYSDNSDSDSDSDTNSGSIDD
KKRAKKAKKKEKKKKHRAKKTKKRKNKKTKKDSSDSSCKDSEGEFPDHIWIKQSKIADTTALIGPEAPVIHTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIG
LTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDNN*
38 >lcl|XP_001505033.1|Plus12188680..2190251 NW_001877044 melanoma-associated antigen E2-like LOC100059259 __SEG__ ChrX {Equus caballus} MSLVSQNALHGSAETTADYSDGRGEMRATNASRPLTSMLVPDSPQSPQTPIDTQGASASEATQDPNDLEVLIDEQSRRLGALRVHDPLEDRSIALVNFMRMKSQTEGSIQ
QTEMLEFLREYSDQFPEILRRASAHLDQVFGLNLRVLDPQADTYNLISKRGIQTNDRVAESLDMQRAGLLALVLGHILLNGNRAREASIWDLLLKVDVFDEPQRINNLFE
NTRNLLTTDFVRMRFLEYWPVYGTNPLEFEFLWGSRAHREITKMEALKFVAEAHDEEPWSWPEEYNKALEADKAKERSQAAGLEFWSEDTMNDKANDLVQLTINVTEELL
PIHQDELLAHTGKEFEDVFPNILSRATLILDLFYGFSLIEVDTSEHIYLLIQQPESEEEQMMLESLGRPTQEYVMPILGLIFLMGNRVKEASVWNLLRRFGVDVGRKHAI
TCKLMRQRYLECRPLSYTNPVEYELLWGPRAHLETTKMKVLEYMARLYRKRPQDWPEQYREAVEDEEARARSEATAMFFFGPM*
39 >lcl|XP_001914982.1|Plus11338551..1339567 NW_001877049 melanoma-associated antigen 11-like LOC100147238 __SEG__ ChrX {Equus caballus} MGELCKREEDHQDPREAQGLVDAQLSGAEEEEAISPSSSPSVPFLGTLEEVAVAATTSPEQGHPSAQPSPTAMAATPWSQSRDNGSSIQDEEGPRVWEDPGDAKSSLQDA
LRLKVSDLVGFLLLKYRTKEPTTKAEMLNTVLRDYQDHFPVIFRQASEHMQLVFGIDVKEVDPSDHSYVLVTTLGLTYDGMLSGEQSMPKTGLLVMLLGVIHLQGDCVPE
EDVWEALSVMGVRAGREHFIYGEPRELITKVWVREQYVEYRQVPSSDPARYEFLWGPRAHAETSKMKVLEYFLRVSSRDPNPFLQLCEEAVSDEEGAPEPEGGQARGRPM
PSTFSCWA*
40 >lcl|XP_001915254.1|Plus13429015..3430469 NW_001877049 melanoma-associated antigen 10-like LOC100146341 __SEG__ ChrX {Equus caballus} MCIQGRPHTRTEETLQTPRPPTPAHQQPQNLGLCLILPEEPSHFLLQVRGDRLHWRTEPCEAESTPKRRPVSHLCQSRQGCVSHLRLLTLPLPPGPWVPIGRLLPTLLSA
ALTGVIMPRAPKRRRYMLEEGLQSQSETQGPVGALLPVAVEEDTSSSSTCSSSFPSSFPSSSSSSCYPLLLSTPEEVDDVTGAPSPPQSPQSAHPSPTAMASPPLSQSED
DSSSSRGEEGPSTSQAQPDTASFPRNVIDGKVAELVEFLLVKFHTKEPTTKAEMLNTVLRDYQDHFPVIFSEASECMQLVFGVDVKEVDPSDHAYVLVTTLGLTYDGMLS
GEQSMPKTGLLVMLLGVIHLQGDCAPEEDVWEALSVMGVRAGREHFIYGEPRELITKVWVREQYVEYRQVPSSDPAPYESLWGPRAHAETSKMKVLEYLLRVSSRDPNPF
LHLCEEAVSDEEGAPEPEGGQARGRPMPSTFSQEGPVSVMGTQG*
41 >lcl|XP_001915938.1|Plus1complement(2074807..2075235) NW_001867372 inactive Ufm1-specific protease 1-like LOC100147412 __SEG__ Chr13 {Equus caballus} MGDKPPGFRGSRSWIGCVEASLCLDHFGGPQGRLCHVPRGAGLERELERLYSHFAGGGGPVMVGGDADAQSKALLGVCLGPDTEAYVLVLDPHCWGAPKNSTELQTAGWV
GWREVSTAFDPNSFYNLCLTSHNAKKQQHALD*
42 >lcl|XP_001916864.1|Plus132886144..32886551 NW_001877040 brain protein 44-like protein 2-like LOC100057157 __SEG__ ChrX {Equus caballus} MAAVAALWRRARDYMKTKEFREYLMSTHFWGPVANWGLPLAAFKDMNAPPDIISGRMTTALILYSMAFMRFAYRVQPRNLLLMACHGTNVVAQSVQAGRYLSHHYGDGAA
AAATTATTAAITMTVAYDPADDSCR*
43 >lcl|XP_001917327.2|Plus1complement(53931178..53932458) NW_001867385 LOW QUALITY PROTEIN: mitochondrial ribonuclease P protein 1-like LOC100072187 __SEG__ Chr19 {Equus caballus} MPVFLKMSVSITFLRPFARCLVPFTLQRKRRVLYSTILQRYMSSKIPAVSYPNKESTSPPEQLELDGWKVTMKSSVQDEDASTVASSKDEDPLTATRELIEMWRLLGREV
PEHISEEELKTLMECVSKSSKKKYLKYLYVKEKMKKAKQIKKEMKAAAKEEAKDQLLETTKEDKQQNFLFLRLWDRNMEIAMGWKGAQAMQFGQPLVFDMAYAEYMKPKE
