SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau S    

ID / Description / Sequence
1 >lcl|NP_001011682.1|Plus12175871..2177613 NW_001494083 glycosyltransferase ago61 precursor C3orf39 __SEG__ Chr22 {Bos taurus} MHLSAVLNALLVSVLAAVLWKHVRLREHAASLEEELAVGRRAADPAPALRIDYPKALQILTEGGTHMVCTGRTHTDRLCRFKWLCYSSEAEEFIFFHGNASVMLPSLGSR
RFQPALLDLSTVEDHNTQYFNFVELPAAALRFMPKPVFVPDVALIANRFNPDNLMHVFHDDLLPLFYTLRQFPGLAREARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQL
KALGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFAHFLMEKLNVSQAGGPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHAFAD
VVRLVSNASMLVSMHGAQLVTALFLPRGAAVVELFPYAVNPDHYTPYKTLATLPGMDLQYIAWQNTMPENTVTHPERPWDQGGIAHLDRAEQARILQSREVPRHLCCRNP
EWLFRIYQDTKVDIPSLIQTIRRVVKGHPGPRKQKWTVSLYPGKVREARCQASVQGASEARLSVSWQIPWNLKYLKVREVKYEVWLQEQGENTYVPYMLALQNHTFTENI
KPFTTYLVWIRCIFNKTLLGPFADVLVCST*
2 >lcl|NP_001019744.1|Plus1complement(449213..450082) NW_001495439 presqualene diphosphate phosphatase PPAPDC2 __SEG__ Chr8 {Bos taurus} MQSPRRNAEGRPLGTCDPSSSGSPAHGGGSRFEFQSLLSSRMPGADPTSARLRASESPVHRRGSFPLAGAGSSQALPPQLPEEDRIDLNPSFLGIALRSLLAIDLWLSKK
LGVCAGESSSWGSMRPLMKLLEISGHGIPWLLGTLYCLSRSDSWAGREVLMNLLFALLLDLLLVSLIKGLVRRRRPAHNQMDMFFTISVDKYSFPSGHTTRAALVSRFIL
NHLVLAIPLRVLVVLWAFILGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWLSPRTAPVLFVLWNQP*
3 >lcl|NP_001020521.1|Plus1complement(4214216..4214476) NW_001495600 splicing factor 3B subunit 5 SF3B5 __SEG__ Chr9 {Bos taurus} MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN*
4 >lcl|NP_001029691.1|Plus1complement(874541..875080) NW_001493651 Bcl-2 inhibitor of transcription precursor PTRH2 __SEG__ Chr19 {Bos taurus} MISRSLVMEYLTNPGALSLAAGVACGVCLGWGLRMRFGMLPKSSVRETNPDTETEASILGESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPELLKEWEY
CGQPKVVVKAPDEETLVELLTHAKVLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPADLIDKVTGHLKLY*
5 >lcl|NP_001035650.1|Plus1complement(219936..221135) NW_001494538 zinc finger HIT domain-containing protein 2 ZNHIT2 __SEG__ Chr29 {Bos taurus} MEPAGPCGFCPTGEAQPARYTCPRCNVPYCSLRCYRAHGSCAEEFYRDQVLGELRGRSASPSRLATALRRLRQQRETEDEPGDAGLRPGPAPGGLSGLWERLAPAEKVAF
ERLLSRGEAGRLLPPWRPWWWGRGAGPRLLEELGDAPSGDAEELEPSPARMPPEPVRDEPAAVEQVLGDLPGACPPAVPTRIPALASLSRGRTSPLVRFQLPNVLFAYAH
TLALYHGGDEALLSDFCATLLGVSGALGAQQVFASAEEALQAAAHVLEAGEHPPGPLGTRGAMREAARILLGEGPANQKSYTLAALGDLAQTLGRARKQAVAPEERDRLY
RARKKCQFLLSWTNENEDALTPLALDCATAHRAHTVAAEDVAALTGELEQLWGGPLPPARRTLIEELPG*
6 >lcl|NP_001035655.1|Plus1complement(686280..686936) NW_001493666 hypothetical protein LOC539395 C19H17orf59 __SEG__ Chr19 {Bos taurus} MDVEQKEDDNEAAEAGRGGRSFSSRLQDSRSLDGLSGACGGPASSGGAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPQPPPPAPTRPCSAPTP
TPAIPPIDPDVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEVLEALCK*
7 >lcl|NP_001039576.1|Plus1complement(2061216..2061707) NW_001495473 alba-like protein C9orf23 homolog C8H9orf23 __SEG__ Chr8 {Bos taurus} MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRAGSKIRNLLGLALERLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLYQLTKLRFLQTEDSWVPTSPDTGLDPLTV
RSHVPAVWVLLSRDPLDPNEYGYQPPGAPPDLGPTPASSCGPQPRRRARDTRF*
8 >lcl|NP_001039788.1|Plus11010211..1011473 NW_001493856 mitochondrial ribonuclease P protein 1 RG9MTD1 __SEG__ Chr1 {Bos taurus} MSVSITFLRPFARVLVPFTLHRKRRVLYSTIMQRYMSSKIPAASYPNKESTPPSEELELDRWKITMKSSVQEEDVSTATSSEDEDPLAATRELVEMWRLLGKEVPEHFSE
EELKTLMECVSKSSKRKYLKYLYIKEKMKKARQIKKEMKKAEKEEPKKDQLPETIKEDKQQNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDMAYDDHMKPKELQNAV
SQLLESEGCNRRNVDPFHIYFCNLKTGGAYYKELVKRYGEKWNKLLLTATEKSHVDLFPKDSIIYLTADSPNVMTTFKHDKIYIVGSFVDKNMQPGTSLAKAKRLKLATE
CLPLDKYLQWDTGTKNLTLDQMMRILLCLKNTGSWEEALKFVPSRKHAGYLEISQHSQEFLNRMKKSKTFNSFPRGSINRHRKSSLKENI*
9 >lcl|NP_001068680.1|Plus1complement(589763..590554) NW_001494322 metallo-beta-lactamase domain containing 1 MBLAC1 __SEG__ Chr25 {Bos taurus} MSGLVRTEPLPGETPLLVPGDPYSVVVLLQGYAEPEGVGDAVRADGSVTLVLPQAWGPASSHREPQPYEAKTALEEAARGPILVDTAGPWAREALLGALAGQGVAPGDVT
LVVGTHGHSDHIGNLGLFPGAALLVSHDFCLPGGRYLPHGLGEERPLRLGPGLEVWATPGHGGQRDVSVLVAGTALGTVMVVGDVFERDGDEGSWQALSEDPVAQKHSRK
RVLGTADVVVPGHGAPFRVIREASAPETEPARSRDGEEPTVHG*
10 >lcl|NP_001069608.1|Plus12009948..2011213 NW_001494921 hypothetical protein LOC538970 C4H7orf25 __SEG__ Chr4 {Bos taurus} MSAHSMLCERIAIAKELIKRAESLSRSRKGGIEGGAKLCSKLKAELKFLQKVEAGKVAIKESHLQSTNLTHLRAIVESAENLEEVVSVLHVFGYTDTFGEKQTLVVDVVA
NGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASHQQPVQYSNPHIIFAFYNSVSSPMAEKLKEMGISVRGDIVAVNSLLDHPEELQPSESESDDEGPELL
QVTRVDRENILASVAFPTEIKVDVCKRVNLDITTLITYVSALSYGGCHFIFKEKVLTEQAEQERKEQVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERAAML
IKRINVVPDQPSERALKLVASSKINSRSLTIFGTGDNLKAITMTANSGFVRAANNQGVKFSVFIHQPRALTESKEALATPLPKDCTTDSEH*
11 >lcl|NP_001070456.1|Plus1486676..487077 NW_001494886 transmembrane protein 60 TMEM60 __SEG__ Chr4 {Bos taurus} MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVF
IPLWALLAGALIELGYNVFFVRD*
12 >lcl|NP_001070548.1|Plus11847927..1848229 NW_001493648 hypothetical protein LOC768021 MGC137055 __SEG__ Chr19 {Bos taurus} MADFLKGLPVDDKSNFSSFHANCLSKASNRRLPVYLPTQEYPSEQIIVTEKTNILLRYLQQQRDKKNAAEKTDQEQVNLEAESWASPCKIPGIYSQDWDD*
13 >lcl|NP_001070577.1|Plus13175114..3176625 NW_001493651 phosphatidylinositol glycan, class W PIGW __SEG__ Chr19 {Bos taurus} MSQKQMKEAFVSNQNGTSVLEITEGLCLPALCILCRGLLIILSQQLCSSLHNSRTRFLVDFAFLIVPLVTTLTIFSSFVLLEYLVAIILGAGLLYEIYCRRTCYARMPFQ
KICEKFLKVSLESEHIPAISCFRVVNSAFTAVAILAVDFPLFPRRYAKTELYGTGAMDYGVGGFIFGSAMVSPEVRRKYTKGSRFCYLTKSLYSLWPLVFLGVGRLVAIK
SVDYQEHLTEYGVHWNFFFTLIAVKLITSLLLIICPLNRSWVVAISIAALYQLALDFTPLKSLILYGTDGSGTRVGLLNANREGIISILGYVAVHMAGVQTGLYVLKKRS
HIKDWIKVACCILLTAIGLFISLYIVQVNVEVASRRMANLAFCIWIVASCLILLSSLLLGDIILSFAKFVIKEAAVPCSWKLIQSPTANKKHLESIVFDAKRKEPTLCLI
TAMNRNQLLFFLLSNVTTGLVNLSIDTLHSSTPWALCLLNLYMFTNCLIIYVLHLQDKTIKFW*
14 >lcl|NP_001071503.1|Plus12813831..2814163 NW_001493662 transmembrane protein 93 TMEM93 __SEG__ Chr19 {Bos taurus} MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASILLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
*
15 >lcl|NP_001071548.1|Plus1complement(997546..998403) NW_001494001 necdin-like 2 NDNL2 __SEG__ Chr21 {Bos taurus} MSQKPKSRGRPSSQVEREPGGGGEEAPSTSRGPGGAASQRRAQASPAPGPRSQKQLELKVAELVQFLLIKDQRKIPIRRTDILRHVVGDYKDVLPELLRRAAERLEYVFG
YRLVELEPRSNTYILVNTLEPVEEDAEVRGDQGTPTTGLLMIVLGLIFMKGNSIKETEVWDFLRRLGVHPTKKHLIFGDPKKLITEDFVRQRYLDYRRIPHTDPVDYELQ
WGPRTNLETSKMKVLKFVAKIHHQDPKDWPAQYCEALADEEARARPQPAGPSPATAPAPTLSPVS*
16 >lcl|NP_001073052.1|Plus11174540..1174674 NW_001494794 phosphotyrosine interaction domain containing 1 PID1 __SEG__ Chr3 {Bos taurus} MLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTQSGCK
17 >lcl|NP_001073069.1|Plus1complement(1811434..1811943) NW_001493164 gametocyte-specific factor 1-like GTSF1L __SEG__ Chr13 {Bos taurus} MEPEALETCPYNPHHRIPLSRFQYHLASCRRKNPKKAKKMASCKYNACHVVPIKKLEEHEAACVNKSTMEEEDSLSPLKVSLPNAGQKGNRNASPVSPRLPNPDLWNVDS
TNCHPMFVLKSFIPQKLVCESDTRESETDDHNPIPDCPRRRSSDRESEPPAEDTSLLKA*
18 >lcl|NP_001074197.1|Plus1759779..760438 NW_001508803 melanoma antigen family H, 1 MAGEH1 __SEG__ ChrX {Bos taurus} MPRGRKSRRRRNARAAEENRNSRKIQASETSETPMAASVGSSTPEEDLNCPEEDPSTPEETSTTPEESLSTAQAQKPSVARSNFQGTKKSLLMSILALIFIMGNSAKEAL
VWKVLGKLGMQPGQQHSIFGDPKKVVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFVARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGYSAP*
19 >lcl|NP_001074201.1|Plus152826..53806 NW_001508701 melanoma antigen family A, 11 MAGEA11 __SEG__ ChrX {Bos taurus} MPHSQKSQSHKLQVGLQAEKEAQGLVGSQVPVAEEKATASLLSSLIQGTPEVVPTAGAQSVPQSSQGACSSSTTIEAIPLSKSNEGSSQEESPSSFQAPMFLLSDVLNKK
LAQLVQLMRVKYVTKEPVTKAEILENVMKEHEDHFPVIFSKACECMEIVFGIEAKEVDPTSHSYVLQKTLGLTYDGMLNDGQSMPKTGLLIYILGVIFMEGNRATEERIW
KVLNMIGVCAGQKDFIYGEPKKLITKDLVEEKYLEYHQVPNSDPPCYEFQWGPRAHAETSKMKILKFFSKVNGVDPTSFPYWYEEALRDEKERAAAGDATSAMASV*
20 >lcl|NP_001075077.1|Plus1complement(366414..367526) NW_001501737 defects in morphology protein 1 homolog DEM1 __SEG__ Chr3 {Bos taurus} MAETEEEETVSEEASGFSDLSDSELLDLEDTQESSASASKPGPSYELPGKDDKLIRSPKWKRRLDVSSPMERFHLKYLYVTDLSTQNWCEQQMVYGKEFSGFLTPEKSAI
LDTGASIHLARELEVHDLVSIPITSKEDAWAVKFLNILSMIPTLQSEGRIREFPVFAEVEGVLLVGVIDELHYTASGELELTELKTRGNPVLPSDAQKKKDYFQVSLYKY
IFDAMVQGKVTAASLIHHTKLDPEKPLGPSVLRHAQQGGYSVKSLGDLIELVFLSLTLSDLPLIDSLKIEYVHQGTATVLGTEMVAFAEKEVRSKVQHYMTYWMGHREPQ
GVDVEEAWKCRMCNYADICEWKKSGGLISATLEPQVKKAK*
21 >lcl|NP_001075185.1|Plus11449937..1451931 NW_001494580 tetratricopeptide repeat protein 30A TTC30A __SEG__ Chr2 {Bos taurus} MAGLGGEPIPDGEFTAVVYRLIRDARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLRQLHPELEQYRLYQAQALYKACLYPEATRVSFLLLDNPT
YHNRVLRLQAAIKYSEGDLPGARSLVEQLLSEGGEDSGGENELDGQVNLGCLLYKEGHYEAACSKFSAALQASGYRPDLSYNLALAYFSSRQYASALKHIVEIIEHGIRQ
HPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQIPFPPETFGNLLLLYC
KYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFVKLDGLAGMLTEQLRRLTKQVQEARHNKDDEAIKKAENEYDDTLEKYIPVLMAQAKIYWNLENYP
MVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILKVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKIYHFCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHMIVLRDSVIQECVQFLEHCELYGRNIPAVIEQPLEEERMHTGKNTVTYESRELKALIYEII
DWNM*
22 >lcl|NP_001077234.1|Plus13296488..3298362 NW_001495473 recQ-mediated genome instability protein 1 MGC140340 __SEG__ Chr8 {Bos taurus} MSVTSIALRVETWLSATWHVKVPVTWLEACINWIQEENDHVNLSQAQMNKQVFEQWLLTDLRDLEHRLLPSGILETPKGELNGFFALQINSLVDVSQPAYAQIQKLRGKN
TTNDLITAETQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQSIPALHSDLPPGTKILIYGNISFRLGVLLLKPENVKMLGGEVDALLEEYAQEKVLARLIGEPDPIVSV
IPNNSNQIIPRITDVLDPALGPSDEELLASLDENDELAANNNTSLERSCFIGNSSNTVPIRQSDFETELVISPRPREKPRNQSMLFTDEELDDFSLEEALLLEEAVQKEQ
METKELQLLTLNRTTDESIEKFSHRSNTLNNFSFICKNGNNNWSEKNLSEQMTSEDKSLSCPSTRDQNSSSLSVNHNVPLPHDFTNKGKSSETYKIKQISSSDGHSLNNK
MFNGELVSNVPKRSSDVPNENEHHLQTCSLQLSENSTGLPITMDLYSPPFIYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSVRAKISDGTAYLDVDFVDEILT
SLIGFSVSEMKRLKKDPCKYQKFLEGLQKCQRELIDLCCLMTISFNPSLSKAMVLALQDVNTDHLENLKRRLKK*
23 >lcl|NP_001092561.1|Plus11516254..1518248 NW_001494580 tetratricopeptide repeat protein 30B TTC30A __SEG__ Chr2 {Bos taurus} MAGLGGSQIPDGEFTAVVYRLIRDARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVSLLLLDNPA
YHNRVLRLQAAIKYSEADLPGARSLVEQLLSEGGEDSGGENELDGQVNLGCLLYKEGHYEAACSKFSAALQASGYRPDLSYNLALAYYSSRHYALALKHIADIIEHGIRQ
HPELGVGMTTVGIDVRSVGNTVVLHQTALVEAFNLRAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQIPFPPETFGNLLLLYC
EYEYFDLAADVLAENAHLTYEFLTPYLYDFLDAMVTCQTAPEEAFIKLDGLAGMLTEQLRKLTIQVQEARHNKDDEAVKKAVNEYEDTLEKYIPVLMAQAKIYWNLENYP
MVEKLFRKSVEFCNDHHVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMISQNEEAEELMRKIGKEEEQLSYDDPDKKIYHLCIVNLVIG
TLYCAKGNYDFGISRVIKSLEPCNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELYGRDIPAVIEETLEEERMHIGKNTVTYESRELKALIYEII
GWNM*
24 >lcl|NP_001093172.1|Plus11493288..1495291 NW_001492867 chromosome 14 open reading frame 169 C10H14ORF169 __SEG__ Chr10 {Bos taurus} MDGLRASAGLLRRGRLRRRRQQQPHSGSVLALPLRPRKIRRQLRRSVSSRMAALRAQTLQSEDSEDSRVESTVGEPGDPLAGGAAALSDATGREPHGQLGPVELLEASPA
SRSLQTPRALVEAQTPAARLVEAQTPAARLVEAHTPAARLVEAHTPPARLVEASALPARLVETSALLCSTQHLAAVPPSVAPAMLSGPQGESTGEELPWDSPLQRILAEL
NRIPSSRRRAARLFEWLISPMPPDHFYRRLWEREAVLVRRQDHSYYQGLFSTAVLDSILRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYRAGCSLRLLCPQ
AFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDG
VHSLHLTLSTFQRNTWGDFLEAVLPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALS
VYGLPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLRSYPEFVRVGDLPCDTVEDQLSLATMLYDKGLL
LTKMPLT*
25 >lcl|NP_001093772.1|Plus11599672..1601984 NW_001494052 UTP14, U3 small nucleolar ribonucleoprotein, homolog A UTP14A __SEG__ Chr21 {Bos taurus} MSRNQAAESNLLALNQQKELEDLPKDYPLSTSEDEGDNDGERKHQKLLESISSLNRKDRQKLAERSEASLKVSEFSVSSEGSGEKLVLSDLLEPVKTSSSLAAVKKQLNR
VKSKKTVELPLHREEIEQIHREVAFNKSSQILSKWDPVVLKNRQAEQLVFPLSKPQSVFAPIEHVVSGWKAGTPLEQEIFDLLHKNKQPVTEPLLTPVEKASLKAMSLEE
VKMRRAELQRARALQSYYEARARREKRIKSKKYHRILKKGKAKQALKDFEKLQKVNPAAALEELEKLDKARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAR
NKELMQKVQAASESEEEEEVQEEEEEPLVPDMVNGVQIKANGLNPWMFQNHFIVAKEAEVQKDLENPAEPEAQETSESEEESAVVEEETLLKEFEERRSLRQKSELNHMA
EPVHRHVTKDPSSQEVLSELRALSQKLITENHQSGKQELSSARTAQREEPAREEEEPMLLQRPKRAQTLEELEELGREGCVENKELPRTAVEGLQLEKNLSNHIGTPKEK
KRKEQMIDLQNLLTTKLSSVKSLAVPTTVQELEDEEERDQRQMIKVAFAGDDAIRDFLKEKREAVEASKPKDLDLTLPGWGKWGGMGLKPSAKKRRRFLIKAPEGPPRKD
KNLPNVIISEKRNIHAAAHQVQVLSHPFTHHHQFERTIQTPIGSTWNTQRAFQKLTMSKVVTKPGHIIKPIKAEDVGYRSSSRSDLSVVQRNPKRLSIRHKKLLENNCVD
*
26 >lcl|NP_001093782.1|Plus1603523..604662 NW_001495055 EP300-interacting inhibitor of differentiation 3 EID3 __SEG__ Chr5 {Bos taurus} MADENGSLREAGAGGKTRAQAVVTIPSSAYFLKQVEEEEEVEALKVEVAAASDTESDTSSDDLSCGKADIDPSLLERVDEEKCRSIRKQYRQLIYTVQQNRDDIVNTASD
SLTEALEEANVLFDAVSRTREAALDSQFLVLASDLGKEKAKHLNSDMNFFNQVAFCDFLFIFVGLNWMEDDERDPLNNCDDNIALSFWETVQKEATSCISQAETFHFLFG
SFKPESAARKPRRNHRRKVQKMEENGVMPTKLRKLDLSGNQEATEKEVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRLDQDRLPIL
EPININLAGEGNDPSFHSRKQGVISLSLQDWKNIVAAFEISEAMITNSY*
27 >lcl|NP_001095519.1|Plus12805627..2806550 NW_001493902 melanoma antigen family F, 1 MAGEF1 __SEG__ Chr1 {Bos taurus} MLQKPESGALPISQAEREMDGSHDGETQALTASQEMAPSPLLQERPEEDLGAVREEGATEPSLTPKGARALAAKTLARRRACRRLDRTVAELVQFLLLKDRKKSRITRSE
MVKYVIGDLKDLFPEIIARAAEHLRYVFGFELKQLDRKHHTYILINKLKPIEDEEEALRGDGPRLGLLMMILGLIYMKGNSAREAQVWAMLRRLGVRPSKYHFLFGYPKR
LIMEDFVQLRYLNYRRVPHTNPPECEFSWGPRSNLETSKMKVLGFVAKLHKKEPQHWPVQYREALADEADRARAGASVRARSSTHLW*
28 >lcl|NP_001095737.1|Plus1complement(1645689..1646237) NW_001495562 hypothetical protein LOC613695 C9H6ORF203 __SEG__ Chr9 {Bos taurus} MAMTSVRLPSSILRKPDAWIGLCRALRGTPSHKGCASWNRYLYLSSAKLNASNYKTLLHNIFSLRLPGLLISPEYIFPFSIRLKSNISSKKSTKKTLQKVEDEGDSDEER
DEMSELEEEPEDNPSEVKDYKDLDKAVQSFRYDVILKTGLDIGRKYVRFHTKITCLLGCFKAALPITWLILQ*
29 >lcl|NP_001095968.1|Plus1complement(582512..583333) NW_001494173 NFKB activating protein-like NKAPL __SEG__ Chr23 {Bos taurus} MAPVFQSSYPEDTPGSGRQRRSSSKSPPSAQARHSPWVSRTHSRDREGLRPSWSRSGVGASYPFNRPGSRERPPGLRNYDFSSSSFSCGGYRYHQHHYVGNRQWAEDCEK
EKEESYRQRRLKERERIGELGAPEVWGLSPKFPEPDSDEHTPVEDEEVKTKKSSSSDSSSEEKRKKAGRSKNKKKRKKKSKRKHRTYSDNSDSDSDSDTNSSSDDKRRVK
KVKKKKKRRAKKPKKKKTKKTKKESSDSSYKDSEGELAEDVWIEQSKIADNMDL
30 >lcl|NP_001095980.1|Plus126408..27097 NW_001494247 hypothetical protein LOC527341 MGC160046 __SEG__ Chr24 {Bos taurus} MQKLNLSHNQLRAVPPELGKLTRLVVLNLCGNRLKTLPGEVSLLQSLKVLFVHMNGLTELPAELGACRSLEVLSASHNCLSQLPTSLADLSRLRKLNLSHNRFAHIPVCV
FSLKELDFLHVGSNRLENIAESIQCLAGLQIFIAEGNHIHTFPRSLCLLTSLELLNLNNNDIQMLPAELYMLCRLTRIAWNPMDKGLHISRNPLSKPLPELLEGGLEMLV
SYLKDRKHT*
31 >lcl|NP_001098454.1|Plus1536570..536980 NW_001494889 lipoma HMGIC fusion partner-like 3 LHFPL3 __SEG__ Chr4 {Bos taurus} MLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQAGYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACII
CFTLFFFCNTATVYKICAWMQLTSGEC
32 >lcl|NP_001103912.1|Plus11150221..1150577 NW_001493607 succinate dehydrogenase assembly factor 1, mitochondrial SDHAF1 __SEG__ Chr18 {Bos taurus} MSRHSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHACLPRSDVLRIEYLYRRGRRQLQMLRSGHATAMGAFVRTRGPTEESNGAGAPGTLSGEGDDPRKPLDSMRT
PKTPLDGR*
33 >lcl|NP_001137559.1|Plus1985454..986062 NW_001494538 coiled-coil domain containing 85B CCDC85B __SEG__ Chr29 {Bos taurus} MEAETGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
EDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGSGGSGGSGAGPTPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD*
34 >lcl|NP_776675.1|Plus1complement(2672805..2673068) NW_001493161 bladder cancer-associated protein BLCAP __SEG__ Chr13 {Bos taurus} MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT*
35 >lcl|XP_001249312.1|Plus1474789..476159 NW_001501761 serine incorporator 1-like LOC781002 __SEG__ Chr7 {Bos taurus} MGSVLGLCSMASWIPCLCGSALCLLCRCCPSGNNSTVTRLIYALFLLVGMCIASVMLIPGMEEQLNKTSGFCENEKGMVPCNILFGCKAVYRLCFGLAMFYLLLTLLMIK
VKSSSDPRAAIHNGFWFFKFAAAIAIITGAFFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVVKMEEGNSRCWYAALLSATAPNYLLSLVAIILFFVYY
THPASCAENKAFISVNMLLCLDASIMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMTSEPETECNPSLLNIIGYNTTRTISKEGQSVQWCHTQGIIGLILFLLCVFH
SSIHTSNNSQVNKLTLTVSLVDESTLIEDGGARNNGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTDWYRYEPSREMKSQWTAVWVKISSSWIGTVLY
VWTLVATLVLTSRDFD*
36 >lcl|XP_001250163.1|Plus1complement(286159..286254) NW_001494423 mitochondria-associated granulocyte macrophage CSF signaling molecule-like LOC782022 __SEG__ Chr27 {Bos taurus} MAKYLAQIIVMGAQVVGRAFARALRQEFAAS*
37 >lcl|XP_001250533.1|Plus1complement(1012719..1013105) NW_001493740 phosphatidylinositol glycan anchor biosynthesis, class P-like PIGP __SEG__ Chr1 {Bos taurus} MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLIYWPQKYWAVALPVYLLITVVIDYVLLFGINMMSTSPLDSIHNITDNYAENQQHKKDQEEAIPA
LRDIPISEVNQMFFLEAK*
38 >lcl|XP_001250744.1|Plus1complement(673317..674348) NW_001508851 melanoma antigen, family B, 2-like LOC782159 __SEG__ ChrX {Bos taurus} MPRRHKSKSHARRKRHEVQGDTQEAQASAAAAPKEECPSSHSSAPQGSPASSPAAGDGQELQGAMAPSSPDAGPSCAGSDEGAQGPEEASAGASQAAPSTQSTRKDPLAR
KARILVEFLLEKYTKQEPITQNALMKIVSRKYRQHFPEVLSTARERMELVFGLEMKEVDCRGNIYTLIRKLNLGGNDCRRDEGALPKSRLLMVLLGVIFMNGNRATEEEI
WEFLSMLGIYAGRRHCIFGEPRRLITKDLVQKEYLNYRQVPNSDLPRYEFLWGPRACAEISKMKVLEVLAKFHGRVPSSFPDLYDEALRDQAERAGRRRAARAPTMAEAS
APSRAKSCSSCHI*
39 >lcl|XP_001250784.1|Plus1286631..287269 NW_001493864 peroxisomal membrane protein 4-like LOC782775 __SEG__ Chr1 {Bos taurus} MVAPPQLRALLFAINALLRKRRYHAALAMLKGFRNGAVYGAKIRAPHALVMTFLFRSGSLREKLRAILQATYTHSWNLARFVFLYKGLCALQSHVQGKTYQAHSFVSAFI
GGLLVFGNNNNINSQISMYLLSRVLFALCRLGVEKGFIPEPRLDPFPWFSGLVWGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFFIYNKSQPSK*
40 >lcl|XP_001251325.1|Plus1400950..401405 NW_001508847 hypothetical protein LOC784741 __SEG__ ChrX {Bos taurus} MSEQAEKSSSVRERPARQSSPEKPSEKELKQMKWLDRQLKQLSFQNPGPQVANFNPEVRQQIKKGQMAKKNELVPEKREVNKYDEKGRLTFNKADLCDCLDEGCLGCFYP
CPKCNSTKCGPTCRCNRRWAYDTIVDENGEVISKMPFDLSE*
41 >lcl|XP_001251339.1|Plus1complement(327170..328174) NW_001508834 melanoma antigen family B, 4 LOC782703 __SEG__ ChrX {Bos taurus} MPRRHKSKSHARGKRHQVRGDTQEAQASAAEAPKEECPSSHSTAPQGSLPSSPAAGNHQQLQGAMVPSSPDAGPSCAGSDAGAQGPEEGSAGASQAAPRKDLLARKARIL
VEFLLEKYTKKEPITQNALMKIVSRKYRQHFSEILSTVRERMELVFGLEMKEVDGRGNIYTLIRKLSLGGNDCPRDEGALPKSRLLMVLLGVIFMNGNRATEEKIWEFLS
MLGVYAGRRHCIFGEPRRLITKDLVQKEYLNYHRVPNSDPPRYEFLWGPRACVETSKMKVLEALAKFHGRVPSSFPDLYDEALRDQAERAGLRGAARARSKAEASAPSRA
SSHI*
42 >lcl|XP_001251428.1|Plus11257013..1257543 NW_001493571 hypothetical protein LOC784324 __SEG__ Chr18 {Bos taurus} MDPPDSASRVFCSRILSMVNADDVSAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMNERFLHHTRTLVKMKRNLDSIFRRIRTLKGKLARQHPEAFSHIPEASLLED
EDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHIRPGSPAINGRSHTDDEEMPGE*
43 >lcl|XP_001251473.1|Plus1complement(1043489..1044250) NW_001494417 NEFA-interacting nuclear protein NIP30 LOC783570 __SEG__ Chr27 {Bos taurus} MDGGDDGNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELK
KLKEYRSNLNKVGISSENKKEVEKKAVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKSDPDPDDKNQEASSCVSLGSTSLSSPSIRCPSAAVCIGILPGLGAYSGS
SDSESSSDSEGTINATGKIVSSIFRTNTFLEVP*
44 >lcl|XP_001251848.1|Plus1complement(1722496..1723134) NW_001493157 peroxisomal membrane protein 4-like LOC784320 __SEG__ Chr13 {Bos taurus} MVAPPQLRALLFAINALLRKRRYHAALAMLKGFRNGAVYGAKIRAPHALVMTFLFRSGSLREKLRAILQATYTHSWNLARFVFLYKGLCALQSHVQGKTYQAHSFVSAFI
GGLLVFGNNNNINSQISMYLLSRVLFALCRLGVEKGFIPEPRLDPFPWFSGLVWGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFFIYNKSQPSK*
45 >lcl|XP_001251857.2|Plus1complement(473747..>474130) NW_001494275 hypothetical protein LOC785480 __SEG__ Chr25 {Bos taurus} IHLCQHVMMPSRTNLATGIPSSKVKYSRLASTDDGYTDLQFKKSPPKIPYKAIVLPTVLFLTGAFLIIIGSPLLAGYISKVGADWAVPVLIIGILVFLPGFYHLRIAYYT
SKGYRGYSYDDIPDFDD*
46 >lcl|XP_001253001.1|Plus1complement(3422869..3423285) NW_001494083 CG5323-like LOC784786 __SEG__ Chr22 {Bos taurus} MVELQQLRVQEAVDSMVKSLERENIWKMQGLMLWCSAGCCKDSQASMQQVHQCTEHCHASLAQAQALVTSELEKFQDRLARCTTYCSDKAKDSIDVGSEELQVKRRLETC
ATKCVDDHVNLIPTMTRKMKESLSSIGK*
47 >lcl|XP_001254354.3|Plus11793961..1794509 NW_001495562 hypothetical protein LOC786764 __SEG__ Chr9 {Bos taurus} MAMTSVRLPSSILRKPDAWIGLCRALRGTPSHKGCASWNRYLYLSSAKLNASNYKTLLHNIFSLRLPGLLISPEYIFPFSIRLKSNISSKKSTKKTLQKVEDEGDSDEER
DEMSELEEEPEDNPSEVKDYKDLDKAVQSFRYDVILKTGLDIGRKYVRFHTKITCLLGCFKAALPITWLILQ*
48 >lcl|XP_001254415.1|Plus1complement(693826..695604) NW_001494245 transmembrane protein 200C TMEM200C __SEG__ Chr24 {Bos taurus} MIATGGLLRISARKQDPLRPPGQVPKRKRKTKKRRKNDVVVVKGKLKLCSVSGLIALCGIVVLLVGIALAVVGYWPKANGAHREGAKQPPPPPGDSGPRVPSVTSSSGGN
RHRSRTQPGPPEGVTASSGGAPRSTPPARSPAPSPSSSTSVGFFFRVFSGYLHSDKLKVFGPLIMGIGFFLFICANAVLHENRDKETKIINLRDLYSTVIDVHSLRAKDL
AAAASSSGPASAPPGAAPLNGFLGYVQSRGLELKPGTRGGAARDAFGAAAMLARGAWPHPAARSGGGGGTPGAASPPDLVSSPRRPREPPSLAEAVYSIYRERPGVAGRR
RAASSGSSPVPGSPPETWGRPSTASSLVGSSLSAFALLPLPGDRDGDAGAASRGWQRPPGERGAREIPLDLSLADLRGGARGGARWAPREPEEPAAARTARGQGGRLPRT
GRHAALRRRSTSGLPDYRAASYPEPPSASRSADLDSSLPELAASPESPARPDSPSSHSDDPSCSNKGYTPLRETGTSLESMGDLREGGNPDGEAAIAPGPEQRPPEDPGQ
EVPEAEPSQPVQRQFTNKEKLYMISRSHASGVEDGELESAGI*
49 >lcl|XP_001254613.3|Plus11513344..1514249 NW_001494245 leucine rich repeat containing 30 MGC160046 __SEG__ Chr24 {Bos taurus} MGARQSGARRKDKGPLGRGLLRGRQKFSSWDDALLPGRDPRCLLKRGLRHVSFSLVTKGMTDAPDFLWGLSEMQKLNLSHNQLRAVPPELGKLTRLVVLNLCGNRLKTLP
GEVSLLQSLKVLFVHMNGLTELPAELGACRSLEVLSASHNCLSQLPTSLADLSRLRKLNLSHNRFAHIPVCVFSLKELDFLHVGSNRLENIAESIQCLAGLQIFIAEGNH
IHTFPRSLCLLTSLELLNLNNNDIQMLPAELYMLCRLTRIAWNPMDKGLHISRNPLSKPLPELLEGGLEMLVSYLKDRKHT*
50 >lcl|XP_001255237.1|Plus132308..32646 NW_001493639 hypothetical protein LOC789841 __SEG__ Chr18 {Bos taurus} MDAYDQVQKGPLKLKGVTELGVTKWKKKKDRDKAKLLETMGKIQKNQEEELRRHLDKLTPAQVAFEKVQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSW
TK*
51 >lcl|XP_001255245.1|Plus1complement(24715..25053) NW_001493639 hypothetical protein LOC789844 __SEG__ Chr18 {Bos taurus} MDAYEQVQKGPLKLKGVTELGVTKRKKKKDRDKAKLLETMGKIQKNQEEELRRHLDKLTPAQVAFEKVQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSW
TK*
52 >lcl|XP_001255460.1|Plus1complement(214176..214814) NW_001508700 hypothetical protein LOC788379 __SEG__ ChrX {Bos taurus} MSDLALAPGTQKGYQWKTNFSLFGVDNMIPSPGHILRVYSGVLPWSLALDWLTEKPDLFQLALKAFRYTLKLMVDKASLGPIEDCKELINCLEEYESDWYIGLVSDEKWK
EAVLQEKPYLFSLGYDPNMGVYTGRVLTLQELLIHVGKLNAEAVRGQWANLSWELLYATNDDEERYSIQAHPLLLRNLTIQAADPPLGYPIYSSKPLHIHLV*
53 >lcl|XP_001255902.1|Plus1complement(537629..537892) NW_001493232 HC12887-like LOC789021 __SEG__ Chr14 {Bos taurus} MGVKLEVFRMTIYLTFPVAMFWIANQAEWFEDYVIQCKRELWPPEKEDQRRELEEFKERRRKQRQEKLPRVPSRAPEVSPCRNSSLP*
54 >lcl|XP_001256364.1|Plus11007323..1008111 NW_001508713 melanoma antigen family A, 10-like LOC789689 __SEG__ ChrX {Bos taurus} MPVVPTNELCTSEEDLQGQIQAEGPVEAQLLGAEAEDASTPLASFPPVSSSSAIGDAEILFMQALNGMTTQLLEFLILKYGTKEPIFQAEMLNTVLRDNQAHFQVIFRKA
TQCLQLSFGLDMKEVDHREHIYVMVPVLGLTLNEMQRDEQSIPKAGLLVAALSLIILAGDRISEEKVWGALSKMEVFPGIQHCIYGEPKELLTQVWVRAGYLKYRQVRYS
HPARYEFLWGPRAYAETSKQKVKDYLRKINGRGPRFFPPRWA*
55 >lcl|XP_001788177.1|Plus1280383..281165 NW_001508710 melanoma antigen family A, 10-like LOC531026 __SEG__ ChrX {Bos taurus} MPVVPMNELCTSEEDLQGQIQAQGPVEAQLLGAEAEDASTPLASFPPVSSSSAAVDAEILFKQALNGMMAQLLEFLLLKYGTKEQIFQAEMLNTILRDNQAHFPVVFRKT
TQCLQLAFGLDMKEVDHREHIYVVVPFLGLTLNEMQRDEQSIPKALVAALSLILLAGDRISEEKVWGALSKMGVFAGIKHCIYGEPKELLTQVWVWEGYLQYQQVPYSHP
ARYEFLWGPRAYAETSKQQVKDYLRRVNGRGPRFFPPRWA*
56 >lcl|XP_001788485.2|Plus1complement(1124689..1125480) NW_001508713 melanoma antigen family A, 9-like LOC520317 __SEG__ ChrX {Bos taurus} MSEQRKPKKDLQDLGDTQGPEEAQLLGAEGGEAATPSASSRPVSSCSAEEALTQEALNKMVANMVKFLLCKYRAKEPTTDAELMNTVLGDNQKYYPVVFRQAVECVLLVF
GVDVRQVDTAPIYIMVPSLGLTYDTIQGSGQGLPKAGLLVVVLSLILQNRDRSPEEEIWRALSKMGVCVLREHPIFGEPRELLTQVWVREGYLEYRQVPDSDPARFEFLW
GPRAFAETSKEKFTEYLLRVNRRAFRSFPLPSAEAVREEEEGS*
57 >lcl|XP_001789556.1|Plus11392553..1392792 NW_001495263 hypothetical protein LOC100138086 __SEG__ Chr7 {Bos taurus} MHPDLSPHLHTEECNVLINLLKECHKNHSILKFFGHCNDLDREMRKCLKNEYMEKRNKSRELGNAMRKRLFNPPEESEN*
58 >lcl|XP_002684312.1|Plus11998509..1998757 NW_001492961 immediate early response 3 interacting protein 1 LOC100296786 __SEG__ Chr11 {Bos taurus} MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG*
59 >lcl|XP_002701703.1|Plus1complement(1257599..1258201) NW_001493490 Ngg1 interacting factor 3 like 1 binding protein 1-like LOC100296011 __SEG__ Chr17 {Bos taurus} MTNEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRK
NRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP*
60 >lcl|XP_002702793.1|Plus13434..3646 NW_001494095 split hand/foot malformation type 1 LOC100295449 __SEG__ Chr22 {Bos taurus} MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS*
61 >lcl|XP_002703554.1|Plus11323573..1323836 NW_001494534 transmembrane protein 216-like LOC100295716 __SEG__ Chr29 {Bos taurus} MLFLYLGTEVIGLFFGTKGSLCQWKMPHGINVVLTFLSTMVASYYLLLQTSVIRLEAIMNSILLFFCSSELLLEVLTLATSSSMDRT*
62 >lcl|XP_002704045.1|Plus13646006..3646386 NW_001494824 phosphatidylinositol glycan anchor biosynthesis, class P-like LOC100297732 __SEG__ Chr3 {Bos taurus} MVENSPLPERAIYGLVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVVLPVYLLITVVIGYILLFGINMMSTSLLDSIHSITDDYAKNQQHQKDQEEAIPALR
DIPVSEVNQMFFLEAK*
63 >lcl|XP_002707474.1|Plus1complement(699969..>700310) NW_001508851 melanoma antigen family B, 4-like LOC100336118 __SEG__ ChrX {Bos taurus} SGLEDSIFGESRKLITKYLVQKGYPNYRQVPNSDPPGYEFLWGLRAYAETNKVKVLEVLAKIQDTVPSSFPDLYDEALREQVERAGLRGIPISPAMAEASASSRAKSYSS
SHI*
64 >lcl|XP_586027.1|Plus1complement(1235797..1236264) NW_001495281 FUN14 domain containing 1-like LOC539264 __SEG__ Chr7 {Bos taurus} MATRHLPPQEYESDGDSYKVLDLTEYARRQHWWNRVFAHSSGPIVEKYSVATQIAVGGVSGWCAGFLFQKVRKLAATAVGGGFLLLQMAGDGGYVQINWKRREKDVNKAK
GRMKKRANKAAPEVSNVIEAATEFVRQNIVIASGLVGGFLPGLAS*
65 >lcl|XP_586734.1|Plus1258727..259998 NW_001493892 hypothetical protein LOC539374 __SEG__ Chr1 {Bos taurus} MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKKLHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMK
LTVSAQGIRMVHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHT
IPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQQEQELQEEEEEEHAEGCPEEEEDRAGEGEPAEPEAEAKRALVVAMHFECGDLLDTLESGHEEALGGGGV
SPGPEAGSSPLLLGSTSDMRAELSQLINDLGELSFGNDVRSLQADLRVTRLLSGESTGSESSIEGGGPDANTATAGDPSGPADCASPDEPHSG*
66 >lcl|XP_586847.3|Plus1complement(1803794..1804903) NW_001508715 melanoma antigen family A, 10-like MAGEA10 __SEG__ ChrX {Bos taurus} MSHAPKRRRCVLEEGSEAQSVLAVVEEDTSSSSTCSSSFPFSSSSSSYSLISSSPGEELNVIPGPPGPSQDPSQGPSQDPSQGPSQSPPSSSLSPTAVASPMSESGDSPS
SQKEESPSTSQALPNAESLPRNVIDDRVADMVEFLLLKYRTKELTTKAEMLNVVIKDYQDHFPEIFREASECLQLAFGVDVKEVDPSDDSYALVTTLGLTCDGLMSDGET
MPKNGILIVILSMIFMEGGCVSEEKVWEVLNVMGVYDGTEHFIYGEPRELITRVLVQEQYFEYRQVPNSDPARYEFLWGPRAHSEIYKMTLLEFLAKISGSDPRAFPLWY
EEALRQQEERAQSGLATMDDTSAVASESSSAPSSSFCPE*
67 >lcl|XP_588628.2|Plus13775320..3775628 NW_001494145 hypothetical protein LOC511316 __SEG__ Chr23 {Bos taurus} MKAATRILLKPTQALYRLQEHVRRSLPELAQHKADMQRWEQQSQGAIYTVEYACSAVKNLVDSSVYFHSVEGLLKQAISIRDHMNTTAQGHSPEEPLPPSSA*
68 >lcl|XP_590423.2|Plus1complement(1073279..1075195) NW_001493168 WW domain binding protein 11 WBP11 __SEG__ Chr13 {Bos taurus} MGRRSTSSTKSGKFMNPTDQARKEARKRELKNKKQHMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNKKVLKDKRKKLRETYERILQLYEKENPDIYKELRKSE
VEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSSILIQDIPLSGAQPPSILKKNSAYGPPTRAVSILPLLGHDVPRLPPGRKPPGPPPGPPPPQVLQMYGHKVGF
ALDLPTRRRDEDMLYSPELAQRGHDDDVSCTSEDDGYPEDMDQDKHDDSTDDSDSDRSGGESEGDEFVHRDDTERENNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQ
AMMLQMAGQEIPEEGREVEEFSEEDDEDSDESEAEKQSQKQHKEESLSDGTSAASQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLR
PPGMPGLQGPLPHLLPPGPPPGRTPGPPPGPPPGLPPGPPPRGPPPQLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSTAT
IEKKATATISAKPQITNPKAEITRFVPTTPRVRRENKGAAAAAQRKSEDDSAVPLAKTAPKSGPSLPVSVQTKDDVCEAFMKEMEGLL*
69 >lcl|XP_592743.2|Plus1complement(65697..66335) NW_001494233 peroxisomal membrane protein 4-like LOC514831 __SEG__ Chr24 {Bos taurus} MVAPPQLRALLFVINALLCKRCYHAALAMLKGFQNGAVYGAKIRAPHALVMTFLFRSGSLREKLLANLQATYTHSWNLARFVFLYKGLCALQSHVQGETYQAHSFVSAFI
GGLLVFGNNSNVNSQISMYLLSRVLLALCHLGVEKGFIPEPRLDPFPWFTGLVWGLVLWLFECHRPTLQPSLQSSTTYLYEDSNVWHDLSDFLIYNKSQPSK*
70 >lcl|XP_598651.2|Plus1863311..864189 NW_001494536 leucine rich repeat containing 10-like LRRC10B __SEG__ Chr29 {Bos taurus} MGIAESTPDELPSDAEEQLRNGEQQLELSGRRLRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRILALDFNKLERLPDGLCRLPRLTRLYLGSNRLLALPADFA
QLQSLRCLWIEGNFLRRFPRPLLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGGFPDLHPLRALRVFSYDHNPVTGPP
RVADTVFLVGEGAVERMAERDEPTPRPPPRRPARVFDDEEEEDLLIGGGSSQALGAPGDSLRALEAAPGLGT*
71 >lcl|XP_599282.3|Plus1complement(2622766..2624829) NW_001493600 ataxin-1-like ATXN1L __SEG__ Chr18 {Bos taurus} MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTF
NVASSLIQHPGIHYPPIHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPASSPAHSFSKAPSASSPPGQLPHHSSTQPLD
LAPGRMPIYYQMSRLPAGYTLHETAPAGASPVLTPQEGQPALEAAAANGQRPRDRNLVRRESEALDSPSNKGEGQGLAPVVECMVDGQLFSGSQSARVEVAVPAHRGTPD
TDLEVQRVVGALASQDYRAVAAQRKDEPSPLNLSHHNPDHQGGGRGPARSAAEMAEKNQARGVSPHSHQEPLKHRPFPKAVVVANGNLVPAGTDPGLLPVGSEILVASSL
DIQARATFPDKESTLPPVTSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGW
SSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSVSQSSCAPPGQLGPPRERPERTVLGPREQCDSDGKSQPSGEGSRSVEPSQPEPGAQACWSAPSFQRYSTQGEE
ARAALLRPSFIPQEVKLSIEGRSNAGK*
72 >lcl|XP_606346.3|Plus138066..38494 NW_001494322 inactive Ufm1-specific protease 1 UFSP1 __SEG__ Chr25 {Bos taurus} MGDKPPGFRGSQSWIGCVEASLCLDHFGGPQGRLCHVPRGAGLHGELERLYSHFAGGGGPVMVGGDADAQSKALLGVCLGPGTEAYVLVLDPHCWGAPKNPSELQAAGWV
GWQEVSTAFDPHSFYNLCMTSCNSEEQNRALD*
73 >lcl|XP_607226.3|Plus11303254..1303682 NW_001494698 CG5323-like LOC528794 __SEG__ Chr2 {Bos taurus} MAELQQPQVQEAVDSMVKSLERENIRKMQGLMFRCSTACCEESQASMQQVHQCIEHCHAPLAQAQAPVTSELEKFQDRLARCTMYCNDKAKDSIDAGSKELHVKQQQETC
VTKCVDDHMNLIPTMTRKMKESLSSIGETAVC*
74 >lcl|XP_609164.4|Plus11168786..1169418 NW_001494036 ribonuclease P 25kDa subunit-like RPP25 __SEG__ Chr21 {Bos taurus} MAKPTSPQRRRMENFRKVRSEEAPVGSGDEEGGPGSGPFADLAPGAVHMRVKEGSKIRNLLAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRY
QSVRELWQSLPPEPTPGQKPGEPAASLSVLKNVPSLSILLSKDALDPRQPGYQPPNPHPGPSSQPTAPTSKRSLGEPAAGESSAKRSQPEPGAAEEEQTA*
75 >lcl|XP_610370.4|Plus1complement(25612..26745) NW_001494439 tripartite motif-containing 67 LOC531867 __SEG__ Chr28 {Bos taurus} MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLHSRGSALSSGAAAAPPLDQEAAAGPACSGAGGSAAGGLGGGAGGGSDHADKLSLYSETDS
GYGSYTPSLKSPNGVRVLPMVPAPPGSSAAAARGVACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIVQRYQQGRGAAPGASAVTAVAICQLCDRTPPEPAA
TLCEQCDVLYCAACQLKCHPSRGPFAKHRLVQPPPPPAPSEVASGSPGAVQGAPSGSGGCKSPGATGAGAAGGNTARKYPTCPEHEMENYSMYCLTCRTPVCYLCLEEGR
HGKHEVKPLGAMWKQHKVSARLAGHGDTGAKKRAPPPPPRWLNEQVL*
76 >lcl|XP_610684.1|Plus1complement(385262..386284) NW_001508834 melanoma antigen family B, 4 MAGEB18 __SEG__ ChrX {Bos taurus} MPRGQKSKLRAREKRRQARTETQGLEVAKATGAAAAGKPHSPVFGDRPENLPAAGTPSTPEAREGATGATAASSGTNSAENINSPKAESASFPRGAESSLSEILSKKVVL
LVQFLLQKYQKREPIKKADMLKFVIKQYKNHFNEILKRASDHMELAFGVDLKEVDPTRHCYTLVNKLDLSYDSALNEYEHMPKTGILMIVLGVIFMRGNCAPEEAIWEVL
NMMGIYAERKHFIYGDPKKVLTEDLVQLKYLEYRQVANSEPPCYEFLWGPRAHAETSKMKVLEFLAKVHDTVPTAFPSWYQEALRDEEERARARAAARARTAALASARSR
ARASTSSQAK*
77 >lcl|XP_871356.2|Plus1complement(422268..423701) NW_001508686 CG3313-like DCAF12L2 __SEG__ ChrX {Bos taurus} MAPEQTGNKKREEPAPQKAAEGSSSPSSSSPGSSSPGSSSPGSAAVHADGPQPPKKPKRMVVRRSLVDYLRGREVGAPGRAGLSGFDSELHGFAVRKLPELLRERELSLG
TVDKVFASQWLNARQVVCGTKCNTLFVVDVRSSQVTRIPLIRDRGHPPARAQPGCGIHAVQLNPSKTLLATGGENPNSLAVYWLPTLDPLCLGDHGHKDWIFAIAWMSDT
VVVSGSRDGTLGIWKIDPDVFRSSIAWRNAAGLSVYAHIRPAEVEDVPRAATNPRNCKVRAVAFGAKRQELGAVTMDGYFHLWKAQNTLSRLLSIRLPYGRENVCLTYCD
ELSLYAVGSQSHVSFLDLRQGHQSIRYLCSREGGTGVRSLSFYEHIVTMGTGQGSLLFYDIRAQKFLEEKVSDSQHSSPRPTGRRFRLICGRGWLNQDDLQMNDLSALAE
LPNALYTHCYNWPEMKLFVAGGPLPSNLRGNYAGLWS*
78 >lcl|XP_872675.1|Plus18367239..8367703 NW_001493148 hypothetical protein LOC615706 __SEG__ Chr13 {Bos taurus} MSSQKGNVTRSRPQRHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKREDVVIPFN
KEPEKTENVENNLRSSHRRSCRKNEENDDDLDFDIDLDDTEEDN*
79 >lcl|XP_873753.2|Plus1352778..353116 NW_001493635 hypothetical protein FAM32A __SEG__ Chr18 {Bos taurus} MDAYEQVQKGPLKLKGVTEIGVTKRKKKKDRDKAKLLETMGKIQKNQEEELRRHLDKLTPAQVAFEKVQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSW
TK*
80 >lcl|XP_875454.2|Plus1complement(2143021..2145288) NW_001494318 tripartite motif protein 2-like TRIM56 __SEG__ Chr25 {Bos taurus} MVSQGSSPSLLEALSSDFLACKICLEQLRVPKTLPCLHTYCQDCLAQLAEGSRLRCPECRESVPVPPAGVAAFKTNFFVNGLLDLVKARAGGDLRAGKPACALCPLMGGA
SAGGPATARCLDCADDLCQACADGHRCTRQTHSHRVVDLVGYRAGWYDEEARERQAAQCPQHPGEALRFLCQPCSQLLCRECRLDPHLDHPCLPLAEAVRARRPGLEELL
AGVDNNLAELEATRLAEKEALARLREQAAKVVTQVEEASERVLRALLAQKQEVLGQLRAHVEAAEEGARERLGELEGQEQVAREAAAFARRVLSLGREAEILSLEGAIAQ
RLRQLQGCPWVPGPAPCQLPQLELYPGLLDKNCHLLRLSFEEQLPQKDSGKDGARSQGGDATQPQSRDGVQTPNQDRAQTPQEDEAQPLKAERAETPQEDGAKTPKESRA
QTPQEDGGTQARVGSRSNKKRKFKGRLKSVSREPSPAPGPNLEGSGLLPRPIFFCSFPTRMPGDKRAPRITGLCPFGSREILVADEQNRALKRFSLNGDYRGAVPVPEGC
SPCSVAALQDTVAFSAAARLYLINHNGEVQWRRALSLCQASHAVAAMPSGDRVAVSVSGHVEVYNMEGSLATRFIPGGKANRGLRALVFLTTSPQGHFVGSDWQQNSLVV
CDGLGQVVGEYRGPGLHGCQPGSVSVDKKGYIFLTLREVNKVVILDPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHVFRVRPLDS*
81 >lcl|XP_875788.2|Plus1complement(206849..207880) NW_001508834 melanoma antigen family B, 4 LOC618364 __SEG__ ChrX {Bos taurus} MPRKHKNKNHAHGKRYQVQGDTQEAQASAAAAPGEECLSSPSFVPQVSSQSSVAAGNHQELQGAMAPSSTVAEASCAGSEEGTQGPKEESADAAQAALVTRSIRKDTLIK
KASMVMDFLLERYIMKEPITQDAMLEVIGSKFKQHFPEILSRASERVELLFGLELKEVDCSRNIYTLVNKFSLGVEEGSSDEEELPKSGLLMALLGIIFMKGNRATEEEI
WEFLNVLGIHAGKKHSIFGEPRKLITKDLVQKGYLNYRQVPNSDPPGYEFLWGPRAYAETTKMKVLEVLAKIQETVPSSFPDLYDEALRDQVERAALGGTARAPAMAEAS
ASTRAKSYSSSHI*
82 >lcl|XP_876338.3|Plus11080500..1081288 NW_001508713 melanoma antigen family A, 10-like LOC618931 __SEG__ ChrX {Bos taurus} MPVVPTNELCTSEEDLQGQIQAEGPVEAQLLGAEAEDASTPLASFPPVSFSSAAGDAEILLKQALNGMTTQLLEFLLLKYGTKEPIFQAEMLNTVLRDNQAHFPVVFRKA
TQCLRLAFGLDMKEVDHREHIYVMVPILGLTLNEMQTDEQSIPKAGLLVTVLSLILLAGDRVSEENIWGALSRMGVFAGIKHCIYGEPKELLTQVWVRAGYLKYRQVRYS
HPARYEFLWGPRAYAETSKQKVKDYLHRVNGRGPRFFPPRWA*
83 >lcl|XP_876547.1|Plus1complement(688057..688512) NW_001508842 hypothetical protein LOC619135 __SEG__ ChrX {Bos taurus} MSEQAEKSSSVRERPARQSSPEKPSEKELKQMKCLDPQLKRLSFQNPWPQVANFNPEVRQQIKKGQMAKKNELVPEKREVNKYDEKGRLTFNKADLCDCLDEGCLGCFYP
CPKCKSTKCGPTCRCNRRWAYDTIVDENGEVISKMPFDLSD*