SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam S    

ID / Description / Sequence
1 >lcl|NP_001003116.1|Plus122848664..22849800 NW_879562 melanoma-associated antigen B10 MAGEB10 __SEG__ ChrX {Canis lupus familiaris} MPRGQKSKLRACKKRRQVREELQDLVGAQATAAVGEVFHSPSSLCFKSSPAAGSYSVSQGPQGAISTSTTAASVSHTRSNESADNQVEERPRSSQAQPTAEPFPRGPLDE
KVVKLVHYLLYKYQMKELISKAGMLRNVIQMYRNHFHEILKRASEHLELVFGLDLKEVDPNRHIYVLVNKLELSYDAMLSDDEGVPKTGLLMTILGVIFTKGNCAAEEQV
WQVLNVIGLYAGMEHFIFGEPRKLITEDLVKEEYLEYRQVANSDPPRYEFLWGPRAYAETSKMKVLEFLAKVHYTVPSAFPAWYEEALQDEEERAQARAAARAHTAAMAS
ARARAMTSAHSKGITNEHSRAMTNVHSRAIASVRSKATQTIPPTPNKV*
2 >lcl|NP_001010957.1|Plus1complement(12136453..12138195) NW_876276 glycosyltransferase precursor C23H3orf39 __SEG__ Chr23 {Canis lupus familiaris} MHLSAVLNALLVSVLAAVLWKHVRLREHAAALEEEVAAGRQAPAPGPAPRADYARALQLLSEGGTHMVCTGRTHTDRVCRFKWLCYSNEAEEFIFFHGNASVMLPNLGSR
RFQPALLDLSTVEDHNTQYFNFVELPAAALRFLPKPVFVPDVALVANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWSEGAHFDLYKLLSPKQPLLRAQL
KTLGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFARFMMEKLNVSQAGAPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDQAFAD
VVRLVSNASMLVSVHGAQLVTALFLPRGATVVELFPYAVNPDHYTPYKTLATLPGMDLQYVAWRNMMPENTVTHPERPWDQGGIAHLDRAEQARILQSREVPRHLCCRNP
EWLFRIYQDTKVDIPSLIQTVRRVVKGRPGPRKQKWTVGLYPGKVREARCQASVQGASEARLTVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYILALQNHTFTENI
KPFTTYLVWVRCIFNKTLLGPFADVLVCNT*
3 >lcl|NP_001229249.1|Plus129913758..29914810 NW_876267 transmembrane protein 185B TMEM185B __SEG__ Chr19 {Canis lupus familiaris} MNPRGLFQDFNPSKFLIYACLLLFSVLLPLRLDGVIHWSYWAVFAPIWLWKLLVVAGASVGAGVWARNPRYRAEGEACVEFKAMLIAVAIHLLLLMFEVLVCDRVERGTH
FWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNILQFIFIALRLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITI
VVPLLTFEVLLVHRLDGHNTFSYISIFVPLWLSLITLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLHHEDSEDAEETSVPDAPKIAPMFGKKARVVI
TQSPGKYVPPPPKLNIDMPD*
4 >lcl|XP_003431496.1|Plus1complement(6569185..6569424) NW_876250 uncharacterized protein C16orf61 homolog LOC100688556 __SEG__ Chr10 {Canis lupus familiaris} MHPDLSPHLHTEECNVLINLLKECHKNHSILKFFGRCNDLDREMRKCLKNEYMEKRTKSREHGNAMRKRLFNPAEESEK*
5 >lcl|XP_003431560.1|Plus1complement(17534542..17535648) NW_876251 EP300-interacting inhibitor of differentiation 3-like LOC100687031 __SEG__ Chr10 {Canis lupus familiaris} MSEEQGSRAGAVEEGEAPPGTLAATVHSVKQADDGEEPVKVEVADGCSDDLSCGEADIDPSLLELADDEEKCRKIRKQYRQLIYNVQQNRDDIVNTASDSLTEALEEANV
LFDGVSRTREAALDAQFLVLASDLGKEKAKQLNSDMSFFNQVAFCDFLFIFVGLNWMEDDEPGELSGCDDNIALSFWETVQKEATSWILQAETFHFIFGSFKSKPSAPKP
RLEHHKKAHKVEESGDMPTKLRKLDLSNNQEATEKEVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRLDQDRLPILEPININQVDEG
NDPSSHGRKQGVISLSLQDWKNIVATFEISEAMITNSY*
6 >lcl|XP_003431780.1|Plus1complement(12780598..12781056) NW_876254 ORM1-like protein 2-like LOC100683487 __SEG__ Chr12 {Canis lupus familiaris} MNVGVAHSEVNPNTQVMNSQGTWLAYIILVGLLHVVLLSIPFFSMPVVCTLTNVIHNLAMYVFLHTVKGTPFETPGQGKSQLLTHWEQMDFRLQFTSSRKFLSISPIVLY
LLASFYTKYDAAYFLNTASLLSILLPKLPQLHGVHLFGINKY*
7 >lcl|XP_003431950.1|Plus11334865..1335116 NW_876258 transcription elongation factor 1 homolog LOC100683954 __SEG__ Chr14 {Canis lupus familiaris} MGCRKSKRKPPPKNKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ*
8 >lcl|XP_003432202.1|Plus121580226..21596002 NW_876263 hypothetical protein LOC100687860 LOC100687860 __SEG__ Chr17 {Canis lupus familiaris} MESGDINTSLDHEVMPPGEIGPQVGHEVVETVEMTVGPQFKVAESVDITSRPQNQAIEPLNIPPGPVCQNTRSLEMISTPLHQVTDYTKVTPVALLQAVDFMGIIPSAQS
HVIEYGDSQSKIAKLTPGVTQPDGLTSGSPTTIGSPGVVETVGLPPKPPPKVTESVGVIPMPSHQSVHSLKVTPVALGSPMGMIIASQSQIVETPDLTSRPVSQVKEPLE
LTPGSWIQVLDSVGMTPQPYHQRTETMALTPGLSHQVIESSRMTPWDQILEPSEMSPRQSHQTIETRGLASDPTVTNLTELTQSPHQIMESLGTVPRSLGQSTASEGMNQ
EPLHQVTDSAVLTTTSLLPDVEYLGVKPMPQLKVVDSMKLSPGLQNVKPIDGTSGSIPQMAKYGQLIPTVNSIESAPELQLQVVNSDGLAPIPLLESGNSVQLAPTSQLQ
GLQSIRLTLGTQEQSGKSAELAPAPQLQNRKSMQLTSSPQLQGLEYVHLAVPPEFPDIKAAELTLRPLQEDMKSMELAPEPRLPDERPEEIAPALLLKDVKIPRMVECRR
LIPKTQVEGMKYEEPISGARIRAVKSAELNLKPNHEAIDPEGLTPWHQALESSGMITEPGYEGAEAELTSDTCHQRKESMELKQSSLGSTPRPLSQTLESMQMNSMPFQG
ALETMLQSVKALETRMSQHTIQESPELVPGSEIQDLTPEVMNPESQGMKSVHLNLGPYSEFMNYKELASEPQFQSVKSVPLTPGPRPQRTKPETLTLGPLMHDNKFVDLT
VPLEASGRLIPETHVESRKVTMEPHLEAMKSLSSTSRSRHQDTASAALASEIWPQEEESVKLIPQQVTETAGMMPRPHFQKFSEMTLGPGHQGTETAQLTSEALLQMALT
QKPTGQVMESTGMTLKPHCQVTEPSEMPVRSEHENTENFGLALLQVENIQETMPVPPYLVQGSPELTLGPGMQYEKSEPLLQNLKSVMSTPGTSPLMEGSKQFITGAKRH
VMELTAEPQLQGVKSMQLKPEPQLQDVEYVNVIQQLATTGVVGSEKLVQKPVLQSILSEDLTKGAQLQGVKLTPGPHLQSVRFSKLSPGPLLQGEKPVDLISGSPHHSVK
SDELTPGSPMQEMKSLDLTPGPNHQSVMSVQLTPESQTQSMKFVKQNSRPRLQDVRFSDLTSEPKHQGFKRVQCVPGTQLQDIQSVGFETESSLQSNQGLLNENMKSLLP
IEGLQFHSMESMKLTKELQYQGVKSQERNLGPRQQEVKFSELTYGPKLQGVKFGEQTPGSVFEGVNSVEMTPELGLQYSKLAKTSSGLQDLKQVGLSSGPWLQDIKFCDL
TSRSQPSSVKSSELNSGPQLQHVKFFELTPKPKMKGIRSMGLSPGPQKQVVKPEVLVPETLFQGIKHFVVGQMSNLEGNGPYKFISQPQKPDAKSMELTPESQLPRVNYS
ESTRRPHLQAIKSSEMIQGPHVGGVKPMELTPGSKRQGLKSELLISELKDVKSVALATGQCLKDMKSMLLTPSPQLEGEKSMETTTVQGIEHVKSVKDTKDTKLQVATPD
LALHARIQEFKGVEMVPRTQPQDVKTVELNFGLKMQGEKPVPFAPGPLLQKSEPQDVKPEELTLEPQTQDRKVVDSTPCGKHQSLKSVEETPDSELQHVKSVKLTPRVKK
QEVKSGNVTRRAKFQGVNSVDLAPSQQFQGMALMNFTSGPEQDGKISVISSKQQWKNSEQLKRRLKAEDGMSLELIPELKFKGRKLEDLNFELGFEDIKSLDWTPESNIQ
GLKPKEFKLEPQLQSLKSPKLTPGPQLHQVKPSESASEPQLCVKTLELQQEPLLESMRCSQWIPGPKFQAVKSVDLNLGSHSPGVKSAGLKSSTQLRDVKSSELTPGPKP
QSATYTEFNLGPQLQNVKTPEVLPGPQLQKGKALASTSEPQVQDVKTTEFKKEPQLETVRRIQWIPGPDFQAVKSVELNLGSHSPGVKSAGLKSSIQLRDVKSSELTPGP
KPQSATYTEFNFGPQLQNVKSPEVLPGPQLQKGKALASTSEPQLQDVKTIGFKREPQLETVRRIQWIPGPDFQAVKSVELNLGLQSQGVKSVELKALKQLRDRRSSALTP
RPKLQDIQSSSSLQEHQPQGFDLKPCLQVRSVKSCDLTSKSKFCDIKSMTFKSRLCLHDRKSTKLTAGPKLQEVKSLQSSPRAQLQGGRSLVLAEGPQLPDTKSGVLSQV
SQLQSGTTIELNSPRHLKRMKSSELTLRTKLQGVKSENFNSGSQWQDLKSSKLSPETKSQDMTFIELNPSSQMEGITFSKPTAGTKIQGAKFTDLFGSSLQGVNAAEGTS
QSKLQSVKHKESDPSPQTQVVKSSDLNLGSELQNMKLASSPEPQFQGEKCSKLISETECQDVESVKFKPGPQLRGMKSSELISGTKLQKVQSVDFKSAPQLQDMKPSRLI
MGIKLQDIKSTNFKSGPHLQDVKSSQVIPREKLQGMKSVELKPNPKLQGEKSSDLTLGRKFPAVKSGPQLQDVKCSELIMGIKLQDTKSTGFSSRSHFQGMKSSKVIPGS
KLQEVKSSEFNHGPKLQGGKSNLTQKRKFQGMKPVEFNPGPQRQGEKSDWIPECRLRDLKSVELKPVPQLQGVTSSELAPETKLQSGESVEFLARPMKQDMKSLELTLGA
KVKDVKSLGFGSAPQLQNRKLHMLTPGAHLQGVKSMKFNPGAKLQGAKSPESINLRIMKTTEVKHDPEFQVANPSELALKSKTCSVISSEFKAGKQWQEEKSCKLKPWPE
LQSMKFMVYNPGPHLQHIKSSELCKETKLHDVKAMEFNPEQQLQDVKSPELCKGTGMLQGMQSFELNPGPQLQEIKSELCTDVKLPYEQFLEFKHEPKLQGGKSSELNPG
PQLQCTNLVAFSTGPQLKGVKSELNPQPGLQGIKSQVFCLGPHVQGVNSSAFISNPKLQCVNSFGCNPEPPLQGINPSELTLVSKLQGMKSSEVSSGTEIASETSMVFNP
DRHLQDMKSELIPGSKFLGVAPMECNPGPQMKCVNSSELNAEPKLQCVNSMGCKRGPLLEGVQSFGLTSGTKCQGMGSEVNPGTKKQSETSVVFNLESHLQCLKSELIPG
SKFLGVAPMECNPGPQVKCVNSSELNPESKLPCVNSTGCILGPPLQGIQSFELTSGIKCQGMGPFDLNLGTEVLGVKSVMFNPMQHLQNVKCELTPGTQFQGITSREFNW
GPQLQSMNSSDLKPGLELQCINSIKFNPGPQMHGTKPSETNPTSEYQGTKSVLFNAGAYWQGVKSSELIPGTKFPEIQFLENHCGSQPQVVQSVFTLGSPLNGMKSVLFL
PEPLLNDVKSVEMNKEPLLCGANSVKLISGSELQDLKCEMFALEPCFKKMKYVELNPGPHPQGMNSEELPSHLRQHSVRSVVFAPKLCFQDVKSLELKPGPQTQNVNSKD
LNSCLRQKSVVFESEPRSQDVKSLKSNLLPHCQSANSLGLSTCLKSPHANSEAFAPEPCFQDMNSVELTPGFQQQGTNCRELTSGWQGMKSVVLAPEATKKFAPGPLLTS
VKFSDWSPESQQRDEKSLEFTPDPKLQSIKHVKLSSASLQQDTKSVELAPGALLQGTKAEMLNRKRSYQITDSEIIPRPGHQFVECAEMIPTPKHQVPKSMNLISIPVYH
ITERLAHQGNETTEKSVELTPKPTSKAMDSSRVPLRLDLQVPESVDLTPVLRNQGSKSSKLTLKKSYQIPETLELLSESRPQLRDLRELHTRPLQQAVGSEEITLEPRHH
TTETVGLTSKARQKGKEFLRVTPKPVSETTGYSERCPRPYPQALEFVEVISEKRLRRGESEALITKSLHHVPESPEMTSGLGYQVPESVGLTSRQWLQRRQSLALLQKQT
GQAVGHTESVELTSETWQPGDGSVGLPQSQNQSIKYSQRAPGVRAQITEVMRISPKPLDQVPGSTKTQLQAALSIGITPGAPQKVTEYVKVTPGPPLQVVKSVALTPGPA
FQMIDYVQLTPKLQDVRPSEFTSELWLQSVKSKELTTEPTHQILDIMKLTGFQIVKTVLIPWPPLQIVKSEELAPGPIPQVVEPIGVALGSAIEVIDCLDLQEIVEPVEL
TPRPNTHVKSAELLSQPACPFEEPAVFTHEQGLQAVKAIGIKIRPPQMMESEDLNLRQVYQNRECEDFTSREELQIGNYFSRFLHNSSNSLITSSGETEFGSLCDFEVPE
VSRALDIRNIGTDIFQPEESFIDPTMIQSSTLPFSLHNQLSDKIANIVETPHFEISGVGVISKTTDKKQVEELGNSLQGLSQHPPQSWRSPPRTFHSGSRIQRGLTSSVL
GRQQNVWENHSWRQRLPRKYLSNMLMLGDVLGTTMERKLCSPTSLMERATRDIRQSIQNLFGVPAELMKPSQSLLEKGRGVIPQPSVARNYIQRHTSCRGHEQRTALRIW
TRSSMSSIIQQYSGTRVRLKKSSKLTDISQDIFQHIPFSTSEGQPPAPVQLESSFNIVFTRKDSVPVEESENSLSFESQHSLKPSYLPHQAKTDFSEQFQLLQDLQLKIA
AKLLRSQIPPNVPPPLTSGLVLKYPICLQCGRCAGFNCCHKLQGTFGPYLLIYPQLHLVRTPEGHGEIRLQLGFRLQTGKRPQVPKYHRRDRPITPRSPISPSLRSAKVY
TRASKSPTSTIYFQSGSSQSPSPVRVHIRRRQYRGPDLVGKTEIRKPGLYEFSQVHSLPESVSESNQNVKWAKRKTKKTHNPKYPYPMKRITKGSRTQNTKLYTNGRSII
QSPSRELPAQVRSKRTGTSQTTSASLRRQSKKSSQPKFIQLLFQGLKQALQTAHRIMTSAGQKPVDRPRPDHSWSSKNQHLKQRARNDYLSRDIKRDRMSVVKVKPVDIT
TKQNMLWEEREQFRSAQPPERDSSFQLRRTQLPKPIVSQGSAAFKTSSLGQPMGIVQNDSSSKGKKKLYRSEISSQESKNSKTGTGVQVGGRNLHGSPHRTSHSHLKEKL
APKKQNHGFLRERTPYNSSVRSHRSPSERRCRSPSERSHRSTSQKSHHIPSERSHHSLSEKSHHSLSERSHQSASERSHRSLPQKSHHSPCERSHHSLSEKSHHSPSDRS
PRSLSGRSYHGASERSHRGPSQKSHHSASERRHHGPSQKSHHSPPERSHRSPQKSHHSPSERSLRSPQKSHHSPSERSLRSPQKSHHSPSERSHRSPSQKSHHSPSERSH
RSPSQKSHHRPSQWSHRSPSQKSHHSPSERSYHSLSVKSHRSPSERSYHSLSVKSHRSPSERRCRSPSERKCRSPSERRCRSPSERSH*
9 >lcl|XP_003432238.1|Plus130934000..30935775 NW_876263 tetratricopeptide repeat protein 39B-like isoform 1 LOC100685565 __SEG__ Chr17 {Canis lupus familiaris} MSLTLSKRENDKENVFTSFTLSKAESDEDKFEDAYETIPVATTMNLMSSLEECTTGLYLFLNNRFKEAIDLIHPWSKKSIYHALIYNILMVVKAILTFDPLDIQIGMTTT
KEALKTCNGFRRKSRMTSFSHLVNKQGIKAIKEEELHAEVCYAECLILKSTVTFIQDDSMFAFLKSAINIGLSYQIYKDCQQVLTQIPNNQSKTYRHLVGGVKFGLGAFN
LILSLVPPKTLKLLNIVGYSGDRDVGLTLLYESASESHINNILSVLTLLFYYSYIFVAFGVEKGHSSAVEDLFLIYLQKFPNCVILKFFHARFSMLKGNFKNAQLVLEQC
IFIQNEWKQFHHLCYWELMWCHVFLRNWKQAYHYADLLSHKSRWSKTIYVYSKAMLLALLPSESVKSESEDLNSLFLKVDSLRIKILGTSVPIEKFVAEKGQRYGTTTGW
FTAQPILEFIYAWSGFRVMSKKLDLISSWLSIINRGEDLLRENPNKEYGTDDISLLNLLKGLCLKHLGRYSTAEHYFNRVIQKEKLLKYDHYLVPYTYYELGILHYLKGD
YESATKNLDNIKNYKDYSMEARLQFRTHIALEQIAKEKRWS*
10 >lcl|XP_003432349.1|Plus1complement(17794244..17794645) NW_876265 transmembrane protein 60-like LOC100685779 __SEG__ Chr18 {Canis lupus familiaris} MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVF
IPLWALLAGALIELGYNVFFVRD*
11 >lcl|XP_003432355.1|Plus1complement(8942751..8943200) NW_876265 oligosaccharyltransferase complex subunit OSTC-like LOC100683242 __SEG__ Chr18 {Canis lupus familiaris} METLYRVPFLVLECPNLKLKKPPWVHMLLAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDQSNAP
NIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKVPGYLMG*
12 >lcl|XP_003432564.1|Plus125341309..25341758 NW_876269 oligosaccharyltransferase complex subunit OSTC-like LOC476204 __SEG__ Chr1 {Canis lupus familiaris} METLYRVPFLVLECPNLKLKRPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAP
NIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG*
13 >lcl|XP_003432797.1|Plus113345959..13346654 NW_876271 protein CWC15 homolog LOC476550 __SEG__ Chr20 {Canis lupus familiaris} MTTAARPTFEPARGWRGKGEGDLSQLSKQYSSRDLSSHTKIKYRQTTQDAPEEVRNCDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKTWVDQIPAANLDADDPLT
DEEDEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSE
FHKKFMGKYIK*
14 >lcl|XP_003432878.1|Plus112860994..12861314 NW_876272 coiled-coil domain-containing protein 56-like LOC100686063 __SEG__ Chr20 {Canis lupus familiaris} MAVPGAGDSLNAKSGQAPVAQCIDPTREKLTPAQLQFMRQVELAKWQKRLPQRRTQNILTSLGIRAVVLAIYGYTFYSVSQERFLDELEDEAKAARALALARASGP*
15 >lcl|XP_003433002.1|Plus126714814..26715263 NW_876273 akirin-2-like LOC100683015 __SEG__ Chr21 {Canis lupus familiaris} MEAQNNRHKRERELDTDSDTNSESEQLLYNIKQEYKRMQKRRHLETSFQQTDPCCTSEAQPHAFLLSGPASPGTSSATSSPLKKEQPLFTLRQVGMICERLLKEREEKVR
EEYEEILNTKLAEQYDAFVKFMHDQIMQRYREQPASYVS*
16 >lcl|XP_003433116.1|Plus1complement(50376177..50376647) NW_876274 gamma-glutamylaminecyclotransferase-like A2LD1 __SEG__ Chr22 {Canis lupus familiaris} MAPVFVYGTLKRGQPNHKVLLDGTNGCAAFQGRGRTVEPYPLVIAGEHNIPRLLNLPGQGQCVVGEIYAVDEQMLRFLDEFEGCPDMYQRMLVRIAVLEWEDTQGAPEET
LASDGTLQCFVYSTGTYSPEWVHLPSHDNYDSHGKHGLRYNPRENR*
17 >lcl|XP_003433151.1|Plus124178609..24178935 NW_876276 transmembrane protein 14C-like LOC100684734 __SEG__ Chr23 {Canis lupus familiaris} MQKDSGPLVPSHWIGFGYAALIASGGITGYAKAGSVLSLAARLLPCALASLGAFQLSQDLRNNWIFLATSGALAGIIGMRFYDSGKFAGASLSMVAKLGITVLNMPRQ*
18 >lcl|XP_003433208.1|Plus1complement(43249359..43249598) NW_876276 UPF0197 transmembrane protein C11orf10 homolog LOC100687785 __SEG__ Chr23 {Canis lupus familiaris} MELEAMRRYTSPVNPAVFPHLTVLLLAIGMFFTSWLFVYEVTPPSALGIIYKELLIPLVASLFLGFVVLFLLLWVSIFI*
19 >lcl|XP_003433241.1|Plus110736258..10736683 NW_876277 UPF0235 protein C15orf40 homolog LOC100682727 __SEG__ Chr24 {Canis lupus familiaris} MPKKAGVMNKGKSQEPERPPPSLGPVTVEPRGSVTIAIRTKSGSKQNAVTNVTTEAMSVAIAAPPSEGEANAKLCQYLPKVLELRKSDVILDKGDKSHEKVVRLLTSTTA
EEILEKLKQQVEKKEKQVIRNTSLRSFLNCY*
20 >lcl|XP_003433309.1|Plus1complement(26087781..26088044) NW_876277 bladder cancer-associated protein-like LOC100685444 __SEG__ Chr24 {Canis lupus familiaris} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
21 >lcl|XP_003433315.1|Plus1complement(31366951..31367451) NW_876277 gametocyte-specific factor 1-like LOC100687214 __SEG__ Chr24 {Canis lupus familiaris} MEPEALEICPYNPHHRVPLSRFQYHLASCRRKNPKKAKKMASCKYNACHVVPIKNLEEHEAACVNRSTMEEEDSLHPLKASLPNSEQNGNAPPGPPCLPSSDVWNVDGTN
CHPMFVLKTFVPQKLVCESDTRQSEREAHPPSLTTPQKTLRPREQTTSCKKEPLTS*
22 >lcl|XP_003433351.1|Plus118225028..18225363 NW_876278 protein FAM32A-like LOC100688978 __SEG__ Chr25 {Canis lupus familiaris} MVAYKQRQKGPLKVKGFAVFGVTKWKKKKDKDKAKLSEAMGASKKNKEGKQRGLDKQTPAQAAFEKMQEKWQVERILKKTSKTHKQRVEDFKRHLDTFSEHYDIPKVSWT
K*
23 >lcl|XP_003433419.1|Plus13925462..3925701 NW_876280 reactive oxygen species modulator 1-like LOC100688669 __SEG__ Chr25 {Canis lupus familiaris} MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIRMRGWELMGGIGKTMMQGGGTFGTFMAIGMGIRC*
24 >lcl|XP_003433435.1|Plus1complement(16442181..16442627) NW_876282 oligosaccharyltransferase complex subunit OSTC-like LOC100684247 __SEG__ Chr26 {Canis lupus familiaris} METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAP
NIPKLNRFLLFIGFVCVLLSFFMARVFMRMKLPGYLMG*
25 >lcl|XP_003433535.1|Plus144879297..44879527 NW_876284 hypothetical protein LOC100685574 LOC100685574 __SEG__ Chr27 {Canis lupus familiaris} MEVKLEVFRMTLYLTFPVTMFWIANQAEWFEDYVIQCKRELWPPEKEDQRRELEEFKERIRKQREEKLLRAAQQSS*
26 >lcl|XP_003433592.1|Plus1complement(44126820..44127311) NW_876284 alba-like protein C9orf23 homolog LOC486757 __SEG__ Chr27 {Canis lupus familiaris} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLHFLQTEDSWVPISPDTGLDPLTV
RRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGPTSSSSCGPRPRRRVRDTWS*
27 >lcl|XP_003434098.1|Plus1complement(3100419..3100691) NW_876297 UPF0139 membrane protein C19orf56 homolog LOC100687339 __SEG__ Chr32 {Canis lupus familiaris} MSDAWKANKVLKYKPLPVSFSLDDPTLDYMNLLGIIFRMYSLLLKLKWCPWRAVYCSFISLAKHMSSFMPSISAVVTSYLQHPQLMTLFW*
28 >lcl|XP_003434255.1|Plus125418358..25419575 NW_876302 NKAP-like protein-like LOC100682944 __SEG__ Chr35 {Canis lupus familiaris} MAPVSRSRYSKEAVGSRRWRRRSSGSPPLAQARRSPWGGLVRSYSCGREALRPPWGGSGVGARYPLGRSEFREPPPGPCDYAFSSSSVYYGSGSGYHCHHRHSPRDRQWA
EEYQEEEESYRQRRLKERERIGELGAPEVWGLSPKFPELDSDEHTPVEDDRAKAQKTAGSESSSEGKRKKASRSKSKKKRKKKSKKKHRKYSNDSDGNSDSDMDSSSDDD
KKRAKKARKKEKKKKHRARKNKKKKKTKKESSDSSFKDSEGELLEDIWIKQSKIADTMDLIGPEAPIIHTSQEEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLT
SEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK*
29 >lcl|XP_003434282.1|Plus1complement(4239148..4239378) NW_876303 TP53-regulated inhibitor of apoptosis 1-like LOC606907 __SEG__ Chr36 {Canis lupus familiaris} MNSVGEACTDMKREYNQCFNSWFEEKFLKGDGSRDPCTDLFKHSQQCVQKAIKEKEIPIEGLELMGHGKEKPESSS*
30 >lcl|XP_003434283.1|Plus1complement(507627..507863) NW_876303 UPF0327 protein C1orf151-like LOC100685995 __SEG__ Chr36 {Canis lupus familiaris} MSDSELGRKWDRCMADAVVKIGTGFGLGLVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ*
31 >lcl|XP_003434387.1|Plus14032791..4036351 NW_876306 hypothetical protein LOC100684492 LOC100684492 __SEG__ Chr3 {Canis lupus familiaris} MSQLSKNLGDSSPPAEAPKPPVYSRPTVLMRAPPASSRAPPVPWDPPPIDLQASLAAWQAPQPAWEAPQGQPPTPVAPMAQPPALGGPMVQAPPLGGPMGKPPTPGVLMI
HPPPPGAPIAQPPTPGVLMMHPSAPGAPMAHPPPPGTPMAHPPPPGTPLAHPPPPGTPMAHPPPPGTPMVHPPPPGTPMAHPPPPGTPMAHPPPPGTPMAHPPPPGTPMA
QPPTPGVLMAQPLTPGVLMVQPPAPGAPMAQPPPPGALMTQPPPPGAPMAKPPGPGVLMIHPPGSRAPITQPAASGAPMAQPAAPPAQPLASWAPQAQPLILQIQSQVIR
APPQVPQGPQAPPAQLATPPGWQATSPGWQAPPQGWQATPLAWQATQVTWQAPTIAWQAPPPVRQGPPPIRPGPPPIRPGPPPVRQAPPPIRQAPPLIRQAPPPIRPAPQ
VLATPPPLWQALPPPPPLRQAPQARLPTPQVRAAPQVRAAPQVPTAPAATQVPTAPPAGPQAPQAVLSAPLSAPQAVHCPPIIWQAPKGQAPVPHELPTSMEFQEVQQAQ
ALAWQASKAPGQFWQPVPTQEAQRQGPPVVQLEQPFQGVPASQKALQIQLPTQQAQPTGPQAELPTLQLQPSWQGPPAALQGQPGAPLAAANFPMGSAKSLMTPSGESRA
SSIERRTSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLPTAWKNLPATSETFTATSRVFPTTSRFQPASSNAFQGPSAPSETPKSLPLALQDPFACMEALPA
VPWVPQPSVNASKASQAVPTILMAKAAAPKAMATTQEASKTPAEPPRRSGKATRKKKHLNTEEDSSGQMLPLRDWQAPRPWENLNLNDWEVENSIQVLGDWEGPSTSRGL
SGWEGPSTSRILSGWEGPSTTWALSAWEGPSTSRALGLWESPGSPQPLIISEFTNLSQGFGVTQNDPKLETQPLSPLDERANALVQFLLVKDQAKVPIKRSEMVKFIIRE
YKDECLDIINRANNKLECVFGYQLKEIDPENHSYIIINKLGHHRGEPVASYLDRPKLGLLMVVLSLIFMKGNCVREDMIFSFLYRLGLDVRETHALFGNTKKLITEVFVR
QKYLEYRRIPYTEPAEYEFLWGPRAFLETSKMLVLRFLAKLHKRDPRCWPLQYFEALAECEAEDLDEDEPGSGDNAGDPTSSSPPR*
32 >lcl|XP_003434795.1|Plus15845878..5846117 NW_876317 UPF0197 transmembrane protein C11orf10 homolog LOC100685795 __SEG__ Chr6 {Canis lupus familiaris} MELEAMSRYTSPVNLAFFPHLTMVLLAIGIVFTAWLFIYEVTSTKYTRNIYKELLISLVASLFMGFGVLFLLLWVGIYV*
33 >lcl|XP_003434833.1|Plus1<36516833..36517264 NW_876321 phosphatidylinositol N-acetylglucosaminyltransferase subunit P-like LOC100684795 __SEG__ Chr6 {Canis lupus familiaris} SHRLSKATGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPEPWLNSLGLTYWPQKYWAVALPIYLITIVIGYVLLFGIRMMSTSPLNSIHIIIGNYAKNQQQN
KYQEEAIPVLRGNPISEVSHMLFLAAKELYAKN*
34 >lcl|XP_003434846.1|Plus1complement(49848527..49848766) NW_876321 UPF0197 transmembrane protein C11orf10 homolog LOC100684377 __SEG__ Chr6 {Canis lupus familiaris} MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDICKELLISLVASLFMGFGVLFLLLWVGIYV*
35 >lcl|XP_003435016.1|Plus111627264..11627881 NW_876323 UPF0454 protein C12orf49 homolog LOC610333 __SEG__ Chr7 {Canis lupus familiaris} MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVQDHDQPIPWKVQFHLGNSSRPGNQCRNSIQGKHLITDELGYICERKDLLVNGCCNVNVPG
TKQYRCDGCLPHGCCGAYEYCVSCCLQPSKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA*
36 >lcl|XP_003435046.1|Plus132189394..32189843 NW_876323 oligosaccharyltransferase complex subunit OSTC-like LOC100688081 __SEG__ Chr7 {Canis lupus familiaris} METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAP
NIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG*
37 >lcl|XP_003435106.1|Plus157183902..57184771 NW_876327 uncharacterized protein C9orf78-like LOC610833 __SEG__ Chr8 {Canis lupus familiaris} MPVTGKSFRQRRADSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQMKTGGMVDMKKLKERGKDKISEEEDLHLGTSFSAETNRRD
EDADMMKYIETELKKRKGIVEHEEQKVKPKNAEDCLYKLPENIRVSSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNIAMN
YVQHNRFYHKELNVPVRRNKDEPKARPLRVGDTEKPEPERSPPNRKHPANEKATDDYHYEKFKKMNRRY*
38 >lcl|XP_003435330.1|Plus1complement(15538244..15538693) NW_876332 oligosaccharyltransferase complex subunit OSTC-like LOC100688373 __SEG__ Chr9 {Canis lupus familiaris} MEILYRVAFLVLECPNLKLKKPPWVHMRSAMTVYAVVVVSYFLITGGIIYDVIVEPPSVGTMTDEHGHQRPVAFLASRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAP
NIPKLNRFLLLFIGFICVLLSFFMARVFMRMKLPGYLMG*
39 >lcl|XP_003435333.1|Plus1complement(16005524..16006063) NW_876332 peptidyl-tRNA hydrolase 2, mitochondrial-like isoform 1 LOC100682594 __SEG__ Chr9 {Canis lupus familiaris} MLSKSLVMEYLAHPGALSLAAGVACGMCLGWGLRVRFGMIPRSSVSETDTETGSEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPELLKQWEY
CGQPKVVVKAPDEETLVELLTHAKMLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPADLIDKVTGHLKLY*
40 >lcl|XP_003435335.1|Plus118238292..18239803 NW_876332 phosphatidylinositol-glycan biosynthesis class W protein-like LOC100683614 __SEG__ Chr9 {Canis lupus familiaris} MSQKQMKEAFVSNHNGTSVLEVTQGLCLPAFCILCRGLLIILSQYLCSSHTWRTRLFIDFVFLIVPLVATLTILSSFVLLEHLAVIILGAGLFYQIYCRRTYYARIPVQK
ILEKFLKISLESEYVPAISCFRVINSAFTAVAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFIFGTAMVCPEVRRKYAEEGSRFYYLTKSLYSVWPLVFLGIGRLVIIK
SIGYQEHLTEYGVHWNFFFTLMVVKLITSLLLIIFPLNKSWIVAISIIVLYQLALDFTPLKRLILYGTDGSGTRIGLLNANREGIISTLGYVAIHMAGVQTGSYMFKKRS
HVKDWIKVTYCILLTAISLFISLYIVQVNVEVVSRRMANLAFCIWIVASSLILLSSLLVGDIILSFAKFLTKGAIVPCSWKPVQPSATSKKHSESLVSEAERKEASLCLI
TAMNRNQLVFFLLSNITTGLINLMVDTLHSSTLWALIVLNLYMFTNCLIIFVLHLQDKTIKFW*
41 >lcl|XP_003435357.1|Plus1complement(7843297..7843524) NW_876333 uncharacterized protein C16orf61 homolog LOC100685530 __SEG__ Chr9 {Canis lupus familiaris} MHCLISLHLHTEECNVLINLLKECHKNHSILKLFGHCNDFDQEMRQCLKEYMEKRTKSREHGNVMRKGLFNPTEG*
42 >lcl|XP_003435541.1|Plus129042088..29042537 NW_879562 epididymal secretory protein E1 NPC2 __SEG__ ChrX {Canis lupus familiaris} MRLLVAAFLLLALGASALAEPVHFKDGGSAVGVIKELNVNPCPTQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINCPIQKDKTYSYL
NKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQIEG*
43 >lcl|XP_003435584.1|Plus1complement(58400586..58400918) NW_879563 succinate dehydrogenase assembly factor 1, mitochondrial-like LOC100684432 __SEG__ ChrX {Canis lupus familiaris} MSRASRLQRQVLSLYRRPGAKARAQAAFRQHASLPRSDVLHIEYLCRHGWRQLQLLRSGHTKAMGAFVRRQGPTKESSSAGASGAQPEDGGGPRNPFDSMGSPETPPDGR
*
44 >lcl|XP_003435641.1|Plus162094488..62095537 NW_879563 melanoma-associated antigen 10-like LOC100682826 __SEG__ ChrX {Canis lupus familiaris} MPRSLKPLRLTFEPDFQTPHEIQDLAVACVLTAEEEEDETTSVSSCSFTFSYPSTSFSPPSSPMIPASSEEEENPAATLSPPQSPQSSCSFSASCSTSNGVCNSQEQGSS
SPQTSKDAEYSPRDPLDESVADLVHYLILKYRLKESVTEAEMVKVVAERYKTQFSVIFRKATKCLEVISGIDMKELNPTTHSYILVNSLDFSHEEMLSDNQSMPKNGLLI
IILGVIFMGGNRALEKDIWDFLNIMGVYAGREHFLYGEPRKLITRDWVQENYLEYRQTPNRDPPCYEFLWGPRAHAETSKIKVLEFLAKIKGIDSISFSHWYEKALKDEK
EKAQDRVGVVDNTSAVNIA*
45 >lcl|XP_003435684.1|Plus1complement(2457300..2457884) NW_879563 WASH complex subunit CCDC53-like LOC100683393 __SEG__ ChrX {Canis lupus familiaris} MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNCFSTVCEEKLEDLSLRIQHIETTLNILDAKLSYIPGLDDVTFEVSPVSVTGVTNESHSETTSEKSQHN
SLQDSVLQRSEVTPENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGEGEKNTEESSDSESSFSD*
46 >lcl|XP_003435690.1|Plus12878808..2879044 NW_879563 UPF0327 protein C1orf151-like LOC100686113 __SEG__ ChrX {Canis lupus familiaris} MSDSELCRKWARCMADAVVKIGTGFGLGLVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYDKGQEQ*
47 >lcl|XP_532542.1|Plus1complement(2501544..2502707) NW_876259 probable exonuclease V DEM1 __SEG__ Chr15 {Canis lupus familiaris} MAETGEEVSAEEVSAEASGFSDLSDSEFLEYLDLEDTQESSASLSKPGPSSELPGKDDKLISLPKWKRRLDVSSPMERFHLKYLYVTDLSTQDWCEQQMVYGKELPGFLA
PEKAAVLDTGASIHLARELEVHDLVTIPITTKEDAWAVKFLNILSMIPILQSQGRIREFPVFGEVEGVLLVGVIDELRYTAKGELELAELKTRRHPMLPLEAQKKKDRFQ
VSLYKYIFDAMVQGKVTSASLIHHTKICPDKPLGPSVLRQARQGGFSVKSLGDLMELVFLSLTLSDLPLLDILKIEYIHQETTTVLGTEIVDFEEQEVKSKVQHYMAYWM
GHREPQGIDVEEAWKCRTCSYADICEWRKGGGMPSSILEPQAKKKSEMNRRICLQEL*
48 >lcl|XP_533248.3|Plus1complement(3005608..3006423) NW_876307 ubiquitin thioesterase OTUB1 OTUB1 __SEG__ Chr3 {Canis lupus familiaris} MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKE
LQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHI
IALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK*
49 >lcl|XP_535035.2|Plus129937746..29938087 NW_876285 vacuolar ATPase assembly integral membrane protein VMA21-like LOC477843 __SEG__ Chr28 {Canis lupus familiaris} MPRSHRPPPTAQRPANATGNAAGNAAEPKPEGGSLATTFKIFLLFAGLMVKVPVGLYFSCKLLLFQSLLLMSPDDSGFYATIVAVVGLHVVLAVFVFIVWKEGMPDWQEN
KSE*
50 >lcl|XP_535722.3|Plus17963729..7964997 NW_876298 mitochondrial ribonuclease P protein 1 RG9MTD1 __SEG__ Chr33 {Canis lupus familiaris} MSVFLKMNGSIILRSLARFLVPFTIPRKRRVLCSGVLQRYLSSKIPAVSYPNKESTSPPEKLELDSWKITMKSSVQDVSADSGSKDEDPVVAMKELIEMWRLLGREVPEH
ISEEELKTAMECVSKSSKKKYLRYLYIKEKAKKARQTKKELKAATKEKAIKDQLLETTKEDKQQNFLFLRLWDRNMDTAMGWKGAQAMQFGQPLVFDMDYGNYMKPKELR
NTVCQLLESEGWNRRDVDPFHIYFCNLQVGGVYHKELVRRYEEKWSKLLLTTTEKSYIDLFPKDSIIYLTADSPNVMTTFKHDKIYVVGSFVDKGTQKGISLAKAKRLKL
ATECLPLDRYLQWDTGTKNLTLDQMMRILLCLKNTGSWEEALRFVPKRKHAGYLEISPSSQEELVNRLKRSKTFNSFPKDSLKIHTQKRWLK*
51 >lcl|XP_537728.2|Plus1complement(20199404..20200519) NW_876332 zinc finger protein 830 ZNF830 __SEG__ Chr9 {Canis lupus familiaris} MASSASARAPAGKRVVNQDELRRLMKEKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHVLGKQHREKVAELKGAREATQGPSSSAAPQSAKRKVPDADG
QDAKRLKASPLPQVQPSTSALPTNFDKAGKESTRATLSKASGLGLLPDYEDEEEEEEEEEGGGGKGGDSSKQPPDAQGKDHSLSSPREATSSMLPSGFSDTNPPKAPLIP
HSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEIDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNK
LKEVLTIKELQKKEEENIDSDDEGELQDLLSQDWRVKGALL*
52 >lcl|XP_537986.3|Plus121500765..21501820 NW_879562 LOW QUALITY PROTEIN: melanoma-associated antigen B3 MAGEB5 __SEG__ ChrX {Canis lupus familiaris} MPRGQKSKHRTRTRTHTREKRHQSHGDSQSNEGVQSPEAQEESPISSSPALEGNTQSLSAPESTSTFQESCRASSTTIITSDISGTRSDEGENSQDEENLYFSEPLPSSE
SECLDILTMKVSLLEQFLLYRYKMKQPIMKEDILNIIGQNYKDHYSEILKQASEHIEIIFAVDLKEIDSTGHSYDLVSKVKLPNNGRVRAGRGLPKTGLLMTVLGVIFMK
GNCAAEEDIWKFLGMMRVYAGRKHFIYGEPRKLITKDLVRLQYLEYRQVSNSDPPRYELLWGPKAQAETSKMQVLEFLAKVSDTVPSAFSTRYEEALRDEEERVQARRSA
RHYCYSQYVL*GHIQQLFSPLL
53 >lcl|XP_537999.1|Plus134950908..34951279 NW_879562 brain protein 44-like protein 2-like LOC480882 __SEG__ ChrX {Canis lupus familiaris} MAMVAGLWQRARDYMKTKEFRDYVTSTHFWGPLANWGLPLAAIKDMNASPTIISGPMTTALIFYSMAFMRFAYRVQPRNLLLLACHSTNVVVQSVQVSRYLIHQYGGDSA
AATAGLTQRPYGC*
54 >lcl|XP_538082.3|Plus1complement(10262068..10263639) NW_879563 melanoma-associated antigen E2 MAGEE2 __SEG__ ChrX {Canis lupus familiaris} MSLVSQNARRGSAETTADYSDGQGEMQASNASGSPTSMLVPQALQGPHAPINPQGASAFQAAQDPNDLEVLIEEQSQRLGALRVQDPLEDRSIALVNFMRMKSQTEGSIQ
QAEMLEFLREYSDQFPEILRRASAHLDQVFGLNLRVLDPQADIYNLISKRGFQTSDQLAESLDVPKAGLLALVLGHILLNGNRAREASIWDLLLKVDLLGDPQRINNLFA
NTRNLLITDFVRMRFLEYWPVYGTNPLEFEFLWGSRAHREITKMEALKFVAEAHDEEPWSWPEEYNKALEADKAKERRQAAGLEFWSEETMNDKANDLVQLAINVTEELL
PIHQDELLAHTGKEFEEVFPNILSRATLILDLFYGFSLIEVDTSEHIYLLVQQPESEEEQMMLDSLGRPTQEYVMPILGLIFLMGNRVKEANIWNMLRRFGVDVGRKHAI
TCKLMRQRYLECRPLSYSNPVEYELLWGPRAHLETTKMKALEYMARLYRKRPQDWPEQYREAVEDEESRARSEATAMFFFSPM*
55 >lcl|XP_538708.1|Plus1complement(42253708..42254199) NW_876253 alba-like protein C9orf23 homolog LOC481586 __SEG__ Chr11 {Canis lupus familiaris} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPISPDTGLDPLTV
RRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGPTSSSSCGPRPRRRVRDTWS*
56 >lcl|XP_540260.2|Plus13446651..3447826 NW_876264 protein FAM46C-like LOC483142 __SEG__ Chr17 {Canis lupus familiaris} MAEEGSTTRDCVSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLELTLKDIVQTVRGRLEEAGIKVQDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRD
VVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGRNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSSSPISEHVHPTVIGESVYGDFE
EAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTL
NLISLLALRVLAEQNIIPNATNVTCYYQPAPYVSDGNFNNYYVAHPPVTYSQPYPTWLPCN*
57 >lcl|XP_540543.3|Plus1complement(7090714..>7091724) NW_876266 four-jointed box protein 1 FJX1 __SEG__ Chr18 {Canis lupus familiaris} GGAARGPPGGREGRAAVRGGVFWSRGLEERVPRGFSEAQAAAWLEAARGARLVALERGGCGRSSNRLARFADGTRACVRYGVSPEQIRGEALSFYLARLLGLQRHVPPLA
LALVEARGAQWAQVQDELRAAHWAEGSVVSLTRWLPNLTDVVVPAPWRSEDGRLRPLRAAGGELANRSQAELVDLVQWTDLILFDYLTANFDRLVSNLFSLQWDPRVMQR
ATSNLHRGPGGALVFLDNEAGLVHGYRVAGMWDKYNEPLLQSVCVFRERTARRVLELHRGRDAAARLLRLYRHHEPRFPELAALADPHAQLLQRRLDFLAKHILHCKAKY
GRRPGT*
58 >lcl|XP_540870.1|Plus126781476..26782669 NW_876266 zinc finger HIT domain-containing protein 2 ZNHIT2 __SEG__ Chr18 {Canis lupus familiaris} MEPAGPCGFCPAGEAQPARYTCPRCNVPYCSLRCYRAHGTCAEDFYRDQVLGELRGRSASPSRLASALRRLRRQRETEDDPEDAGLRPGPAPGGPSRLWELLAPAEKVAF
ERLLNRGEAGRLLPPWRPWWWGRGAGPRLLEEVGDAADRDPAELEPTPARTPPEPVKEAAAEPFLEDPPEACAPAVPTRIPVLASLSRGRASPLVRFQLPNVLFAYAHTL
VLYHGGDEALLSDFCATLLGVSGALGAQQVFASAEEALQAAAQVLEAGEHPPGPLGTRGAMREAARILMGESPANRKGYTLAALGHLAQTLSQARKQAVATEERDRLYRA
RKKCQFLLAWSNENEAALTSLALDCARAHRAHAVAAEEVVALTEELEQLWGGPLPPAPRILIEELPG*
59 >lcl|XP_540918.2|Plus1complement(29637686..29638564) NW_876266 leucine-rich repeat-containing protein 10B-like LRRC10B __SEG__ Chr18 {Canis lupus familiaris} MGVAESTPDALPSGAEEQLRSGEQQLELSGGRLRRLPGAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDSNKLERLPDGLCRLPRLTRLYLGGNRLLALPADFA
QLQSLRCLWIEGNFLRRFPRPLLRLAALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPP
RVADTVFLVGEGAVERMAERDEPTPRPPPRRAARALEDEDEEDLLGGSSGSRALGPPAGSRPALEAAPGPGT*
60 >lcl|XP_541681.1|Plus1complement(46986458..46986814) NW_876270 succinate dehydrogenase assembly factor 1, mitochondrial-like SDHAF1 __SEG__ Chr1 {Canis lupus familiaris} MSRPSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHASLPRSDVLRIEYLYRRGRRQLQLLRSGHAKAMGAFVRPQGPPEESSGAGASGAQPDDGGGLRSPLDSMGS
PETPPDGR*
61 >lcl|XP_545233.2|Plus1complement(5067861..5068823) NW_876301 melanoma-associated antigen F1 MAGEF1 __SEG__ Chr34 {Canis lupus familiaris} MLQKPESGALPILRAEGEKDGGRDGETQALAASQEAASPLLQETPGEHLGARREEGPAEPALAPRGARTLAAKASARRRAYRRLDRTVAELVQFLLVKDKKKSPITRSEM
VKYVIGDQKDLSPEIIARAAEHLRHVFGFELKQLGRKQHTYILINKLKPLEEEEEEEDLGGGGPRLGLLIMILGLIYMKGNSARETQVWEMLRRLGVRPSKYHFLFGYPK
RLIMEDFVQQRYLSYRQVPHSNPPECEFSWGPRSNLEISKMKVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARARARATETAGISPW*
62 >lcl|XP_545810.1|Plus13985169..3986146 NW_876306 necdin NDN __SEG__ Chr3 {Canis lupus familiaris} MSEQSKDVCDLVSAAEASNSEAHRSPGGPGEPSPSASQAATLAGPERRPSGPTDGSLASPPPQASSEEGDPKALQQATEEGRAHQAPTAAQPAPAPPAPAQLVQKAHELM
WYVLVKDQKRMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFSLVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRI
LGLRPWKKHSTFGDVRKLITEEFVRQNYLKYQRVPHVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREADPTAYCPRSSVSED*
63 >lcl|XP_546121.2|Plus14411294..4412106 NW_876311 2-aminoethanethiol dioxygenase-like LOC489003 __SEG__ Chr4 {Canis lupus familiaris} MPRDNMASLIQRIARQACLTFRGGGGGRSAPDLGSASGPEAPMPQGFPENLSKLKNLLTQVRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIP
LHDHPGMHGMLKVLYGTVRISCMDKLEAGGGQQPRPLPPEQQFEPPLQARERDAVRPGVLRSRAEYTEASGPCVLTPHQDNLHQIDAVDGPAAFLDILAPPYDPDDGRDC
HYYRVLEPVRDKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP*
64 >lcl|XP_546845.2|Plus111165078..11167141 NW_876316 ataxin-1-like ATXN1L __SEG__ Chr5 {Canis lupus familiaris} MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTF
NVASSLIQHPGIHYPPIHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQASSPAHSFNKAPATSPPGQLPHHSSTQPLD
LAPGRMPIYYQMSRLPAGYTLHETPPAGASPILTPQEGQSALEAAAANGQRQRERNLVRRESEALDSPNSKSEGQGLVPVVECVVDGQLFSGSQTARVEVAVPAHRGTPD
TDLEVQRVVGALASQDYRVVTAQRKDEPSPLNLSHHTPDHQCEGRGSARNPAEMAEKNQARGFYPQSHQEPVKHRPLPKAMVVANGNLVPTGTDPGLLPMGSEILVASSL
DMQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGW
SSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPGQLGPPRERPERTVLGPREQCDSEGKSQPSGEGSQMVEPSQPEPGAQACWPAPSFQRYSMQGEE
ARAALLRPSFIPQEVKLSIEGRSNAGK*
65 >lcl|XP_547666.1|Plus19744749..9745654 NW_876324 leucine-rich repeat-containing protein 30 LRRC30 __SEG__ Chr7 {Canis lupus familiaris} MGAKQSRAPCRDKGPRRMVLLRGRQPFAPWDDSLLPGKDPRALLKRGMRHVSFSLVTKGMTDVPDFLWGLSEVQKLNLSHNQLRAVPADVGKLSRLVVLNLCGNHLRSLP
REISVLQSLKVLFLNMNCLTELPAELSACRSLEVLSLSHNCLSQLPASLADLSRLRKLNLSNNYFAHIPICVFALKELDFLHVGSNRLENIAESIQCLAGLQIFIAESNN
IHSFPRSLCLLTSLELLNLNNNDIQTLPDELYLLWRLGRIAWNPMDKGLHISHNPLSKPLPELVEGGLDMLFSYLKDKKHH*
66 >lcl|XP_548342.1|Plus129319550..29319882 NW_876332 transmembrane protein 93-like TMEM93 __SEG__ Chr9 {Canis lupus familiaris} MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLVGGLFTYVLFWTFLYGMVHVY
*
67 >lcl|XP_548906.1|Plus121381788..21382825 NW_879562 melanoma-associated antigen B18 isoform 1 MAGEB18 __SEG__ ChrX {Canis lupus familiaris} MPRGQKSKLRAREKRRQARSEAQDLERAQATAPAAGESFSTACALSGGHPENFPAAATASSPQAPKGASGSTSASVAVSCTDSDEGAKSEDEGSPNSSSGTEVSRRDPLN
KKVVLLVQFLLQKYQNKEPITKADMLKLVIKKYRCHFNEILKRASEHMELAFGVDLKEVDPIRHCYALVSKLDLTFDGTMREEENMPKTGLLMIVLGVIFMKDNCAAEEE
VWEVLNMMGVYANRKHFIYGDPRKVITEDLVQLRYLEYRQAPDSFPPRYEFLWGPRAHAETSKMRVLEFLAKVHDTVPTAFPAWYEEALKDEEERAQTRAAARAQTAALV
RARARALAGGVSHTK*
68 >lcl|XP_548914.1|Plus122883408..22884451 NW_879562 melanoma-associated antigen B10-like LOC491795 __SEG__ ChrX {Canis lupus familiaris} MPRGQKSKLRAREKRHQARSEAQGAPDAQVTAAAEEQPSAAPFPPLGGNAQSSSAAGSGRKSQGSRRAPSTTATSVGVSHTRADEGARSQDEERPSTSQAQPSTDHYRKT
PLDDKAILLVQFLLRKYNMREAITKEDMMKYVIKKHKEHFHEILRKASELMVLAFGIDLKEIDPTRHYYALVSKFQHTCDDRLRGEEIMPRTGLLMTILCVIFMKGNRAT
EEDIWEVLNVMGIYADRKHFIYGDPKKLITQDLVQERYLQYQQVANSDPPRYEFLWGRRAHAETSKMKVLEFLAKIHNTVPSAFPSWYEEALRDEEERARARFAARLRMG
ALASVHSRAHFGSFSHL*
69 >lcl|XP_548921.1|Plus125175027..25176061 NW_879562 melanoma-associated antigen B4 MAGEB1 __SEG__ ChrX {Canis lupus familiaris} MPRGQKSKLRAREKRRRNRDETQGLQSAQATTAEEEETTPSTSSVLGNVPPSSPVASTSQEPQEAPTTTRAVAGGSRRRSNAGAKSQVEGGKHSSQASTSTASAPKDPLT
GKVGLLVQFMLYKYKLKEPIKKAEMLKIINKRYREHFPEIFKRTSERMELVFGLELKEIKPGGHSYTLMSTLNLTSDSDVSNGWGFPKNGLLMPLLGVIFLNGNCTSEEG
IWEFLNILGIYDGKRHFIFGEPRKLITQDLVQEKYLEYRQVSGSDPPRYEFLWGPRAHAETSKMKVLEFLAKVHDTVPSVFLPHYEEALRDEEERAQARATAKAASATKA
SAHSRATSSHSTPP*
70 >lcl|XP_549024.1|Plus146953627..46954286 NW_879562 melanoma-associated antigen H1 MAGEH1 __SEG__ ChrX {Canis lupus familiaris} MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMASSLSPSSPEDDLSGPEEEPRTPEEASITPEEASSTAQAQKPPVARSNFQGTKKSLLMSILALIFIMGNSAKEAL
VWKVLGKLGMQPGRQHSIFGDPKKVVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSEDDAEVEAILNSGARGYIAP*
71 >lcl|XP_549103.2|Plus113242881..13244053 NW_879563 protein FAM46D-like LOC491983 __SEG__ ChrX {Canis lupus familiaris} MSEIRFSNLIWDQLITLDQVLDEVIPIHGRGNFPTLEVKPKDIIQVVKEQLIEQGIIVKDTRLNGSTASYILASHNGISYKDLDVIFGVELPSDQEFQVVKDAVLGCLLD
FLPKGVKKEKITLKTMREAYVQKMVKVCNKHDRWSLISLSNNTGKNVELKFVNSLRRQFEFSVDSFQIVLDPMLEFYSDKNAKLTKESYPVVVAESMYGDFREAMTHLQF
KLISTRKPEEIRGGGLLKYSNLLVRDFKPACEAEIKTLERYMCSRFFIDFPDVAEQQMKIESYLRNHFIGEEKSKYDYLMTLRGVVNESTVCLMGHERRQTLNMITLMAL
KVLGEQNILPNTDNVTCFYQPAPYFAAEGGHPTYYVTSGPPPIFFQPYHPLHFHVPNGMV*
72 >lcl|XP_549208.2|Plus140569200..40570060 NW_879563 uncharacterized protein C22orf13 homolog LOC492086 __SEG__ ChrX {Canis lupus familiaris} MNAVFSLPRWRRRLWLWLWRRRRNPPRTSLAPAPLGAEAAAGRGPWGLRTEVEAAGPPLEPGDFVQLPVPIIQQLSHWDCGLACSKMVLRYLGQVDDNEFESALRELQLT
RNIWTIDLAYLMRHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCTVSVQDIQEHLAQGHVAIVLVNSGVLHCDLCSSPVKYSCFAPSG
HRCFCGTPDYQGHFIVLCGYSRATGCIFYNNPAYADRMCSTSISNFEGARTSYGTDEDILLVYLDS*
73 >lcl|XP_549293.1|Plus159959941..59960984 NW_879563 putative MAGE domain-containing protein MAGEA13P MAGEA11 __SEG__ ChrX {Canis lupus familiaris} MPHSKKSQCCKLEASHEAQRRAQNPVDAQVPVTEKETITSSLSPLIQGTPKVVPAAGKPSVCQSSQGVCSSPSTIKGAPLSKPNEGSSSHKEGPSTSQAPPDPDSLLSEV
LNQKVAELVQFLSVKYVTKKPTMAAEMLQSVIREHKGHFPVIFKKACECMEVVFGIEVKEVDPVNHSYELVKILNLTYDGMLSNEQGMPKTGLLILILGVIFMEGNCAPE
EKIWDMLNKIGVFAGKKDFIYGEPRKLITKDLVQEKYLEYRQVPNSDLPRYEFLWGPRAHAETSKMQVLQFLAKVSGTAPTSFSSWYEEAMRDERARAEARVAATDDTTA
MARESSSVPSGSFSCPK*
74 >lcl|XP_549301.1|Plus1complement(63057060..63058145) NW_879563 melanoma-associated antigen 10-like LOC492181 __SEG__ ChrX {Canis lupus familiaris} MPCSSKHLHLTFEPDIQAQSEIQDLEVSHVLIAEVKEETSSMSFCSFNFSYPSTASSLCSSPVIPVSLEEEKEEKPAATLSPLQSPQSSCSLSTSWSTSEGVSDSSGEED
TSSLKTSIDIASLPRDPLNEKVADLVHFMILKHQLKEPITKVEVLKVVIKRYKKQFPVIFKKASKFLEVISGIDAKEVDPTTHFYVLVNSLELTHEEMLSNNQSMPKNGL
LIIILGVIFMEDNCALEEDIWYFLNVMGVYAGREHFLYGEPRKLITRDWVQENYLEYRQTPNRDPPCYEFLWGPRAHADTSKMKVLEFLAKVKGTNSTSVSCWYEGALRD
EEVRAQTRIGSMDNTTACSLHRIIPQILRPD*
75 >lcl|XP_549315.3|Plus1<69012164..69013018 NW_879563 melanoma-associated antigen 10-like LOC492195 __SEG__ ChrX {Canis lupus familiaris} SSSSSSSSSSSSSSSSSSSSASFSISGMVFGPPEGGSTAPGALSASQSSQNASPSPSGGAAGGLGQSEPPGPSGPGEAGDEEPLVEGSFHMKTAALVVFLLLKYRNKQPT
SKAEMLEVFSPEYQDDFPAILSQASICLRLVFGLDVIEVDPREHSYVLNPILGLTWDGMLSGQWGLPKTCLLGLVLGLILLQDGCVPEEEVWEALGFTAVYDDQEHIVCG
EPGDHLTNVWVQEGYLERRQVAGSDPARNEFLWGPRAYEETNRLQVMDFLLLVGSNNLGSSLVL*
76 >lcl|XP_549339.3|Plus171260461..71261549 NW_879563 melanoma-associated antigen 4-like LOC492219 __SEG__ ChrX {Canis lupus familiaris} MSVGKSSEPWRLGEDPEEAQGVVDALQTRAEEEEEEPGEVLSPRTPPSLFSSSPYFSLSGGCSGAQEEESANEGSLSPLQCSQGANTSQGGREASAQFAGPNSPEEVGSS
GSEGEEDADSSPCGGASHGLGQPQPAVPSSPAEVGSNPPEQQEDEQPQGSFHLKTAALVIFLLLKYRTKQPTSKAEMLEIITPEFQDNFPVILRQASICLRLVFGLDVIE
VDPSEHYYNLSIILGLTWNGTLSSQGGLPKTSLLVLVLGLIVLADDCAPEEEVWEAMGIMGVYDGQDHILFGAPRDLLTNVWVQEGYLECRQVAGSNPARKEFLWGPRAL
QETSKLQVMDYVLQLGNNNLTYSLALCEQILR*
77 >lcl|XP_549341.3|Plus1complement(71407456..71408541) NW_879563 melanoma-associated antigen 10-like LOC492221 __SEG__ ChrX {Canis lupus familiaris} MSLGKSNELWELGEDPDKAQGLLDALQSRAEEEGQVPSPWSLPSLSSSSPSFSFYGLLGPPEEGSTTEGSPSPLQSSQSAITSPYDGAARGLGQPQPAGPYSPGEVGSSG
SEGQEDADPYPCGWASISLGQPQPAGPNGPGMVGSNPPEEQEDEQPQGTFHVKTAALVMFLLLKYRTKQPTSKAEMLEVITPAFQDDFLIILSEASICLRLVLGLDVTEV
DPREDSYDLNIVLGLTWDGTLSGQGDLPKTSLLVLVLGLIVLEDDCAPEEEVWETLGVMGVYDGQEHIVYGEPRDLLTNVWVQEGYLECRPVAGSDPVRYEFLWGPRAYE
ETSKLQVMDYVFQVSSSLVVSSLALCEQILR*
78 >lcl|XP_848908.1|Plus113208374..13208970 NW_876265 apolipoprotein O-like LOC607469 __SEG__ Chr18 {Canis lupus familiaris} MFKVIRRSVGPASLSLLTFKVYASPKRDSPHKTSVKVNELSLYSVPEGQSKYVEEPRTQLEESISHLRHYCEPYTSWCQEMYLQTKPKMQSLVQWGLDSYEYLQNAPPGF
FPRLGVIGFAGIVGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFVQVSGEKLYDWGLRGYIVVEDLWKENFQKPGNVKNSPGNK*
79 >lcl|XP_849439.1|Plus1complement(6058535..6058747) NW_876278 26S proteasome complex subunit DSS1-like LOC607599 __SEG__ Chr25 {Canis lupus familiaris} MSEKKQPVDLGLLEEDDEFEEFPGEDWAGLDEDEDAHVWEDNWDDDNEEDDFSNQLRAELEKHGYMMETS*
80 >lcl|XP_850131.1|Plus1complement(2966779..2967834) NW_876313 uncharacterized protein C17orf59 homolog LOC608122 __SEG__ Chr5 {Canis lupus familiaris} MESSRGRPGPEADLPAPGEQQAALWGGGPGRAPSEPPSGLPPSAQGEAENVGGARRHPAASPKTPSRGAVHRAEREARDDDESGRRGTPSAPGSRAGEACEDPEPPEAEP
ASERGCRRGSAGGGGMEAEPREGDEEEEEAAAAGRAGRSFSSRLQDSRSLDGLSGACGGGGGGGAGSAGGAEPGAGSGRRATISSPLELEGTVSRHGDLTHFVANNLQLK
IRLSGTPQPPPPAPARPCAAPAPAPAIPPIDPDVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQ
GLARKSGDIERTLRVLEALCK*
81 >lcl|XP_850446.2|Plus124116..24544 NW_876318 inactive Ufm1-specific protease 1-like UFSP1 __SEG__ Chr6 {Canis lupus familiaris} MGDKSPGFRGSQSWIGCVEASLCLDYFGGPQGRLCHIPRGAGLQGELEKLYSHFAGGGGPVMVGGDADAQSKALLGVCLGPGTEAYVLVLDPHFWGDPKNPSELQAGGWV
GWREVGTAFDPNSFYNLCLTSRNSQHQQDALD*
82 >lcl|XP_851111.1|Plus119907530..19907868 NW_876251 protein FAM32A-like isoform 1 LOC609217 __SEG__ Chr10 {Canis lupus familiaris} MAAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEVMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSW
TK*
83 >lcl|XP_851974.2|Plus123492331..23493260 NW_876270 presqualene diphosphate phosphatase PPAPDC2 __SEG__ Chr1 {Canis lupus familiaris} MPSPLRNADARPLAAAASSSSSSSPGSPGSPARGGGGGGGGGGGGGGGGGRFEFQSLLGSRAPGADPACARLRAPESPVHRRGSFPLAGAGPSQAPAAALPEEGRMDLNP
SFLGIALRSLLAIDLWLSKKLGVCAGERSSWGSARPLMKLLEISGHGIPWLLGTLYCLLRSDSWAGREVLTNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVD
KYSFPSGHATRAALVSRFILNHLVLAIPLRVLVVLWAFIVGFSRVMLGRHNVTDVAFGFFLGYAQYSIVDYCWLSPHNARVLFLLWNQQ*
84 >lcl|XP_852206.1|Plus1complement(17604506..17606023) NW_876284 tRNA-splicing ligase RtcB homolog LOC609076 __SEG__ Chr27 {Canis lupus familiaris} MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALGKLMFEELRNAGRGGGVGGFLPAMKQTGNMAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAV
VSPGGVGFDINCGVRLLRTNLDESGVQPVKEQLAQTMFDHIPVGVGSKGVIPMSAKDLEEALEMGVNWSLREGYTWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLG
TLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNNRQLACARIASPGGQDYLKGMAAAGNYAWVNRSSMTFLTRQ
ALAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQLMLTGGTTGTCSYVLTGTKQGMTETFGTTCHGAGCALSRAKSH
HNLDFQDVLDKLADMGIAVRVASPKLVMEEAPESYKNVTDVMNTCHDAGISKKAIKLRPTAVIKG*
85 >lcl|XP_852531.1|Plus116858949..16861354 NW_876254 pre-rRNA-processing protein TSR1 homolog LOC610048 __SEG__ Chr12 {Canis lupus familiaris} MAAHRSGPLKQQNKAHKGGRHRGRGSAQRDGKGLKILSKKVRKELSKVDQRHRASQLRKQKKEAVLAEKRQLGSKDGPPHQVLVVPLHDKISLPEAFRLLQDTDTGTVHL
NECGSTHSFMLLCPRLKHRWFFTSARPGDLHTVLDMAKVADTILFLLDPLEGWDSIGDYCLSCLFAQGLPTYTLAVQGISGLPPRKQIDARKKLSKTVEKRFPSDKLLLL
DTQQEAEMLLRQLANQKQRHLAFRDRRAYLFAHAADFVPSEENNLVGTLKISGYVRGQTLNVNSLLHIIGQGDFQMKQIDAPMDPFPLNFRMIKSQKEDPGVTMEICAMD
AVADMEEDLKVVMKADPDKQESLQTEVNLDPMEGEQTWPTEEELSEANDFLKESSKVVKKVPKGTSSYQAEWILDEDGESDGEDEYDDMQREDFIEEESQDEGSEKEEEE
EYETMTMGESVHDDLYDENVDDEAEEKMLEKYKQERLQEMFPDEIDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKRIFKEIEEKEVEGAE
VGWYVTLHVSEVPLSVVEYFKRGAPLIAFSLLPHEQKMSVLNMVVSRHPGNIEPVKAKEDLIFHCGFRRFRASPLFSQHTAADKHKFQRFLTADVALVVTIYGPITFPPA
SVLLFKQNSNGMHSLIATGYLLSVDPDRMVIKRIVLSGHPFKIFTKMAVVRYMFFSREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRV
FPKWTYDPYVPDPVPWMKSEISLAVPEVDME*
86 >lcl|XP_852740.2|Plus1complement(21298630..21300624) NW_876303 tetratricopeptide repeat protein 30B-like LOC610209 __SEG__ Chr36 {Canis lupus familiaris} MAGLGGAHVPDGEFTAVVYRLLRDARYAEAVQLLGAELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YRGRVLRLQAAIKYSEGDLPGAKSLVEQLLSAEGGDDSGGDGEPDGQVNLGCLLYKEGQYEAACSKFFAALQASGYRPDLSYNLALAYYSRRQYAPALKYIADIIERGIR
QHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRSEEELDPVTLHNQALMNMDTRPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFDLAADVLAENAHLTYRLLTPYLYDFLDAMITCQTAPEEAFVKLDGLAGMLTEQLRRLTIQVQEARHNRDDEAVKKAVNEYDDTLEKYIPVLMAQAKIYWNLENY
PMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEEEEQLSYDDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEQCELYGRNIPAVIEQPLEEERMHTGKNTVTYESRQLKALIYEII
GWNI*
87 >lcl|XP_852753.2|Plus1complement(21355722..21357719) NW_876303 tetratricopeptide repeat protein 30A-like LOC478814 __SEG__ Chr36 {Canis lupus familiaris} MAGLGGAHVPDGEFTAVVYRLLRDARYAEAVQLLGAELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPA
YRGRVLRLQAAIKYSEGDLPGAKSLVEQLLSAEGGDDSGGDGEPDGQVNLGCLLYKEGQYEAACSKFFAALQASGYRPDLSYNLALAYYSRRQYASALKHIADIIEHGIR
RHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRSEEELDPVTLHNQALMNMDTRPTEGFEKLQFLLQQNPFPPETFGNLLLLY
CKYEYFDLAADVLAENAHLTYRLLTPYLYDFLDAMITCQTAPEEAFVKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAVKKAVNEYDDTLEKYIPVLMAQAKIYWNLENY
PMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEKQLSYNDPDKKIYHLCIVNLVI
GTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHMIVLCDGVIQECVQFLEQCELYGRNIPAVIEQPLEEERMHPGKNTVTYESRQLKALIYEI
IGWNM*
88 >lcl|XP_853323.1|Plus113939938..13940750 NW_876260 2-aminoethanethiol dioxygenase-like LOC610687 __SEG__ Chr16 {Canis lupus familiaris} MPRDNMASLIQRIARQACLTFRGGGGGRSAPDLGSASGPEAPMPQGFPENLSKLKNLLTQVRAEDLNIAPRKATLQPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIP
LHDHPGMHGMLKVLYGTVRISCMDKLEAGGGQQPRPLPPEQQFEPPLQARERDAVRPGVLRSRAEYTEASGPCVLTPHQDNLHQIDAVDGPAAFLDILAPPYDPDDGRDC
HYYRVLEPVRDKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP*
89 >lcl|XP_853471.1|Plus1complement(32071774..32073702) NW_876258 mini-chromosome maintenance complex-binding protein-like LOC612966 __SEG__ Chr14 {Canis lupus familiaris} MPCGEDWLSHPLGIVQGFFAQNGVNPDWEKKVIEYFKEKLKENNAPKWVPSLNEVPLHYLKPNSFVKFRCMIQDMFDPEFYMGVYETVNRNTKARVLHFGKYRDVAECGP
QQEVDLNSPRTTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDEDMDLQPNKQKDQHAGARQAGTVGGLQWCGEPKRLETEASTGQQLNFLN
LSSPFDLNFPLPGEKGPACLVKVYEDWDCFKVNDVLELYGVLSVDPVLSILNNDERDASSLLDPMECTDTAEEQRVHSPPASLVPRIHVVLAQKLQHINPLLPACLNKEE
SKTCKFVSGFMSELSPIRAELLGFLTHALLGDSLAAEYLILHLISTVYTRRDVLPLGKFTVNLSGCPRNSTFTEHLYRIIQHLVPASFRLQMTIENMNHLKFIPHKDYTA
NRLVSGLLQLPNNTSLVIDETLLEQGQLDTPGVHNVTALSNLITWQKVDYDFSYHQMEFPCNINVFITSEGRSLLPADCQIHLEPQLIPPNMEEYTDSLLSAVLPSVLNK
FRIYLTLLRFLDYSISDEITKAVEDDFVEMRKNDPQSITADDLHQLLIVARFLSLSAGQTTLSRERWLRAKQLESLRRTRLQQQKCVNGNEL*
90 >lcl|XP_853943.1|Plus1complement(9421731..9423239) NW_876331 nuclear-interacting partner of ALK-like LOC611213 __SEG__ Chr9 {Canis lupus familiaris} MAAPSEGQAFASGVEKTWGAVVRSPEGTPQKVRQLIDEGIAPEEGGAEAKDTSATFQSVNGSPQAEQPPLESTSKEAFFSRVETFSSLKWAGKPAELSPLVCAKYGWVTV
ECDMLKCSSCQAFLCASLQPAFDFDRYKDRCAELKKALCTAHGKFCFWPDSPSPDRFGMLPLGEPAVLVSEFLDRFQSLCHLDLQLPSLRPEDLKTMCLTEDKISLLLHL
LEDELDCRTEERKTTSKLGSDIQVHVTACVLSVCGWACSSSLEPMQLSLITCSQCMRKVGLWGFQQIESSMTDLDASFGLTSSPIPGPEGRPERFPLVPESPRRMMTRSQ
DATCSPGSEQAERSPGPIVSRTRSWDSSSPVDRPEPEAASPTTRSRPVTRSMGTGDSSGLEVPSSPLRRAKRARLCSSSSSDTSSRSCFDPTSQHRDWCPWVNVTLGKET
REHGGTETDASISTEPGWKAVLNILLAHKQSNQPAETDSMSLSEKSRKVFRIFRQWESLCSS*
91 >lcl|XP_854362.2|Plus1complement(37985523..37986122) NW_876294 ribonuclease P protein subunit p25 RPP25 __SEG__ Chr30 {Canis lupus familiaris} MENFRKVRSEEAPGGEGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLLAFATASMAQPATRAIVFSGCGRASTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLP
PGPAPGHRPGEPAASLSVLKNVPGLAILLCKDALDPRQPGYQPPDAHPGPSSQPAAPTSKRGPGGAAAAEGSAKRLRPEPGTAEERPMA*
92 >lcl|XP_854535.1|Plus1complement(35601195..35601455) NW_876269 splicing factor 3B subunit 5 SF3B5 __SEG__ Chr1 {Canis lupus familiaris} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*
93 >lcl|XP_854765.2|Plus121507658..21508719 NW_879562 melanoma-associated antigen B3-like LOC491787 __SEG__ ChrX {Canis lupus familiaris} MPRSQKSKLQASEKRRQAQAEAQAGENAQATAAVEKESTPSFPPQYEDTAQILPPVRASSTSQWYRRAQATTFTSVGASWARSDAEYNNQDYDRANAYEAAYYTENVGED
SLTRKPGLLEQFLLYKYKMKQPILKEDMLKIIGHHYEDQFPEILKKASERIEIVFAVDLKEIDSTRQSYDLISKLKLPNNGRVRAGRGLPKTGLLMNILGMIFMKGNCAA
EEDIWKFLGMMQVYAGRKHFIYGEPRKLITKDLVRLQYLEYRQVSNSDPPRYELLWGPKAQAETSKMQVLEFLAKVNDTIPSAFPSYYEEALRDEEARASAIAKVIASSR
AMPWNIFPPLVKPEFCYYLDKKI*
94 >lcl|XP_854805.1|Plus136844959..36845882 NW_876292 transmembrane protein 200B-like TMEM200B __SEG__ Chr2 {Canis lupus familiaris} MTAGSPGDRGEVRRSPEGRVSRLGRRLGRRRRPRSPPEPLRVRARLRLRSPSGAFAALGALVVLVGMGIAVAGYWPHRAGAPGPRAANASAPPPSELRREGRGAGRAHGP
HERLRLLGPVVMGVGLFVFICANTLLYENRDLETRRLRQGVLRAQALRPPDGPGWDCALLPSPGPRTPRAIGCTEPESWDLSPRRGTSPVPSVRSLRSEPANPRLGLPAL
LNRYPLKGPGLPPPWGPRTQTGHVIITVQPSGSCIEHSKSLDLGLGELLLGAPAARDCAHRSWPRLDRLSLGGYAKLGGGGDLGARV*
95 >lcl|XP_855538.1|Plus168904323..68905798 NW_876269 transmembrane protein 200A TMEM200A __SEG__ Chr1 {Canis lupus familiaris} MIATGGVITGLAALKRQDSARSQHHVSLSPAPAAQDKKPARRRPQADVVVVRGKIRLYSPSGFFLILGVLISIVGIAMAVLGYWPQKEHFIDAETTLSTNETQVIRNQGG
VVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMRDIYSTVIDIHTLRVKEQKHMNGLYTGAMGDSEVKQNGSSCTSRLAANTIASFSGFRSSF
RMDSSVEEDELALNENKSLGHLMPPLLSDSSVSVFGLYPPASKMTEDKTGGPKKCGTKSIVSSSISAFTLPVIKLNNCVIDEPSIDHITEAADNLKSRARNLSMDSLVLP
PPNAGEPFQPVGTAFPRNHSVGESLSSQYKSSVALGPGAGQFLSPGAARRQFGSNTSLHLLSSHSKSLDLDRGPSTLTVQAEQRKHPSWPRLDRSNSKGYMRLENKEDPM
ERLLVPQATIKKDFTNKEKLLMISRSHNNLSFEHDEFLSNNLKRGTSETRF*
96 >lcl|XP_866170.1|Plus1complement(26079271..26079879) NW_876266 coiled-coil domain-containing protein 85B isoform 2 CCDC85B __SEG__ Chr18 {Canis lupus familiaris} MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAGGSSSGPTPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*