LQNTVSQLLESEGWNRRNVDPFHIYFCNLQLDGAYHRELVKRYGEKWNKLLLTATEKSHVDLFPKDSIIYLTADSPNVMTTFKHDKIYVVGSFVDKNMQSGTSLAKAKRL
KLATECLPLDKYLQWDTGTKNLTLDQMMRILLCLKNTGSWEEALKFVPRRKHTGYLEISQPSQEIVNRSKKSKTFNSFPKGSLNKRTQKR*LE*EYL
44 >lcl|XP_001917372.2|Plus1complement(55867899..55869890) NW_001867384 LOW QUALITY PROTEIN: tetratricopeptide repeat protein 30A TTC30B __SEG__ Chr18 {Equus caballus} MAGLASAQISDGEFTAVVYRLIRDSRYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YHSRVLRLQAAIKYSEGDLPGARSLVEQLLSGEGEDSGGENEPDGQVNLGCLLYKEGQYEAACSKFSAALQASGYRPDLSYNLALAYYSSRHYAPALKHIADIIERGIRQ
HPELGVGMATEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDSRPTEGFEKLQFLLQQNPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGLLTEQLRKLTIQVQEARHSRDDEAVKKAVNEYDDTLEKYIPVLMAQAKIYWNLENYP
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKLYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHDCAS*QCYSRMCPVSRTL*TFWQEHTRSY*TTPRRRKNAYWQEYSHV*IQTVKSFDF*DYR
MEYV
45 >lcl|XP_001918157.2|Plus1complement(48383594..>48385129) NW_001867366 platelet glycoprotein Ib alpha chain-like LOC100072850 __SEG__ Chr11 {Equus caballus} ISHNQLKACLCLGQALPALTTLDVSFNQLTSLFPHDLNGLSKLHELSLRGNKLKSLPPDLLRPTAQLKKLNLAENKLQELPPGLLDGLEDLDTLYLQQNWLYTIPKRFFG
DLILPFAFLHDNPWKCNCEILYFKHWLEANEKNVYVWKNGTDVKAMTPNVASVRCDNQPVYTYAGEGCSTAGDEDIDYDDYREEVTTMRGMVSFSTNTEANTTHQGLLYL
EPSASLQSQMPYLPPTEESTKKQTTFPYITEFIRFSKMSKSSTEPTTMPTTPEPTTPTTPEPTTTPSTPEPTTTPEPTTPPEPTTTLTTPEPTTTPEPTTMPTTPEPTTT
LTTSELTTPEPTSVTTNLESTKPTTDINSLMDPWARIKRIWIALDNDPFLNPDFCCLLPLGFYILGFLWILFASVVLILLLTWVQHGKPQALDFGQSAALATATHTTHLE
LQRGRQVTVPQAWLLFLQGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSLGRGQDLLGTVSIRYSGHSL*
46 >lcl|XP_003363265.1|Plus1complement(51743566..51744036) NW_001867383 gamma-glutamylaminecyclotransferase-like LOC100062328 __SEG__ Chr17 {Equus caballus} MTHVFVYGTLKRGQPNHKVLLGGTHGRAAFQGRGRTAEPYPLVIAGEHNVPRLLNVPGQGHRVVGEIYAVDEQMLRFLDEFEGCPDMYQRTSLPIAVLEWEGTRGAPRET
PAADRTVQCFVYSTATFPPEWLHLPYHDNYDSQGQHGLRYNPRENR*
47 >lcl|XP_003363972.1|Plus1complement(27844397..27844660) NW_001867392 bladder cancer-associated protein-like isoform 1 LOC100055373 __SEG__ Chr22 {Equus caballus} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
48 >lcl|XP_003364145.1|Plus117556005..17556400 NW_001867396 SH3 domain-binding glutamic acid-rich-like protein-like LOC100630609 __SEG__ Chr25 {Equus caballus} MVTRVYISSSSGCLAIKKKQQDVLGFLEANKIGFEEEEIASNEENWKWMRENVPENSQPATGYPLPPQIFTESQYRGDHEDFFEARENSAVYSFLGSTGPPGSKETEAQQ
SSMKLNHSALSILKKGSPLLL*
49 >lcl|XP_003364270.1|Plus1complement(25445030..25445392) NW_001867398 UPF0451 protein C17orf61 homolog LOC100630717 __SEG__ Chr27 {Equus caballus} MARPGAAFRHLGPLSRAGALGSACCGAHGAQFLDAYGKELFGKANKPSFHSLALMLGGSRYRKSLWVELLPASGSTLLCTSFYCQAEWRPSAQIVAPVEGACHSCAGLPL
LLVFNFWVIF*
50 >lcl|XP_003365183.1|Plus111347126..11347707 NW_001867422 akirin-1-like LOC100057095 __SEG__ Chr6 {Equus caballus} MACGATLKRPMEFEAALLNPGSPKRRRCAPLPGPTPGLRPPDAEPPPPLLQTQTPPPALQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACTSESQP
HSAALAAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS*