SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr R    

ID / Description / Sequence
1 >lcl|NP_001003663.1|Plus1complement(606506..607372) NW_003535962 N-acetyltransferase 6 NAT6 __SEG__ Chr13 {Sus scrofa} MPPRGDPEIQLAKLTLDPTHQPELTLSPRLDELTLGSACHPELTLDPARQPEETPVPNLAELTMEPVHCRPELLDACADLINEQWPRSRASRLHSLGQSSDAFPLCLMLL
SPHPMPGAPPIVVGHARLSRVLDRPQSLLVETVVVARALRGRGFGRRLMEGLEAFAQARGFHRLHLTTHDQLHFYAHLGYHLGEPVQGLVFTSRRLPATLLSAFPKAPFP
QPPSKAPSLTAQSAPRAPRGPLVPPPPPLPEPVTTLPPPPAGPLPQSLLKTQYQDLRGYPIFWMEKDI*
2 >lcl|NP_001038063.1|Plus1473955..474641 NW_003300186 GTP-binding protein Di-Ras3 DIRAS3 __SEG__ Chr6 {Sus scrofa} MGNSCFGLKERLMKRLRPLPTVIVIRTCLPQRRSRDFRVVVLGSAGVGKSALVQRWVRGNFREAYLPTIEDTYRQVLGCSHKVGALHITDTTGGRRYRGLQRLAIARGHA
FILVYSVTKKHTLEELKPLYHLIRELKGNNPLKCPIILVGNKCDESHREVSEKEGAACASEWNCAFLETSAKMNINVQELFQMLLNHEKKPAASAQPAQKKSQIPKTAEK
LLGKCIIM*
3 >lcl|NP_001072150.1|Plus1complement(18521..19120) NW_003536156 DIRAS family protein LOC780430 __SEG__ Chr14 {Sus scrofa} MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGD
VESIPIMLVGNKCDESPNREVESSEAEALARKWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM*
4 >lcl|NP_001095291.1|Plus1complement(49820..51199) NW_003300233 zinc finger and BTB domain-containing protein 12 ZBTB12 __SEG__ Chr7 {Sus scrofa} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGVSDASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLGGGLGIGGSVGSHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEASVAEINVLIR*
5 >lcl|NP_001116661.1|Plus1complement(1180055..1180645) NW_003534544 rho-related GTP-binding protein RhoB RHOB __SEG__ Chr3 {Sus scrofa} MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNV
PIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL*
6 >lcl|NP_001116663.1|Plus1complement(<314876..315133) NW_003300509 rho-related GTP-binding protein RhoG RHOG __SEG__ Chr9 {Sus scrofa} MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIAS
7 >lcl|NP_001116677.1|Plus1complement(889868..890908) NW_003535879 protein Tob1 TOB1 __SEG__ Chr12 {Sus scrofa} MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVK
VLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQK
AISSSMHSLYGLGLGSPQQPQQQQQPSQPPPPPPPPQQQQQQQKTSALSPNAKEFIFPNMQGQGSSTSGMFPGDSPLNLSPLQYSNAFDVFSAYGGLNEKSFVDGLNFSL
NNMQYSNQQFQPVMAN*
8 >lcl|NP_001123443.1|Plus1884311..885225 NW_003534062 homeobox protein NANOG NANOG __SEG__ Chr1 {Sus scrofa} MSVDPACPQSLLCPEASISSESSPMPEVYGPEENYASLQMSAAETLDTETVSPLPSSMDLLIQDSPDSSTSPRVKPLPTSAEKSTDKEEKVPVKKQKIRTVFSQTQLCVL
NDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQKNHWPRNSNSVIQGSASTEYPGFYSYHQGCLVNASGNLPVWGNQSWNNPSWSNQTWNSQSWSNQTW
NSQTWCPQAWNNQTWNSQLNNYVEEFLQPQLQFQQNSISDLEAVLETAGENHNVIQQTSKYCGTQQQIMDLFPNYSMNIQPEDM*
9 >lcl|NP_001182527.1|Plus12007..2375 NW_003299211 splicing factor, arginine/serine-rich 13B SRSF12 __SEG__ Chr1 {Sus scrofa} SRHRRCSYSQSKSRSKSLPRRSTSARQSRTPRRNSGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKAQTAKHSHFRSH
SRSRSYRHKNSW*
10 >lcl|NP_001193310.1|Plus1138611..140425 NW_003300013 kelch domain-containing protein 7B KLHDC7B __SEG__ Chr5 {Sus scrofa} MVLRSHPFPRQERPQGRAPRAALGSSTSRASEDRRAGSPPEEAVPNCEDRRGSARLFTGADAGALAEAGGHSQQSSTEASEAPVTGPPSGPKGVRTEEEHPASLPPAAAV
PGALSRPPEQTRSASSSPARRGSLPVPRPRKRSMCEIAQSAEREVSRVAPGQHQGQAPGERPSPAGSGAALTEKQKEARKLMVFLQRPGAWGGVEGPRKLRSPARELASA
VALPPWGLDLGSCLDVLAFAQQHGEPRLAQEIYALMSDNLLHVLGDPSLYRQLSGADRERILSLRTGRGQAVLGVLVLPSLYQVSRSGLTRDPGGAGAPGVGPGPLPPCP
SLHVLHPGENTWQPLTQVPQEVPLRGCGLCTLHNYLFLAGGIRGSGAKAVCSNEVFCYNPLTNIWSQVRPMLQARAQLKLVALDGLLYAIGGECLYSMERYDPRTDAWTS
RAPLPAGSFPVAHEAVACQGDIYVTGGHLFYRLLRYSPEKDVWDECPYSASHRRSSDMVALGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLPDPAPLRCAVLGNT
IYCLNHRVTATFTVSEGTAQFQAKELQPFPLGAKGVLCPFTLTLPAADPLQTAL*
11 >lcl|NP_998904.1|Plus1complement(320456..321508) NW_003534995 membrane progestin receptor alpha PAQR7 __SEG__ Chr6 {Sus scrofa} MATMVAQKLSHLLPSLRQVHPEPQPSVHPEPVFTVDRAEVPPLFWKPYIYVGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFVGTVDFWGDPHALPLF
IIVLASFTYLSLSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEVPSALAYALDI
SPVAHRILASPEPATDDPALLYHKCQVVFFLLAAAFFSAFMPERWFPGSCHIFGQGHQLFHVFLVLCTLAQLEAVALDYEARRPIYEPLHTRWPHNFSGLFLLTVGSSIL
TAFLLSQLVRRKLDLDRKTQ*
12 >lcl|NP_998905.1|Plus1896449..897513 NW_003535192 membrane progestin receptor beta PAQR8 __SEG__ Chr7 {Sus scrofa} MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFLPAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FILDISPVAHRVALCHLSGCQEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYKGRQEIFLHRHSPLSIYAACLSFFFL
VACSGATAALLREKIKARLSKKDS*
13 >lcl|XP_001924512.3|Plus1111282..112295 NW_003535839 abhydrolase domain-containing protein 13 ABHD13 __SEG__ Chr11 {Sus scrofa} MEKSWMLWNFVERWLIALASWSWALCRISLLPLIVTFHLYGGIVLLLLIFISIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVRLNLILIRYTGDS
SPYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFL
SIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEEMAKT
SSNVTII*
14 >lcl|XP_001924985.3|Plus1168639..>170192 NW_003535777 kelch repeat and BTB domain-containing protein 6 KBTBD6 __SEG__ Chr11 {Sus scrofa} MQSREEASRSRRLASPRGGKRPKRVHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSESNVERLYAASDMLQLEYVREACASFLARRLDLANCTAIFKFADAFGHRKLRSQAQSFIAHNFKQLSQMGSIREESLADLTLA
QLLTVLRLDSLNIEHEQTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDRNYLEELLTKPIVKKYCLDLMEGALQMRYGDMLYKSLVPKPESSSACSSSSNNNNS
SGGGSGVGCGGSSSSCSVVSVAENPPQRLGVCAKKMVIFFGHPRDPFLCCDPYSGDIYKVPSPLTCLAHTRTVTTLAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLA
DRLLCREGMDVAYLNGYIYILGGRDPITGIKLKEVECYSVQRNQWALVAPLPHSFISFDLMVIQNYLYALNSKRMFCF
15 >lcl|XP_001925032.2|Plus1complement(108363..109163) NW_003536279 multiple inositol polyphosphate phosphatase 1-like LOC100155071 __SEG__ Chr14 {Sus scrofa} MLPLPGRIFRVRVAPVAALAVALVSSLSRCSLLEPENRVVSALSPYFGTKTRYEDANPGLLPDPEVPRRDPELLEETCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQ
ARAPDKGTRAAGGRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLVTSSKHRCVDSGAAFLQGLWQHYHPGLPPPDVAGDRPGLPAS
ALLLSSRSQTSPTSASPHFPLCSISHLLGPHLVRCSGLGYLPSPLT*
16 >lcl|XP_001925504.1|Plus1complement(1030535..1032142) NW_003535196 ankyrin repeat domain-containing protein 34C ANKRD34C __SEG__ Chr7 {Sus scrofa} MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGA
DPSLEDRTGASALVYAINADDKDALKHLLDACRAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKETDRQSPPLCASPSDIELKAPGLGCPPSEKEDDFFSLQAGHPSGC
NTSKALNDPGSPTRKVGNLKRARLPQLKRLQSEPWGLIAPSVLAASTRQDENHGVGTDNEVIKSISDVSFPKRGPLSRTNSIDSKDPSLFHTVTEQVLKIPASSAPASWK
AAYEKSQASHPRLARRGTLPIDQEKGGISPSGPSALKDAVSLKRLENDLYDLDLQAGTELPNSISLEPGKGPLDRMKLNSSHLSLFQGSRESLDTVPSTSPSSARHRPPH
LLERRGSGTLLLDRISQTRPGFLPPLNVNLNPPIPDIRSSSKPSSPLASGLKSMVPVAPSSPKRVDLRSKKKLLRRHSMQVEQMKQLSDFEEIMT*
17 >lcl|XP_001927670.1|Plus1318030..319349 NW_003534585 tRNA wybutosine-synthesizing protein 2 homolog LOC100155406 __SEG__ Chr4 {Sus scrofa} MEKEGGKPASVVAVVTEPRFTQRYREYLEKQKLLDRQHRVEKMPDGTVALPVLGEALSEQHLRELRDRVAPGSTCVLTQLLHPVPSKKTQGCSPAQRLCLEVSRWAESRG
VTWSAELEADLPRSWQRHGDLLLLSEGCFQAKQWRNLEPELWETIASALGVRRLAKRGRISPDGTRTPAVSLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVA
SLPCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLELNGVADRCQIHFGDNRKLRLSNIADRVNLGLIPSSEEGWPIACQVLRQDAGGILHIHQNV
ESFPGKKLQPTGSSETEKEYRPSLQQIITNQLKNGAASDSRREMQSAAIKPEWQRWAEAAETRLATLLWQVHGKPWKTQILHIQLVKSYAPHVDHIVLDLECRPCPLVG*
18 >lcl|XP_001927821.1|Plus1complement(2204474..2206393) NW_003535175 zinc finger and BTB domain-containing protein 22 ZBTB22 __SEG__ Chr7 {Sus scrofa} MEPSPMSPGGAALPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRASATTTTVTTAAATSVTVPGAGVPPGSGGSVAPAAVGSVRSHASSRASENQSPSSSNYFSPRESTDFSS
SSQEAFAASAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPVYAPPSIVPQKHWVYVKRGGTCPAPAPLAPQDPDLEEDEEEEDLV
LTCEDDEDEELGGGSHVPPGGEPETTLSISDVRTLSEPPDKGEEQVNFCESSNDFGPYESGGPGGGLEDSGGPTPSSYAPSHPPRPLLPLDMQGNQILVFPSSSSTSSSS
SQAPGQPPGNQTEHGAVTLGGASAGALGMPGGTGGTPGGTGSGDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECGVCA
KKFMWRDSFMRHRGHCERRHRLGGGGAGAGAGAGPGGPTGPAVQPKRESPGRGSGDEASGTTPPPSRRVWSPPSVHKVEMGFGGGGGAN*
19 >lcl|XP_001928010.1|Plus1complement(137468..139237) NW_003535254 ectoderm-neural cortex protein 2 KLHL25 __SEG__ Chr7 {Sus scrofa} MSVSVHETRKSRSSTGSMNITLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELEAEDERVVFEAILQWVKH
DPEQRKAHLPELLRGVRLALLPSDCLTEAVSGEALLMADERTRLIVDEALRCKTRILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYNTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA*
20 >lcl|XP_001928172.1|Plus1651682..656157 NW_003536287 zinc finger protein 518A ZNF518A __SEG__ Chr14 {Sus scrofa} MPSEQKHLFFDEKQNTLKKDYDVKNEIVDTVRSVLKPKISESHFHYELKNVKIVLPRINIPNEVLLKHEVDKYRKLFQHKPQTARKSISIKTVNCIEECVLLHKSERVEE
GIKMSAKILNFNCLKCRDSTRYSPNDLQKHFQMWHHGELPSYPCEMCSFSANDFQVFKQHRRTHRITLVKCDICNNENLYTLLDLTKHFSSTHCVNGNFQCEKCEFSTQD
VGTFVQHIHRHNEVLYKCDKCHYICLTKGELQKHLHIHSGTFPFTCQYCSYGATRREHLIRHVITLHKEHLYAKEKLEKDKYEKRMAKTSTGLKLILKRYKIGASRKTFW
KRKKINNGSDRSIEKNTQVLKKVNKTQAKSEDQSRLVQEHINEEKDERLYCENNDKPAESESEKPTLLSTGQCNRAEEGSNSTTGFLKTALQGPTVLMVKNNRITIPANY
SAKFMGFKMVDGKQHIVIKLLPTSKQNLYLPGSQSGATRHSTANLQPQTLDTTAFLTGVTTELNDTIYMKASTPFSCSSPIRSGKVTSEKEVALLSQTSNMLPTMDDEKS
VSSLPTTSELITASVNLTTKVETRDNVDLWGSHIAQCHPEVSGTAIKSPDKVTCTVKPNPYSSGDMHNYCINYVNSELPVESSNQGSLPFHNYSKVNNSNKRRRFSGTAT
CENPQKESSLSKTVVQQPISESVLSLVRKESSNPDSLLASISLLNTKDGTLKTQAEMEEQCVLEKGQNIDGQNLYTNENQNLESLTEKPKWDDISSDESPMMPRITSVFS
LQSQQASEFLPPEVNQLLQEVLKAKPDVKQDSSNTPSKDLRLHCDQSFQKHEREDKIVECSKDLKGQGLFPVPSCSMGINGPTNDPNLKCGGKEKQMLSMSQDVRDSEKT
PRISGFGTLLKTQSDAIITQQLVKDKLRATTQNLGSLYMQSPLLNSEPKKALFVQTPRGFFVPLHIANKPGLHASGKPLPLVNTQGVPASLLLNKKPGMILTFNNGKLEG
VSAVKTESAQACGTTTKEPCRPPILKVEPSSNCLTPALCSSIGSCLSMKSSSENTLSLKGPYIIKTPASSSVKAVPTPNTVSEHQGTKLNISDSVKQQNKIFPKPPLYTL
LPDGKQAVFLKCVMPNKTELLKPKLVQNSTYYKNIQPKKPEGTPQKILLKIFNPVLNVTAANNLSVSNSASSASSSQKDNVPSHPATGGEQKEPESSRDALPFLLDDMMP
ANEIVITSTATCPESSEEPVCITDHSEARVLRRKTNCTIERCVNKKKTLKKNFSRIKTHLRSKDSETAFVSRNRNCKRKCRDSYQEPPRKKALHRKCKEKAKPEDISESF
GYSKPRLSKDSVRTLRLFPFSSKQLVKCPRRNQPVVVLNHPDADAPEVVNVMKTIAKFNGRVLKVSLSKRTINALLKPVCCNSSKTICDDFPKRHKTFKPVSSVKERFVL
KLTLKKTSKNNYQIVKTTSENVLKAKFNCWFCGRVFDNQDTWAGHGQRHLMEATRDWNMLE*
21 >lcl|XP_001928333.1|Plus167182..68036 NW_003536312 nanos homolog 1-like LOC100157783 __SEG__ Chr14 {Sus scrofa} MEAFPWAPRSPRRGRVPPPMALVPSARYVSAQGPAHPQPFSSWNDYLGLATLITKAVDGEPRFGCARGEDGGGGGGSPPSSSSSSCCSPHAGAGPGALGPALGPPDYDED
DDDDSDEPGSRGRYLGGTLELRALELCADPSEAGLLEERFAELSPFAGRATAVLLGWAPATAATAEAAPREERAPAWAAEPRLHAAFGAAGARLLKPELQVCVFCRNNKE
AVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPRSVRDGLPGKKLR*
22 >lcl|XP_001928715.1|Plus133036..33773 NW_003536011 tetraspanin-6-like LOC100157741 __SEG__ Chr13 {Sus scrofa} MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIGTGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIV
GFVFRHEIKNSFKNNYEKALKQYNATGDYRSDAVDKIQNTLHCCGVTDYRDWKDTNYYSEKGFPKSCCKLEGCSPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVA
CFQLIGIFLAYCLSRAITNNQYEIV*
23 >lcl|XP_001928761.1|Plus1200092..201156 NW_001886576 membrane progestin receptor beta-like LOC100153743 __SEG__ Chr7 {Sus scrofa} MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFLPAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FILDISPVAHRVALCHLSGCQEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYKGRQEIFLHRHSPLSIYAACLSFFFL
VACSGATAALLREKIKARLSKKDS*
24 >lcl|XP_003121208.2|Plus1complement(508182..508877) NW_003533904 sterile alpha motif domain-containing protein 5-like LOC100522528 __SEG__ Chr1 {Sus scrofa} MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDAAAAGLYFTLEPQPPPVPPGPPAVSVPTRRRGEPCSGPTQGPRG
DPRSQTTAPRGRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVWRRRPGVAGRAAGGDVAQPPLPRLGSPFGRCRGGEDANGCLGFSSVFLLCSLFIPSFLVSPAVR
TSSLTQVLILN*
25 >lcl|XP_003121957.1|Plus1complement(409225..409929) NW_003534113 tumor protein D55-like LOC100518107 __SEG__ Chr1 {Sus scrofa} MNPSHLEAHPTSQKSDPEGLDFNCVGQDYFFSVHELDSFYQELDLDSLNEDLPSQSMPGAMTETSAGKNGSYLTAKPEDLTEVEQKELKSELSKLEAEIVTLRHALAAKE
RRCVELKRKLGLMTLAGLRQNLSKSWHDVQVSNDYMKQKTSAALSTMGSAIRRKLGDMKKSATFRSFEGLMGTIKSRVTGSRELGSDCLPSSAGSGDDPLPVSGSGNDPV
PGNEDNLLPFLEPE*
26 >lcl|XP_003121958.1|Plus1complement(479467..480171) NW_003534113 tumor protein D55-like LOC100518290 __SEG__ Chr1 {Sus scrofa} MNPSHLEAHPTSQKSDPEGLDFNCVGQDYFFSVHELDSFYQELDLDSLNEDLPSQSMPGAMTETSAGKNGSYLTAKPEDLTEVEQKELKSELSKLEAEIVTLRHALAAKE
RRCVELKRKLGLMTLAGLRQNLSKSWHDVQVSNDYMKQKTSAALSTMGSAIRRKLGDMKKSATFRSFEGLMGTIKSRVTGSRELGSDCLPSSAGSGDDPLPVSGSGNDPV
PGNEDNLLPFLEPE*
27 >lcl|XP_003122047.1|Plus1996401..998167 NW_003534138 calicin-like LOC100515522 __SEG__ Chr1 {Sus scrofa} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLISNHDMKTTDELFITIDPNYLSPTTVDHLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRANCLRYLFLAELFELKEVSDLAYSGIRDNFHYWASPEGSLHFMRCPPVIFGRLLRDENLHVLNEDQALQALLSWVYFRKDEREKYFKKFF
NYINLNAVSNKTLMYASNKLMGMENSSAHSTLIESVLVDRKQERPTSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATAAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIFRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTNTGDVVQCITFPIEFNHRPLLSFHQDNILCVYSHRQSVEINLQKIKANKTTTSVPLLPNNCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
YLLDQKTGEWKTLAPPPEALDCPACCLAKLPCKILQRI*
28 >lcl|XP_003122389.1|Plus1complement(155045..156292) NW_003299439 torsin family protein C9orf167-like LOC100514387 __SEG__ Chr1 {Sus scrofa} MDRGQPSPEPAAAAPARGPNVIAPVRAVVRLRRRVCLLRTRRLPTPGAGPDFGPGAPRANLHQPQFFTFEGPAELSSRAPRKRRRRSRVVLYPETSRKYRPQAERRSRAQ
RCLLLLVAIVGFQVLNAIENLDDNALRYDLDGLEKALQRAVFGQPSAVGRIVALLRDYLATHVHSRPLLLALHGPSGVGKSHVGRLLARHFRAVLEDSALVLQYDARHHC
PDPRAAQDCREELAQRVADVVARAEAEEKTPLLVLDEVELLPQALLDELHGFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALALRPDGAHGARAAAMAAQAEE
ELRVRLQALLVREHPLWQAAAIVPFLLLDKRDVVNCFRDEMAGEGFFPEQAHAELLAARLSYYRVAGREFAVTGCKQVVATVNLL*
29 >lcl|XP_003123080.2|Plus1complement(150529..151125) NW_003299505 GTP-binding protein Di-Ras1-like LOC100517263 __SEG__ Chr2 {Sus scrofa} MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGS
VEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSSKQKRTDRIKGKCVLM*
30 >lcl|XP_003123279.2|Plus1complement(1391060..1391881) NW_003534273 f-box/LRR-repeat protein 12-like LOC100513198 __SEG__ Chr2 {Sus scrofa} MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVANLSMVPITSLPSTLRTLELHSCEISMAWLLKEQDPTVLPLLECIVLDRVPA
FRDEHLQGLTRFRALRSLVLGGTYRVTETGLDMGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLLGPLITPEMPTPAE
ILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM*
31 >lcl|XP_003123410.1|Plus11244522..1245706 NW_003299522 uncharacterized protein LOC113230-like LOC100513647 __SEG__ Chr2 {Sus scrofa} MRRASGLNPVPREAPRLWLEGGARSPQGRCRGRCPALPPGAVLGGQGRVREAAGAGDALEPAGGNCGHRCGAGQCVPALGIRALALGVEASELLTTLDPEAPGPESGALG
SSKALGPEPPGSNREIPGPTAERDTEVPRPGGEVPVSSQNQCAETPKQEREVFQPSPGQDAAEGFVSPGPGSDDPEPSEVRGVGLLDQCPSQGCETYSESEAPQLRFLLH
SETPQQPREEPLMETPIEREIRRSCEREESLRRSRGLSPGRAGRELVELRVRPVLSLPGPGPALPRALERARAGAQMQRDIEREAHRQAALARSAVPEQRTRPPPQPLGE
LKRFFETAGWCGSTPAAEGSAGQQRLPEPGGRPRSAVQGRCPVLARAPPPIRAIVAGAGGARGE*
32 >lcl|XP_003123749.1|Plus1complement(37039..38808) NW_003534300 ectoderm-neural cortex protein 1 ENC1 __SEG__ Chr2 {Sus scrofa} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
33 >lcl|XP_003123803.1|Plus1complement(489199..490740) NW_003534308 ankyrin repeat domain-containing protein 34B-like LOC100513200 __SEG__ Chr2 {Sus scrofa} MDEGIEISSDGKSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDHQSVSKAKMVKYLLENNADPNIQDKSGKTALMHACLEKAGPEVVSLLLKSGAD
LSLQDHSSYSALVYAINSEDRETLKVLLSACKAKGKEVIIITTAKSPSGRHTTKQYLNMPPVDMDGCHPPATCATPSEIDLKTASSPPSHSSETEMTLFGFKDLEAPGSS
DDTRDPDSPVRKPGMAPNGPKLPQASHWIKSPPLLMHQNRVASLQEELQDITPEEELSYKTNGLALSKRFITRHQSIDVKDTAHLLRAFDQASSRKMSYDEINYQSFFSE
GNQQCIEIPVDQDSDSNQTIFASTLRNIVQKRNSGANHYSSDSQLSAGLTPTTLEDGKALIGKKKILSPSPSLLSGSKELLENIPPGPLSRRNHALLERRGSGAFSLDHN
ITQTRPGFLPPLNVNPHPPISDINVNKISNLLSCGQKVLMPTVPMYPKEFRSKKMLLRRQSLQTEQIKQLVNF*
34 >lcl|XP_003123823.1|Plus1complement(1188542..1189192) NW_003534312 hypothetical protein LOC100518826 LOC100518826 __SEG__ Chr2 {Sus scrofa} MRARVTRNPGMKPKLHGAWSPWTATRVRAEESRPRSELERGEASGAQSGWGEAREEGPAALLYSPASASSDLTHRLPRDAGGVALQLGGEQFIPLRPIPAHLRVLTLPLP
SLLSTTPSLLDSHLLSLHPLLLLSPPLSPPSRLPSLSPPSPLRISKLLLLKSQVILVCNREREREREREREREREREREREGETSLPRRERSRQEGNLAQRLREET*
35 >lcl|XP_003123975.1|Plus1817380..819101 NW_003534364 ankyrin repeat domain-containing protein 43-like LOC100524137 __SEG__ Chr2 {Sus scrofa} MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNDVAVVKEFDGVKFVVLRKKLRPREGPEPLTTCWNSTPGTLAPPSKIT
SVSQVEAAASGTPSLASEQKAVEPPRDPAPPSESQDTLGAPASEPTLPTRELLLSPALQSGGPSDPQIPTFELSQPSEGLSADVAPPSRAPSEATLTHAEPPDLEPGPRQ
SKGPPPPPSPPPPPPRAPLQKPCMLPVRCVPGPFRIRTEDQGLRRQLSEEPSPRSSPLLLRRLSVEEPGLGLSLGPGRSPHLRRLSRAGQRLLSPDTEEVPAAPPPSAVP
LEPAEHEWLVRAAGGRWTHQLHGLLLRDLGLAAKRDFMSGFTALHWAAKSGDLEMVQQLVEVARRGGARVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVQVRD
HSGRRAYQYLPPGASYALRHLLGDPGLRGSTETDRAGGGSGNLAARRPVQVAATILSSTTSAFLGVLADDLMLQDLARGMRKSGSFSKFLGASPMAPRKKTKTRNSLQAF
SEISRRPTPGPLAGLVPSLPTAT*
36 >lcl|XP_003125054.1|Plus1469481..470194 NW_003534486 probable N-acetyltransferase 8B-like LOC100516363 __SEG__ Chr3 {Sus scrofa} MAPYCIRKYQEKDRKWVLGSFSHLVTEHIPATFCCVLKLPRTLVLLLGGPLALFLISGSWVLALMASASLLGALWFLAKYPWAQFEARCLRTDLSDITKSYFSESGSCFW
VAESEGQLVGMVGALPSKKPTLQKVQLELLHLFVALEHRGQGIAKALVRTVLQFAHDQGYSEVVLTTSIVQCSALVIYQHFGFQKTGFSSEGFRLCALPVLHLTYRLPSA
QVSQTLEQGESPRPISL*
37 >lcl|XP_003125101.2|Plus1<767589..768173 NW_003534488 poly(rC)-binding protein 1-like LOC100526046 __SEG__ Chr3 {Sus scrofa} CLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGTPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWA
SLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS*
38 >lcl|XP_003125105.1|Plus1897012..898082 NW_003534488 poly(rC)-binding protein 1-like LOC100511501 __SEG__ Chr3 {Sus scrofa} MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCG
SLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGTPLD
AYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT
GSAASISLAQYLINARLSSEKGMGCS*
39 >lcl|XP_003125614.1|Plus1complement(530091..533051) NW_003534619 RNA-binding protein 12B RBM12B __SEG__ Chr4 {Sus scrofa} MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGEVGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRMGRDRPGSGAPGVGSLSNFV
EALKEEASNSGYGSPINQDAGFHTNGTGHGDLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVIFLKHHDGRNNGDAIVKFASCIDASGGLKCHRSFMGS
RFIEVMQGSEQQWIEFGGNAMKEDDIPMRTEEHSQPRGINDRHFRKRSHSKSPRRTRSRSPLGFYVHLKNLSLSINKRDLRNFFRDTDLTNEQIRFLYKDERRTRYAFVM
FKTLKDYNTALGLHKTVLQYRPVHIDPVSRKQMLKFIECYEKKRPASIEKEKLGHISQKYSQEGYSGQKLCIYIRNFPFDVTKVEVQKFFADFSLAEDDIYLLYDDKGIG
LGEALVKFKSEEQAMKAERLNRRRFLGTEVLLRLISEVQMQEFGVDFSLVSSERIHDHSQSCDRDDHFHSFDSNDLPVYSVGPSENLRHQQEDLRQLDSFKHSQGDFRLP
DRRPPGDFRHSPEDFRRSPEDFRRLREEHFRRPPEDDFRRPWEEDFRYPREEDFRYPREEDWRRPPEEDFRRPPKDDFRRPPEEDWRRPPEGDFRRPPEEDWRRPPEEDF
RRPPPGEWRRPPEEDFRRPPEEDFRRLPEEDFRRPHEEDFRRSPEEDFRHSPEDDFRRPPPEHFRRPPPEHLRRPPPEHFRRPPQEHFRRPPQEHFRRPPQEHFRRPPQE
HFRRPPQEHFRRPREEDFRHPLDEDFRGPPNEDFGHPPDEDFRSPQEEDFRCPSDEDFRRLPEEDLREAPEEDPRLPDNFRLSGEQFRSPPDDFRSHRPFVNFGRPEGGK
FDFGKRNMGSFPEGRFMPDPKLNCNSGRVIPIKIMNLPFKANVNEILDFFHGYRVIPDSVSIQYNEQGLPTGEAIVAMINYNEAMAAIKDLNDRPVGPRKVKLILL*
40 >lcl|XP_003125680.1|Plus1843002..844120 NW_003534652 LOW QUALITY PROTEIN: histidine protein methyltransferase 1 homolog LOC100153964 __SEG__ Chr4 {Sus scrofa} MPFQFNFTIEDHLEDELIPLEDGALALDFSKESSVSERQKGKHSDKKSSTEQFDLLQDLLWEHQSGGNAAPSQDTDHSLNGTNSLSNLEPYEKKPCLRVAKEHALPKDLK
KVLESKVIETLPGLQHVNISVVKTILLKDNFSGENIISKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGIMAFKGGAKEIHFQDYNS
VVIDEVTLPNVVANSTLEDEENDLNEPDVKRCRKSKVAQELCKCRFFSGEWSEFCKLVLSREELFEK*ISFLPQNHLQS*LLWSFAPNIR*IVR*KWSGAYGQQSTLFWG
GWRYSSLSEVYRGKECI*D*NTRNN**RTKEIPN*NDF*IPQL
41 >lcl|XP_003127039.1|Plus1216413..217261 NW_003534938 e3 ubiquitin-protein ligase SIAH1-like isoform 1 LOC100520614 __SEG__ Chr6 {Sus scrofa} MSRQTATALPTGTSKCTPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP
HTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAEN
FAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC*
42 >lcl|XP_003127051.1|Plus16266..7117 NW_003300067 pleckstrin homology domain-containing family F member 1-like LOC100522869 __SEG__ Chr6 {Sus scrofa} MVDYLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLNKRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFV
VSAASATERQEWISHIEECVRRQLLATGLQPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPKPLRVCSLCFRELAAQKQKEEE
EEEEEEEQGPRVPGQPAYLAGAVCGASSGDDDDSDEDREGGDGDWPSRVEFYAGGVSWSSFHS*
43 >lcl|XP_003127280.1|Plus1complement(146350..146766) NW_003534958 nanos homolog 2-like LOC100512966 __SEG__ Chr6 {Sus scrofa} MQLPPFDMWKDYFNLSQVVLGLIQNRRQGPEAPGTGEPRPEPPLEQDQGPGERGASGGLATLCNFCKHNGESRHVYSSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHT
LKYCPLNGGQQSLYRRSGRNSAGRKVKR*
44 >lcl|XP_003127938.2|Plus1775306..776262 NW_003535045 kelch-like protein 14 KLHL14 __SEG__ Chr6 {Sus scrofa} MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPPLGGGVGGQDGLGAPKDPQQQQQPPQQPPQQQQPPPQEEPGTPS
SSPDDKLLTSPRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNF
EEMRALLDSLPPPVESELALFQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMNYHLMPFRQHCRQSLASR*
45 >lcl|XP_003128015.1|Plus1274271..275242 NW_003300193 tumor-associated calcium signal transducer 2-like LOC100510966 __SEG__ Chr6 {Sus scrofa} MARGPGLALLSLSLLPPLLLLVAVIGHAAAQDNCTCPTNKMTMCERSGPGGRCQCRALGSGLLVDCSTLTSKCLLLKARMSASKSGRALVRPSEHALVDNDGLYDPDCDQ
QGSFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDELVRTHHILIDLRHRPDTRAFNHSDLDAELRRLFRERYLLHPKFVAAVHYEHPTIQIELQQNASQKAAGDVDIA
DAAYYFERDVKGESVFPGRGGLDVRVRGEPLLLERTLIYYLDEKPPQFSMKRLTSGLIAVIVVVAVALVAGVVVLVVTNRRKSGKYKKVEVKELGEMRKEPSL*
46 >lcl|XP_003128391.1|Plus12286046..2287452 NW_003535175 zinc finger and BTB domain-containing protein 9-like LOC100525704 __SEG__ Chr7 {Sus scrofa} MAASTPVPPGAPSPACNPAPRTIQIEFPQHSSLLLEALNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRL
PLDALPAHLLVASGLQMWQVVDQCSEILKELENSGGGLSARAATPFHALLSTTASPGGWCIRSSSFQTPAQASASTESPVVGDGSELGEVLQIQVEEEEEEEEEEEEEGQ
RSAASSQTPQPPRASGSFPRPPGSHTLPTSSTPRRLPEGDSALLEPPAPHTALPPKIFYIKQEPFEPKEEIVGGGTQSGGSKEETGVLPAGDVEGNGELGFLLPSGAGST
SGGGGPSWKPVDLHGNEILSGGAGPGGAGQAVHGPVKLGGAPPADGKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGVCNKRFKLKHHLTEHMKTHAGALHACPHCGR
RFRVHACFLRHRDLCKGQGWATAHWTYK*
47 >lcl|XP_003128985.1|Plus162155..62730 NW_003535351 LOW QUALITY PROTEIN: rho-related GTP-binding protein RhoH-like LOC100513215 __SEG__ Chr8 {Sus scrofa} MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEHYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANYNSFLNLKNKWIGEVRNNLPCTP
VLVVATQTDQREVGPHSGLLRQCRRRQETGRRFTSQGLLGVLSPQQPGGAAGV*VCRPNCRQPSQETQQKEVLPA**VQDPL
48 >lcl|XP_003129143.1|Plus11319562..1321961 NW_003535396 ankyrin repeat domain-containing protein 56-like LOC100523320 __SEG__ Chr8 {Sus scrofa} MARELSQEALLDFLCQAGGRVTNAALLSHFKHFLRDPDAPPGQHQRRRELFKGFVNSVAAVRQDPDGTKYVVLKRRYRDLLGEEGLQRPSDPPATAAPAGGAAPRCPLPA
CPGESLPPQQPRRRRREKEPEEEPAGAAAAAAVPAAGCNGFPASGVREAPRGGGGRRGSSGPQERVPAAVAAAAQARARCAAAETQGRCCWECLQNGLGGLPGQPLPAAL
PDPATTTVTACAGEETAQAPPAQDDRRAPRPQREGAPAEPPPVPAASRSRSTTVEAAESWALSPSLLSCSPAPGDPPELVTRGPLLYSTLQQQQQRTREWVARHPQIPEA
RDRGPIRAWSVLPDDFPRLPPEPGFWVPESKSATPEPPLSSHSVLPAGSESWPGNSPLAVFRSIRCQLSLQDLEDFVDQESHGSEESSSGPKESPGRSDEELHLAPGAPD
GRRLRNTAGDPSPKKGSPNGSSQGLGNAGDGHTSQPLPVGADGLEGHPQQPLPWPVPRLRRSLRRSSRAGRARLSSSDEECLEEDLLKRSRRPPRSRKPSKAGAVSSLRV
DAALTSKLVDIKAATEQGPPHSPWALGGERPAAFVHHRSSEHKSSLVPLDAREHEWIVKLASGTWNQALTLFWQDPQLALHKDFLTGYTALHWIAKHGDLTALQDLVSGA
QKAGIALDVNVKSGCGYTPLHLAAIHGHQAIIRLLVQRLSSRVNVRDSSGKKPWQYLTSNTSGEIWQLLEAPRGKPIFPTQPLVRNSSPTRKAKSREISRSVTRKSSFAA
LLKSQHNKWKLANQYEKFPTPREREEYSD*
49 >lcl|XP_003129498.1|Plus119654..21495 NW_003535487 ubiquilin-like protein-like LOC100517175 __SEG__ Chr9 {Sus scrofa} MPHVITRTPRTAQGGRPARLPADKSSSSSVTQVIIKTPGKQENFTIADDTSVRQFKEKLSAHFKCQVDQLVLVFMGRLLKDHDTLSRRGVLDGHTVHLVIKSKHGSRSLA
HSTRNPSTKDPSHQDRTRQGNSTGVDQPASVGHSPVEPALSAEPDVPKAHTRDQDVGRPEHLTQILENASTQRLLSNADLMRQFISEHPDMQQLMQQNPEVSHILDSSEL
LRQTLELARNLAVIQEIMQIQQPAPSREHPLNPQSCVGLESIPRVQTSPGQGSADFSDEVLNPSQDPFGGNPFTALLGGQVPGQVQSSPPSPPPQEWGEQLPQLPTTRVI
YASSRAFSSVTPASATPDKSHHTSRAFTSTNSTNSRSHTGTVEKPAGVSVLPSVEVTQQPQAEDKDATISLDSSGQKLEDALQLSDEQSSSPITGSLMQLLLNNPSLAAQ
MMLCVSMPQLSQQWQQQLLAFLQQTQLSETLIALGNPKASQAILQIEQGLQLLATEAPVLLPWVAPYLWGLGWLPAPSCSYPDTVPWAWDTPDMAKPNGPEACHKSGTVL
QRLQSLAGDPAHLLQAPEIRFSKQMESLRAMGFGNQHANLQALIATEGDSSAAILRLRRSQAF*
50 >lcl|XP_003129502.1|Plus1113721..115562 NW_003535488 ubiquilin-like protein-like LOC100517904 __SEG__ Chr9 {Sus scrofa} MPHVITRTPRTAQGGRPARLPADKSSSSSVTQVIIKTPGKQENFTIADDTSVRQFKEKLSAHFKCQVDQLVLVFMGRLLKDHDTLSRRGVLDGHTVHLVIKSKHGSRSLA
HSTRNPSTKDPSHQDRTRQGNSTGVDQPASVGHSPVEPALSAEPDVPKAHTRDQDVGRPEHLTQILENASTQRLLSNADLMRQFISEHPDMQQLMQQNPEVSHILDSSEL
LRQTLELARNLAVIQEIMQIQQPAPSREHPLNPQSCVGLESIPRVQTSPGQGSADFSDEVLNPSQDPFGGNPFTALLGGQVPGQVQSSPPSPPPQEWGEQLPQLPTTRVI
YASSRAFSSVTPASATPDKSHHTSRAFTSTNSTNSRSHTGTVEKPAGVSVLPSVEVTQQPQAEDKDATISLDSSGQKLEDALQLSDEQSSSPITGSLMQLLLNNPSLAAQ
MMLCVSMPQLSQQWQQQLLAFLQQTQLSETLIALGNPKASQAILQIEQGLQLLATEAPVLLPWVAPYLWGLGWLPAPSCSYPDTVPWAWDTPDMAKPNGPEACHKSGTVL
QRLQSLAGDPAHLLQAPEIRFSKQMESLRAMGFGNQHANLQALIATEGDSSAAILRLRRSQAF*
51 >lcl|XP_003129503.1|Plus1118408..120366 NW_003535488 ubiquilin-3 UBQLN3 __SEG__ Chr9 {Sus scrofa} MARSGEALPQGSPAPVPDPHLIKVTVKTPKDKEDFSVTDTCTIRQLKKEVSQRFKAHPDQLILIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTVGAECPAASAPGP
AAPSPGPLPQPSSIYPGDGPSPFSVGVLAGLQGLGLTSGSFPDQPSSLTGQQVSTPGFVAQITDDPFIQGLLSNTGLAHQLVLDNPHVQQLIQHNPEIGHILNNPEIMRQ
TLEFLRNPAMMQEMMRSQDRALSNLESLPGGYNVLRTMYTDVMDPMLNAMQEQFGANPFAPTTMAKATTSSSQPSRTENRHPLPNPWASTCAGSGGRRGGRPEDRDVSEP
RTRVPNILGHLGLCDPLQQLHETPLSLGTYLQGMASALSPSQEPPLPPQGSQPPPTSPSSQESGSGQAPPRESVAVKGKPTCPGFLRYPPERGPRKDGDRSGAGNGSTLP
DLVSGLGRAANRAPCVPSPPSPMAATAGIPEHAWWPPPAYPRSLRPDSMSQVPQLQDEMHWQLPLLLHLQAAMANPRAMHALLQIEQGLQILATEAPHLLLWFMPCLAGL
GSMAGGAEPREGTLLPDDPPTPAAPGVSSTQDTELGLHPPPFLQILQALAGANSQQLPPETPFRVQLERLRAMGFLNPEANLQALIATGGDVDAAVEKLRQL*
52 >lcl|XP_003129684.1|Plus1complement(700966..701220) NW_003535496 coiled-coil-helix-coiled-coil-helix domain-containing protein 8-like LOC100514530 __SEG__ Chr9 {Sus scrofa} MSTQGHTWSRQVKKEDEEEDPLDQLISRSGCAASHYAVQECMAQHQDWRRCQPQVQAFKDCMNDQQARRREELQRRKEQSSAHR*
53 >lcl|XP_003129795.1|Plus1complement(238501..239715) NW_003535519 putative upstream-binding factor 1-like protein 3/5-like LOC100523854 __SEG__ Chr9 {Sus scrofa} MTLSQGQGDWSKEDVEKLLERMEKNLPSNDSHTFKTAQSLMDWEKVAFKAFSGQMCKQKWLEISYNLRKLRTLSELVLEAKENVHSSHKSRKLEKHPDFPKKPLTSYIRF
FTEMRPQYLQKHPQLSNQELTKVLSEEYKKLPEQMKLKYTQDFQKEKQEFEEKVAQFKEQHPDLVRKSRKSAVPKGSQSRLQGNVQKVRSPPRNKVSMTMKFHGEPKKPP
MHGYHKFHQDLWSSWQLKGLPYWQRMVEIGRLWQRVPQNEKEHYKKQAEQLQKQYKVDLDLWLQTLSPEEYAAYRERTCSKRKNMSMPGGPDPKIRKMDLQSPSAGNLQG
GLGGDQGLRETESSDTIGENVSQASEEQKDLKEREEGRNSSDSNRDEDEDGVVEGSGDEDEYCDVQHSGPNSHS*
54 >lcl|XP_003130568.2|Plus117994..18266 NW_003300682 serine/threonine-protein kinase MARK1-like LOC100519726 __SEG__ Chr10 {Sus scrofa} MKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL*
55 >lcl|XP_003130633.1|Plus1272336..273484 NW_003535665 zinc finger and BTB domain-containing protein 41 ZBTB41 __SEG__ Chr10 {Sus scrofa} MKKRRKVTSHLEKIHLGYHKDSSDGNVAAECEQITCTHSTERPAPDTLRCYQELPPSPDQRTLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGS
SYFHACLSKNPSADVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVATFQSELTEKSSPEETLSELTGRLSNNHQCKFCSRHFCYKK
SLENHLAKTHRSLLLGKKHGLKMLERGFSARRPKRNRKCPVKFDDTSDDEQESGDGSDNLNQDHFDKEKSDRNDSEDPGSEYNAEEDELEEEMSDEYSDIEEQSEKDQND
AEEEPEAGDSVGSIHEGLTPVVIQNSNKKILQCPKCDKTFDRIGKKKLVSSL*
56 >lcl|XP_003131043.1|Plus1105185..107227 NW_003535777 kelch repeat and BTB domain-containing protein 7-like LOC100511833 __SEG__ Chr11 {Sus scrofa} MQSREEASRSRRLASPRGGRRPKRISKPSVSAFFTGSEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESHQT
NVTMHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLA
QLLAVLRLDSLDIESERTVCHVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDKDREYLEGLLTKPIVKKYCLDLMEGVLQMRYGDMLYKSLVPKPESSSGNSVVSIAENP
PQRLGMCAKEMVIFFGHPRDPFLCYDPYSGDIYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRD
PVTGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNYLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWRRISNIPLDS
ETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLLQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFTD
DEVWVQVAPQRNAQDQQGSL*
57 >lcl|XP_003131079.1|Plus1complement(249177..250157) NW_003535808 BTB/POZ domain-containing protein KCTD12-like LOC100524761 __SEG__ Chr11 {Sus scrofa} MALADSTRGLPNGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERS
RLQREAEYFELPELVRRLGAPQQPGPGPPPPHSRRGVQKEGSLGDELLPLGYAEPELQEGASAGAPSPTLELSSRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYT
IGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSEAGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE*
58 >lcl|XP_003131105.1|Plus1394847..395167 NW_003535832 CDGSH iron-sulfur domain-containing protein 1-like LOC100520401 __SEG__ Chr11 {Sus scrofa} MSTTSSLRVEWVEADTIAAGTAAAGYLAYKRFYVKDHRNKSMVNPHIQKDNSTVVHAFDREDLGDKAVYCHCWRSKKFPLCAGSHIKHNEETGDNVGPLIVKKKDT*
59 >lcl|XP_003132029.1|Plus1complement(81598..83370) NW_003300967 major facilitator superfamily domain-containing protein 6-like LOC100514186 __SEG__ Chr12 {Sus scrofa} MSANPQWDISRALWVARLFHLVCGVRDACVTPFLTLYLRQLGLAAPWVGILMGTKHLIATFWAPFCAFLAKSYQKRRVLLIGSLLGSVGASLLMVLVPPLDRDRPCNGSH
SVTVTVLPPGVALTVNVTSTPEPASNRPAGGPRRPAQRGTGVAGADGFRGRPGESGRESVSHLPGYSLGSVHGARTTSGVLHPTSSGVTGTPGAAAFSVVSTAVPLHAGG
TALASPANQSAAKGNAQALDLSLEGLRWPFLLSLGSLVFWELLSAPLEQVADDSLYEYLDFVDATDRYRSLWLWRLLGTSVGVCGIAALVGKLDCLLVTKGPRGVVHFYG
YALVSTVALLVSTAFPVPLCRRREPSYRTGKALSLVGGDARLILLALTVLLIGAATSAVQNFLFWHMKDHGSSELVMGFSVALGLLGEILLHPFKTPLLRKLSKVGTVGL
GLGCLAGQLLYYSFLWSWWSVLPVQIFSAISHGALWWAVGASIEDLATPGTERPLHAMFRGHFYGGGASLGSFVGGFVGMRFGLAVLYQACCVVLWLWLALFLSIRPRLP
RERKINYSKLLAVEASDTSDSEQGTERDWLVKAMRDEPSD*
60 >lcl|XP_003132286.1|Plus11483944..1486625 NW_003535962 putative RNA-binding protein 15B-like LOC100519215 __SEG__ Chr13 {Sus scrofa} MKRQSERDSSPGGRGSSSSAKRPREREREAEAGGRRAAHKASGGTKHPVPTRAREKPRGSGGGGGGHRDGRGAGDANHRASSGRASGSGAGGGGRGGKASGDPGASGASP
RASPLPPPPPPPGSEPAGPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPELGRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLR
GGGGGGGSSRRSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDL
MPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALARE
FDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLPDGYTRHRNLDADLRVRDRTPPHLLYSDRDRTFL
EGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGGDGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGGGQQADRGSDRTPERSRKENHSSEGTKELSGNSLSNS
RHGAEERSHHHHHEAPDSSHGKKTRESERNHRTTEAETKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISGLLKDHTSGSKLTQLKIAQ
RLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATPSGPGTEGMPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLYAFPPCDFSQQYLQSALRTLGKLE
EEHMVIVIVRDTA*
61 >lcl|XP_003132509.1|Plus1387802..388935 NW_003536013 progestin and adipoQ receptor family member 9-like LOC100516760 __SEG__ Chr13 {Sus scrofa} MPRRLQPRSAGTKGPPGMTAAASEAASRSHPSASGDPAASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGR
DVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYVQQRLGWHVDCTGLIAAYRALVLPVAFVL
AVACTVACCKSRTDWCSYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVE
EGLRQFLKAPPDAPTFCGTVGYMLLLVICLGLVIKKFLNNSEFCSKK*
62 >lcl|XP_003133518.2|Plus1239630..240355 NW_003536436 pyridoxal phosphate phosphatase PHOSPHO2-like isoform 1 LOC100152929 __SEG__ Chr15 {Sus scrofa} MKILLVFDFDNTIIDDNSDTWIIQCAPEKKLPIELRDSYKKGFWTEFMGRVFKYLGDEGVREDEMKRAMMSMPFTPGMLELLNFIRKNKDKFDCIIISDSNSVFIEWVLE
ATSFYDVFDEVFTNPAAFNSSGHLTVENYHAHSCSRCPQNLCKNVVLVEFVGKQLKQGVNYAHIVYIGDGGNDVCPVTFLKKNDVAMPRKGYTLQKTLSRMSQNLEPMES
SVVSWSSGIEIISHLQFLIKE*
63 >lcl|XP_003134983.1|Plus12641061..2641666 NW_003536748 ras-related protein Rab-9A-like isoform 1 LOC100513057 __SEG__ ChrX {Sus scrofa} MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYAD
VKEPESFPFVILGNKIDISERQVSAEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRADHLIQTDTVSLHRKPKPSSSCC*
64 >lcl|XP_003135039.1|Plus1941460..943274 NW_003536763 DDB1- and CUL4-associated factor 8-like LOC100515809 __SEG__ ChrX {Sus scrofa} MADDESSTDGPPDLENRGLSDHPEESSGVEAGREACPDTEIILSVTRGGGDFGSGGIPEHASTENQGTSSERSSEDIDIECVEDADNFFINDENQFHYREEEELREEEEF
GEEEQEELAEEQPQVQCGEANHGECLSAEDQALEEWVSSETSALPLPRWRVLNALRERQLGSSARFVYEACGARVFVQHFQLQYGLEGHNGCVNTLHFNQRGTWLATSSD
DLKVILWDWVRQQPVLVFESGHRNNVFQAKFLPNCGDPTMAMCARDGQVRVAELSAIPHCKNTKRVAQHRGAAHKLALEPDSPFKFLTSGEDAVVFAIDLRQGRPASRVV
VTKDKEKKVGLYTVCVNPADTYQFAVGGRDQFVRIYDQRKIDENENNGVLKKFCPHHLVSCDSTANITGLVYSHDGTELLASYNDEDIYLFNSSHCDGAQYVKRYKGHRN
NATVKGVNFYGPRSEFVVSGSDCGHIFLWEKSSCQIVQFMEGDKGGTVNCLEPHPYLPVMATSGLDHDAKIWAPTAKTTTGLIGLKNVIKKNKQERDEDSLHHIDLFDSH
MLRFLMHHLTQRGHHQHWRSPEVGVMDADLDESSSTSDTSEEEDNQDEMQCLPS*
65 >lcl|XP_003135184.1|Plus1260120..262552 NW_003536790 zinc finger X-linked protein ZXDB-like LOC100511114 __SEG__ ChrX {Sus scrofa} MEIPRLLPARGTRQGGGAGSPGGGGRIHGGPDPRAGQAPARRLLLLRGPQDGGSGRRREEARAASSGPGQSPSAPRPDRGSGGGGSGGGDDFFLVLLDPVGGDVETAGAG
QAAGPVWREEAGLGPRLQGGESGANPEGRPALGPSCLSVIPAPVPALAPIPAPGLGPAAAFAGTVTIHNQNLLLRLENGVLTLATPPPPAWAPGVAPTPQPRGLIAPQAG
IPHAAQPGDCPELPPDLLLAERAEPAPAPAPEAEAEGPAAAESPRGPPGPGQGVVLYLCPEAQCGQTFAKKHQLKVHLLTHSSSQGQRPFKCPLGGCGWTFTTSYKLKRH
LQSHDKLRPFGCPAEGCGKSFTTVYNLKAHMKGHEQENSFKCEVCEETFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFSCSFPGCSKQ
YDKACRLKIHLRSHTGERPFLCDFEGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSLYIHSKKHLQDVDT
WKSRCPVSTCNKLFTSKHSMKTHMAKRHNLRQDLLAQLEAANSLTPSSELTSQGQNDLSEAELVSLFSDAPGNSSAAVLDTALVNSGILTIDVASVNSTLAGNHVPASNN
NSLGQAVDPPALMATGDLPQSLDTSLFFGTTAAGFQQSPLDMDDVSTLSVGTLGSLGSLAMKNSSQEPQALTPSSKLTADTDALTPSSTLCESSVSELLPPTKTEWNVHP
DSDFFGQEEETQFGFSNPAGNHGSQKETDLITVTGSSFLV*
66 >lcl|XP_003135186.1|Plus1185428..186936 NW_003536790 germ cell-less protein-like 1-like LOC100511853 __SEG__ ChrX {Sus scrofa} MGLLNSRILRCRESDTAEPQQLEAQAGPSYVFGSRKRKEKSGPCLGPESENNYGFLDQEDDLQKVVSTSQGKKVKIASEYAYQTLFLNGENSDIKIRALGKVWCLHKMFL
CQLDYFDTIFRGSWKESPKDIIDLEINDQYINVESLHFVLGSLYKDECVSMEPLQVPGVLATACLLQVEDLIQQCNETMKETINVKTVCGYYAAAETYGLDSVKTGCFEW
LLHNLMTHPSVELYKDLSTDLMNLLISSSNLLVMQKEMDVYTTLKEWMFLRLNPAWNGSMKQLLVNANNWFSRHREGVGNTAFLETNQGIVFQPVFKNLRFQHIICDLAS
ARVIEQDALIPSKWLSSVYKQQWFTLLRAQQFSEIGPRDINETELEEYSMRCGKRIVKDGKYSWKWSGYNFGFPLHVIFTSHYIIFKQNTFSQPYDGSTCLQNLRNIAFR
LTLVYFDSSGKLSFRKTTGYKILTFERDEEQVVMKLDSIALSFPLYIFCNFLFISLENPGNR*
67 >lcl|XP_003135221.2|Plus1677862..678437 NW_001886637 rho-related GTP-binding protein RhoG-like LOC100153418 __SEG__ ChrX {Sus scrofa} MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQTSVDGQIVSLNLWDTAGQEEYDRLRTLSYPQTNIFVICFSIGNPSSYANVRHKWYPEVSHHCPNVPV
LLVGTKRDLRSDLETVKKLKEQSLVPTTPQQGTSLAKQVGAVKYLECSALMQDGVHEVFSEAVRAVLYPATKKNTKKCVLL*
68 >lcl|XP_003135320.1|Plus1complement(598591..599196) NW_003536831 ras-related protein Rab-9B-like LOC100525674 __SEG__ ChrX {Sus scrofa} MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYAD
VKDPEHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTVDLNSGSKAGSSCC*
69 >lcl|XP_003135335.1|Plus1complement(779319..780239) NW_003536831 mitochondrial carrier triple repeat protein 6-like LOC100514813 __SEG__ ChrX {Sus scrofa} MGEQNHSPGKELQPWTRTEAPGKKSWHPQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAVAVSQAIRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYENLLCSLCPVG
PHSLGHRCTAGLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFHSYGLWGRLSMGYYRGFWPVLLRNSLGSALYFSFKDPIRDSLAEQGLPHWVPALVSGSV
NGTITCLILYPLIVLVANMQSHIGWQSMPSLWASAQDVWDTRGRKVFLIYRGGSLVILRSSVTWGLTTAIHDFLQRRARSRKELKD*
70 >lcl|XP_003135382.2|Plus1complement(1684988..1687006) NW_003536841 transcriptional regulator Kaiso isoform 1 ZBTB33 __SEG__ ChrX {Sus scrofa} MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTPQDGNAETLPPGSSDKNLEIQKSKDEAQDNGATIMPIITESFSLSAEDYETKKIIVTDSDDDDDDVIFCSEILPAKETLPSNNAVAQAQPN
PGSVAISDVAPCASSSSPPLTSITPPQKLPTSVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLTNPPNVSSSLPNHMSPSINLLVPNQQPPNNAVLTGNKANEEE
EEEIIDDDDDTISSSPDSAVSNTSLVPQAEIPQNTTFDGSLIQKMQVPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLTEGQKIITLDTATEIEGLSTGCKVYANIGED
TYDIVIPVKDDPDEGEARLENEIPKTSSSETANKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRY
QCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSGTMPVMKDDGIGYKVDAGKEPPVGTTSAPQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY*
71 >lcl|XP_003135391.1|Plus1complement(49124..50089) NW_003536842 ankyrin repeat domain-containing protein 58-like LOC100515700 __SEG__ ChrX {Sus scrofa} MAEPQGAAKRTPKASLAPTALNLRSAPQPRPSRADTGSLGRYRGNAAASREPPFHGSLMLSATGSGRRREGLRELLGLQGAAPAGWPSEERSEEPSPSGPNGPGGSGLCL
EPREHAWILAAAEGRFEALQELLKAEPGLLLRGDPITGYTVLHWLAKHGRHEEIILVHDFAQRQGLQLDVSAPGSGGLTPLHLAALQGHDMVIKVLVGALGADPTRRDHS
GHRACHYLRPEAPWSLRELSGAEDWETGGGGGGSERNNANNNSSGGGAAWTLRRAPSAVGAPATETTARAAAAPAKKDSMGSRMAQVQGFLRHMFPFFQDR*
72 >lcl|XP_003353631.1|Plus1complement(876801..877376) NW_003534139 mitochondrial carrier triple repeat protein 1-like LOC100624707 __SEG__ Chr1 {Sus scrofa} MMDSEAHEKRPPILTSSKQDISPHIANVSEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLR
KHSSTPEFATRSMAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIREYYRGLVPVLFRNGFSNAIKQ*
73 >lcl|XP_003353879.1|Plus1complement(520161..520754) NW_003534209 rod outer segment membrane protein 1-like LOC100622323 __SEG__ Chr2 {Sus scrofa} MAPVLPLVLPLQPRIRLAQGLWLLSWLLALVGGLTVLCSGHLLVQLWHLGTFLAPSCPFTALPRVALAASAVALGTGLVGSGASRASLDAAQYPPWRGVLSPLLVAGTAG
GGGLLVLALGLALALPGTLDTGLEEGLGTAMAHYKDTEVPGHCHAKRLLDELQLRHHCCGSHGYKDWFGIQWVSNRYLDPNDQDVVE*
74 >lcl|XP_003354083.1|Plus1381911..383614 NW_003534271 LOW QUALITY PROTEIN: zinc finger protein 358-like LOC100511368 __SEG__ Chr2 {Sus scrofa} MRRSVLVRNPGHKGLRPAYKELDSDSEDLDPNSEELDPVSGNPEPDPEDLNTVSEDVDPSYEDLEPVSEDLDPDVEAPSSISGTRDSDPQDLDPMSSSFDDPDVIGPVPL
VLDPNSDTLSPSAAPDLDPLSSDLTATPEVLATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACG
KAFGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPH
CGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAAAAGLGLSPASMLRPGQVSLLGPD
AVSVLGSGLGLSPGPSSSLDPDPGSVLGSLPKPSPKPLPGSGSTPTSDSVKSSDPKPGRNASSDLVANPDRGSGPSPGPDPVPSPDPNSKSHPDPTSPTP*HCQPSPPYW
REPRVGAGARGTAGA*WL
75 >lcl|XP_003354347.1|Plus1complement(118132..119139) NW_003534373 pro-neuregulin-2, membrane-bound isoform-like LOC100626493 __SEG__ Chr2 {Sus scrofa} MRQVCCSALPPPPLEKARCSSYSDSSSSSSSSERSSSSSSSSESSSSRSSSSSNSSISRPAAPPEPRPQPQPQPRSPAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVS
LACYSPSLKSVQDQAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCAPLERNQRYIFFLEPTEQPFVFKTAFAPLDTNGK
NLKKEVGKILCTDCGESPPPSAGERGEGRAGGEWGWGGRCCRCPGLAAPSRWGVGPPLGRALGVLGEGFGVGEKEEQAPSVAGLGPGRGKALACASRDLRLMYGLWGWKA
AILAQ*
76 >lcl|XP_003355304.1|Plus1complement(1064546..1067425) NW_003534689 putative RNA-binding protein 15 RBM15 __SEG__ Chr4 {Sus scrofa} MKTAGRDPLPRRSPRWRRAVPLCETSAGRRVNQLRGEDLRRPATMKGKERSPVKPKRSRGGEDSTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSR
EYETGGGSSSSRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGGEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFV
NFRRPEDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDSYPPSASVVGSSVGGHRHPPGGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRELER
ERDYPFYERVRPAYSLEPRVGAGAGAAPFRDVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKII
IRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPLPLTHYELV
TDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAATAVPAYEPLDSLDRRRDGWSLDRDRGERDLPSSRDQPRKRRLPEESGGRHLDRSPEN
DRPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLLERPSPVRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTASTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQ
KQDGGTAPAAAASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGNSDSRSSSSSATS
DTATSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGAS*
77 >lcl|XP_003355417.1|Plus1229720..230877 NW_003534737 mTERF domain-containing protein 3, mitochondrial MTERFD3 __SEG__ Chr5 {Sus scrofa} MLWKLLMRSQPCRLCSFQKMLSAPKYRPFLASFTYTTDNQSNKENKMTVEKLYKLSVDIRKIRRLKGWVLLEDETYVEEIADILQQLGANQTAVASILERCPEAIICSPT
AINTQRELWQLVCKNKEELVKLIEQFPESFFTVKDQENQKLNVQFFQELGLKNVVISRFLTTASNIFHNPLEKNKQMIKILQESYLNLGGSEANMKVWLLKLLSQNPFIL
LKSSAAIKETLEFLQEQGFTNFEILQLLSKLKGFLFQLCPRSIQNSMSFTENAFKCTDHDLKQLVLKCPALLYYSVAVLEERIQGLLKEGISITQIRETPMVLELTPQIV
QYRIRKLNSLGYRVKDGHLAHLNGTKKEFEENFGKIQAKKGRPLFNPVAPLDVEE*
78 >lcl|XP_003356118.1|Plus1151169..151687 NW_003534965 zinc finger protein 580-like LOC100627967 __SEG__ Chr6 {Sus scrofa} MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKTEGPSSSPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSH
RVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH*
79 >lcl|XP_003356216.1|Plus1400919..403309 NW_003534986 kelch domain-containing protein 7A-like LOC100622416 __SEG__ Chr6 {Sus scrofa} MLPRGGGAEAQDWHLDMQLTGKVVLSAAALLLVTAAYRLYKSRPAPAPLGGRNTKAGKETEGSGQPAGQGAVSRLPQQGLKRRRGSKGAGVPRGCSWENPGGSGVLATEV
PSKDSEAGETGKSETEGAGEEHGRQCPDADLAKTPRGGREARTPVGGKPELSNCPALCSEPQSSPTGLIAVDSGHGVGGKPPPWQESGPPEQPGPGGLESPHQGWVAHTE
GKSDMNKSWVFTHVTGVHREEAGALRAASDVDLALYQQQGATDASYTFSSVARVRVEENFIAAEKAEGIRPRLKGKVYDYYVESTSQATSRDRLAPRTAALAESPPPVSV
PGPPGTGAASGGQADDRAGRAETTAPLPPVLPSSTQGFSRKESLLQIVENPELQLQLDGFGDRALACPDQSALLRCPISSESLGSSSAGSSEKPQVHAVAGTNFFYVPLI
PGSAPDVHLDLGNCYEVLTLAKRQKLEALKEAAYKVMSDNYLQVLRSPDIYGCLSGAERELILQRRLRGRKHLVVADICPQEDSSRLCCYDSEQDAWHPLARLPPEAVSR
GCAICSLFNYLFVVSGCQGSGHQPSNRVFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLYTVERYDPRLDRWTFAPPLPNDTFALAHTATACAGEIFVTGG
SLRYLLLRFSAQEQRWRAGPTGGGKDRTAEMVAVNGFLYRFDLNRSLGISVYRCSASARLWYECATYRTPYPDTFQCAVVDHLIYCVGRQRILCFLADSVSPRFVPEELQ
NFPSPQGTLVPTVLTLPGPDVPQTRV*
80 >lcl|XP_003356690.1|Plus138350..39414 NW_003535193 membrane progestin receptor beta-like LOC100620575 __SEG__ Chr7 {Sus scrofa} MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTL
PLLLYVLSSITYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFLPAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLA
FILDISPVAHRVALCHLSGCQEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYKGRQEIFLHRHSPLSIYAACLSFFFL
VACSGATAALLREKIKARLSKKDS*
81 >lcl|XP_003356714.1|Plus1516128..517282 NW_003300254 UPF0580 protein C15orf58 homolog LOC100156697 __SEG__ Chr7 {Sus scrofa} MAGTRDSNETSYLLPPDSKDWEGHGIPDFVYRQKELVPEGIQWPKNAPSLLDTLPLSRFDSALCSAWRQRMELGLFRYHLGELQTQTLPGAVGFVAQLNVERGVQRRRPQ
NIRSVRQAFDPEQFNFNQIRPGEVLFRLHPAPIPGALQQEDILVVINVSPLEWGHVLLVPEPARGLPQRLLPGALRAGVEAVLLSSHPGFRVGFNSLGGLASVNHLHLHG
YYLAHRLPVEGAPSEPLDPKGRLHLLQAPPAPGFLFYTSGPGPSLEALISRVCRATDYLTDHDIAHNLFVTRGSPPGKTSSSSTLTGVRVILWARKSSFGIKDGEAFNVA
LCELAGHLPVKTSQDFSSLTEAAALAIIQDCLLPPAQAEEVQAALVALTAQEEP*
82 >lcl|XP_003356781.1|Plus1complement(32846..34615) NW_001886521 ectoderm-neural cortex protein 2-like LOC100621005 __SEG__ Chr7 {Sus scrofa} MSVSVHETRKSRSSTGSMNITLFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLFPSNCLGMMLLSDAHQCRRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELEAEDERVVFEAILQWVKH
DPEQRKAHLPELLRGVRLALLPSDCLTEAVSGEALLMADERTRLIVDEALRCKTRILQNDGVVTSPCARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYNTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGVFPASPSVSLKQVEKYDPGANKWTMVAPLRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCYDPSENRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITTVPYSLIPTAFVSTWKHLPA*
83 >lcl|XP_003356905.1|Plus1complement(44128..47385) NW_003535323 zinc finger protein 518B-like LOC100624699 __SEG__ Chr8 {Sus scrofa} MQIKKMKDIGQQLYSPQVSDGRTSLTMSPKQPNANRATRPDGQDAPTVLYQGSEAEAAAVTVATCAKCRSVHEIPLQELKKGAGQSQKEDKYICFKCSLGAAPPQFHFLN
SNRGAAHVGDRTESVSSSVGNKFKVRNFKPGKYYCDKCRFSTKDPLQYKKHTLQHEEIKFICSHCSYISYTKGEFQRHLVKHTGIFPYQCEYCDYGAIRNDYIVKHRKRV
HEKAGGKRLPKTVTKLEPKRVGAAKPHPELFKAPGPRTAFQNKLSDQLSRFSLHAHKDRTHNIMLLPESKEPQKDVVCVPNRATPSGPSDVGLLENKSVEVEVLSPAKEP
VQPGMPLTVVAPAELVVPANCLAQLIDVKVVNGTQQLVLKLFPLEENSRLDAGGGDGGPCQRAARERGSKEHDEMVSGGDQTKSLTVAGDVGRLAGIDELHASVQKQLKN
VKWVRSYDFFMSNSSTHGAGELLLNPGGVEELQKRRYMYPHRTALPSAAFRGHSPSSLVRSSLLSGLGAAASAFPYKAAVSFPDAGRRVRGDSRHLFPLAAASAAISFSG
EKDLPPARKNDLEARGAISIPVKMVPPNRKPRENQAQDPRAVSDVGPVSPQPKGEYLHINITGEERLRPPQPGEKPLELKNPERTQDPFDGPVISSVFSLSSGSENVPEG
VKWNSSTSKIKSIELLRRKIAQLIESCGKPSPPAASGAHRRSVGKAAKGAAAAAADGIREISVSFAGPGFPTGAVPRPQGEGGAGGDGQPAPRQVYPQVVEGGSGRAEGR
GARKPQGAPPVLLPKGAVLRFLNSSEDSRVIEATCEAPVSLSGSETHVARPVPFRPGKQTDAESRALPGESGLADTCPGLDLAPRPKPRRESADGGSAPRRPGPPHGPQG
SGEVSKQGRLFSRSLPVSKSKPRHVNSSKKKSKMQADPSRYFRDPSIFQVARQLRLIAAKPDQLIKCPRRNQPVIVLNHPDVDSPEVSNVMKVINKYKGNVLKVVLSERT
RCQLGIRRHHVRLTYQNAEEANQVKRQMMLKMKLKKVHKNNYQVVDSLPDDSSQCIFKCWFCGRLYEDQEEWMSHGQRHLIEATRGWDALSSKGK*
84 >lcl|XP_003357351.1|Plus1415649..416920 NW_003535543 zinc finger and BTB domain-containing protein 16 ZBTB16 __SEG__ Chr9 {Sus scrofa} MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILE
IEYLEEQCLKILETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAAQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGALQP
PAGPEEPTLAGGGRHPAVAEVKPEMMQVDEVPSQDSPGAAESSISAGMGDKVEERGKEGPGTPTRSSVITSARELHYGREESAEQLPPPTEAGQGPPGRPEPPAPPAEKH
LGIYSVLPNHKADAVLSMPSSVTSGLHVQPTLAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRSVGEQCSVCGVELPDNEAVEQHR*
85 >lcl|XP_003357899.1|Plus1complement(20783..21562) NW_003535768 BTB/POZ domain-containing protein KCTD4-like LOC100623554 __SEG__ Chr11 {Sus scrofa} MERKINRREKEKEYEGKHNSLEDADQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLL
AQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTL
ETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK*
86 >lcl|XP_003357946.1|Plus1177633..178646 NW_003535839 abhydrolase domain-containing protein 13-like LOC100626325 __SEG__ Chr11 {Sus scrofa} MEKSWMLWNFVERWLIALASWSWALCRISLLPLIVTFHLYGGIVLLLLIFISIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVRLNLILIRYTGDS
SPYSPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFL
SIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEEMAKT
SSNVTII*
87 >lcl|XP_003358137.1|Plus1complement(86982..87860) NW_003300918 phosphoethanolamine/phosphocholine phosphatase-like isoform 1 LOC100621753 __SEG__ Chr12 {Sus scrofa} MCQRLWPWPANQPLPGRLPPRLPSLAPSSSSCSSLPCSQDEGRMAVQGSPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPDSLRATYREGFYNEYMQRVFQYLGEQGVR
PRDLRAVYEAIPLSPGMSDLLQFVSKQGACFEVILISDANTFGVESALRAAGHFSLFRRIFSNPSGPDARGLLALRPFHTHTCARCPANMCKHKVLSDYLRERAHDGVHF
ERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQQVLKTC*
88 >lcl|XP_003358289.1|Plus140449..41147 NW_003535913 BTB/POZ domain-containing protein KCTD11-like LOC100520099 __SEG__ Chr12 {Sus scrofa} MLGAMFRAGTPMTPNLSPQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASRGTPAPTAALLHADVESSPRLVHFSARRGPH
HYELSSVQVDTFRANLFCTDPECLGAMRARFGVANDDRAEGGPHFRLEWAPRPSELPEVEYQRLGLQPLWTGGPGEPREVVGTPSFLEEVLRVALEHGFRLDSVFPDPED
LLNSRSLRFVRH*
89 >lcl|XP_003358298.1|Plus1complement(213813..214511) NW_003535913 BTB/POZ domain-containing protein KCTD11-like LOC100622059 __SEG__ Chr12 {Sus scrofa} MLGAMFRAGTPMTPNLSPQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASRGTPAPTAALLHADVESSPRLVHFSARRGPH
HYELSSVQVDTFRANLFCTDPECLGAMRARFGVANDDRAEGGPHFRLEWAPRPSELPEVEYQRLGLQPLWTGGPGEPREVVGTPSFLEEVLRVALEHGFRLDSVFPDPED
LLNSRSLRFVRH*
90 >lcl|XP_003358612.1|Plus1116913..118151 NW_003301097 transmembrane protein 22 TMEM22 __SEG__ Chr13 {Sus scrofa} MDTSPSKKYPVKKRVKIHPNTVMVKYTSHYPQPGDNGYEEINEDYGNFMEENPKKGLLSEMKRKGRTFFGTMDTRPPPTEDPVINETGQLQSFAEKNIFQSRKMWIVLFG
SALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVLSVLVVCYYQEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILAFLLVDEKMAY
VDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKEKISMWTALFTFGWTGTVWGVSTMFVLQEPIIPLDGETWSYLIAICVCSTA
AFLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK*
91 >lcl|XP_003358709.1|Plus1complement(56638..57171) NW_003536028 nucleoredoxin-like protein 1-like LOC100623594 __SEG__ Chr13 {Sus scrofa} MFWERAPGRGSGQCKGPRRLTQRRGQCGQPVLVPRASVQARGSAHRRHSVGTGRLARVTDEGPTGLLHLPRRDLGRRFSVERLPAVVVLKPGGDVLTLDAVDEIQRLGPA
CFANWQEAAEVLDRSFLQPEDLDDPAPRSLTEPLRRCKYRVDRAARGSHGREREGCPRREDGAEELF*
92 >lcl|XP_003358840.1|Plus139086..40078 NW_003536072 WD repeat-containing protein 5B-like LOC100627452 __SEG__ Chr13 {Sus scrofa} MATKESRDDKAGSALSSSANQSKQVAEKPNYTLKFTLVGHTEAVSSVKFSPNGEWLASSSADKVIIIWGAYDGKYEKALKGHSLEISDVAWSSDSGRLVSASDDKTLKIW
DVRVGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDESVKIWEVKTGRCLKTLSAHSDPVSAVHFNCKGSLIVSGSYDGVCRIWDAASGQCLKTLVDDDNPPISFVKFSP
NGKYILIATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTSGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENIIASAALGNDKTVKLWMSNY
*
93 >lcl|XP_003360269.1|Plus1complement(4953..5504) NW_003536741 neuroligin-4, X-linked-like LOC100624109 __SEG__ ChrX {Sus scrofa} MSRPQGLVWLPLVFTPVCVMLHAKVLLWITALAIKFTLIDSQAQYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNATQFAAVC
PQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDGKSLIGAEHRRALSLRWARRVLEGPVH
94 >lcl|XP_003360365.1|Plus1186129..186830 NW_003536783 GTPase ERas-like LOC100621986 __SEG__ ChrX {Sus scrofa} MALPTKPGMFDLGLGTWSPSSQEQKHKARAPSRGVGKQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKEMALDHGGCILNVLDTAGQATHRALRDQCV
AIGDGVLGVFALDDLSSLAQLQQMRATWGPHHTQPLVLVGNKCDLVTTTGDAHAAAAALAKSWGAPFVETSAKTRQGVEEAFSLLIHEIQRFREAMAKEAMAGPGGDKAR
HQKAMCRCGCSVA*
95 >lcl|XP_003360481.1|Plus1complement(437834..438286) NW_003536844 kelch-like protein 13-like LOC100519459 __SEG__ ChrX {Sus scrofa} MCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDE
WHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP*