SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor R    

ID / Description / Sequence
1 >lcl|NP_001003401.1|Plus12132114..2133883 NW_047617 ectodermal-neural cortex 1 Enc1 __SEG__ Chr2 {Rattus norvegicus} MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRV
IINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLVYESAMNWISY
DLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPR
KEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEQYDPTTNKWTMVAPLREGVSNAAVV
SAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQ
RCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS*
2 >lcl|NP_001004444.1|Plus1328288..330429 NW_047761 zinc finger and BTB domain containing 1 Zbtb1 __SEG__ Chr6 {Rattus norvegicus} MAKPSHSSYVLQQLNNQREWGFLCDCCIAIDDTYFQAHKAVLAACSSYFRMFFMNHQHSTAQLNLSNMKISAECFDLILQFMYLGKILTAPSSFEQFKVAMNYLQLYNVP
DCLEDIQDSDCSSSKCSSSASSKHNSKMIFGVRMYEDTVARNGSEANRWSAEPSSTVNTPHNREPEEESLPLANFPEPLFDVCKKSSVSKLSTPKERVSRRFGRSFTCDS
CGFGFSCEKLLDEHVLTCTNRHSYQSTARAYHRVVDARDGKDSAIKAELGDKGSPTAFSAHTDKYREDASQAPDDSASPTGSRKSTVESGTAGEEKSRAAETKRVVIKME
PEDVPADDMKDFTIVKVTEKDCNESTDNDELEDEPEEPFYRYYVEEDVGIKKSGRKTLKPRMSVGVDERGGLENMRPPNNSSPRQEDAENASCELCGLTITEEDLSSHYL
AKHIENICACGKCGQILVKGRQLQEHAQRCGEPQDLTMNGLGNTDEKMDMEENPDEQSEIRDMFVEMLDDFRDNHYQINSIQKKQLFKHSACPFRCPNCGQRFETENLVV
EHMSSCLDQDMFKGAVMEENERDHRRKHFCNLCGKGFYQRCHLREHYTVHTKEKQFVCQTCGKQFLRERQLRLHNDMHKGMARYVCSICDQGNFRKHDHVRHMISHLSGG
ETICQVCFQIFPNNEQLEQHMDVHLYTCGICGAKFNLRKDMRSHYNAKHLKRT*
3 >lcl|NP_001005904.1|Plus1534972..536738 NW_047712 calicin Ccin __SEG__ Chr5 {Rattus norvegicus} MKLEFTEKNYNSFVLQNLNKQRKRKEYWDMALTVDHHVFFAHRNVLAAVSPLVKSLVSSNDMKTTDELYITIDPNYLSPATVDQLLDYFYSGKVVISEQNVEELLRGAQY
FNTPRLRIHCNDFLIKSIRRVNCLRYLFLAELFELKEVSDLAYSGIRDNFHFWASPEGSMHFMRCPPVIFGRLLRDENLHVLNEDQALSALINWVYFRKEEREKYFKKFF
NYINLNAVSNKTLMFASNKLTGLENNSAHATLIESVLMDRKQERPCSLLSYQRKGALLDSVVILGGQKAHGKFNDGVFAYIIQENLWLKLSEMPYRAAALSATAAGRYIY
ISGGTTEQISGLKTAWRYDMDDNSWTKLPDLPIGLVFHTMVTCGGTVYSVGGSIAPRRYVSNIYRYDERKEAWCLAGKMSIPMDGTAVITKGDRNLYIVTGRCLVKGYIS
RVGVVDCFDTCTGEVVQCITFPIEFNHRPLLSFHQDNILRVHSHRQSVEINLQKIKANKSTTSVPLLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
YLLDQKIGEWKTLACPPEALDCPACCLAKLPCKILQRI*
4 >lcl|NP_001007147.1|Plus1complement(651881..652921) NW_047781 transducer of ERBB2, 2 Tob2 __SEG__ Chr7 {Rattus norvegicus} MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLRGSGFRCVHIGEVVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVK
VLYLGDGEVGGAQELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGASSGVSVSGSGAGGQQPPSQQPRL
ARSPTNNLLKHKSLSLSMHSLNFITANPGPQSQLSPNAKEFVYNGGGSPSSLFFDGVDGPGTSAAAPFGSSGASTCNSSSFDVAQVFGGGANSLFLEKTPFVEGLSYNLN
TMQYPNQPFQPVVLAN*
5 >lcl|NP_001007643.1|Plus121108939..21109664 NW_047655 phosphatase, orphan 2 Phospho2 __SEG__ Chr3 {Rattus norvegicus} MKVLLVFDFDNTIIDDNSDTWIIQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKEEELKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLE
AAAFHDVFDTVFTNPASFDSTGRLTVRNCHTHACTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGNDVCPVTFLKKNDVAMPREGYTLHRTLDKMSQNLEPMAS
SIVVWSSGMEIISHLQFLIQM*
6 >lcl|NP_001009172.1|Plus1complement(1726676..1728586) NW_047597 zinc finger and BTB domain containing 22 Zbtb22 __SEG__ Chr20 {Rattus norvegicus} MEPSPMSPSGATLPLPLSLAPPPLPLPAAAVVHVSFPEVTSALLESLNQQRLQGQLCDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKGMTSISLPSVMDPGAFETVLA
SAYTGRLSMAAADIVNFLTVGSVLQMWHIVDKCTELLREGRSSAATTTVTAVAAPSVSVPCASVPSGSGGTVAPATVGSVRSHTSSRASENQSPSSSNYFSPRESTDFSS
SSQDAFVASAVGSGNRRDGGPVFPVPVVGSAGTTSGKLLLEADELCDDGGDGRGAAAPGAGLRRPNCLPASAVPQKHWVYVKRARNCPAPASLVHQDPDLEDEEEEEDLV
LTCEDDEDEDLGNGSGVPAGGEPEATLSISDVRTLTEPAEKGEEQVNFCESSNDFGPYEGGGAGAGLDDPGGPTPSSYGLTHPPRPLLPLDVPGNQILVFPSSSSQAPGQ
PPGNTAEHGAVTLGGASAVGLGIPSGSGGTPGGAGNSDGNKIFLCHCGKAFSHKSMRDRHVNMHLNLRPFDCPVCNKKFKMKHHLTEHMKTHTGLKPYECSVCAKKFMWR
DSFMRHRGHCERRHRMGAGGAASVPGPGPGAPTGPALQPKRESSAVGGGSGDEANSATPPSNRRVWSPPSVHKVEMDFSGGGGAAH*
7 >lcl|NP_001009540.2|Plus1complement(16099558..16100511) NW_047693 tumor-associated calcium signal transducer 2 precursor Tacstd2 __SEG__ Chr4 {Rattus norvegicus} MARGLDLAPLLLLLLAMVAGFCTAQINCTCPTNKMTVCNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKA
RQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYF
ERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTGLIAVIAVVAVALVAGVVVLVVTNRRKSGKYKKVELKELGEMRSEPSL*
8 >lcl|NP_001012045.1|Plus133363633..33365036 NW_047454 kelch repeat and BTB (POZ) domain containing 7 Kbtbd7 __SEG__ Chr15 {Rattus norvegicus} MQSREDAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQA
SVTIHDVDAESFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLTNCTAILKFADAFDHHKLRSQAQSFIAHNFKQLSRMGSIREETLADLTLA
QLLAVLRLDSLDVESEKTVCHVAVQWLEAAPKERGPSAAEVFKCIRWAHFPAEDQDYLEELLTKPIVKKYCLDVIEGALLQLRLDDDLCKALIRVPSSSSNSSNNSNSNN
NNDTSNTVIPAEENPPHRLGMCVKRMMVFFEHCKHPFLCCYSYSGEIYKVFLPVSCLADTRALSTLAVSIFPDHDICSTVQPRKGVWVYKPAPNNLHQLTDHLLCPKGMD
VTDLNGYIYILGGQDPVTGAILKDVECY
9 >lcl|NP_001012126.1|Plus1complement(4653195..4654433) NW_047801 transmembrane protein 22 Tmem22 __SEG__ Chr8 {Rattus norvegicus} MDTSPSKKYPIKKRVKIHPNTVMVKYTSHYPQPGEDGYEEINEDYGRFMEENPKKSLLSEMRRKGRTLFGTMDTQPPRSEDPRASSRGQFQSFAEKNIFQSRKMWLVLFG
SALAHGCVALITRLVSDRSKVPSLELIFIRSVLQVLSVIVVCYYQEAPFGPSGYRLRLFLYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAVLAFLLVDEKMAY
VDMATVVCSILGVCLVMIPNIADEDNSLLNVWKEAFGYTMTVMAGLTTALSMIVYRSIREKISMWTALFTFGWTGTIWGLSTMFVLQEPIIPLDGETWSYLIAICICSTV
AFLGVYYALDKFHPALVSTVQHLEIVVAMVLQLLVLHIFPSVYDVFGGVIIMISVFVLAGYKLYWRNVRREDYQEILDSPIK*
10 >lcl|NP_001012355.1|Plus1complement(33183686..33184339) NW_047799 Sumo1/sentrin/SMT3 specific peptidase 8 Senp8 __SEG__ Chr8 {Rattus norvegicus} MDPVVLSYMDSLLRQSDVSLLDPPNWLNDHIIGFAFEYFASSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQ
DKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQQNSYDCGMYVICNTEALCQNLFRRQPESPLQLLTPTYITKKRGEWKDLIARLAKKNRSSY*
11 >lcl|NP_001013166.1|Plus1complement(6927873..6928712) NW_047557 pleckstrin homology domain-containing family F member 1 Plekhf1 __SEG__ Chr1 {Rattus norvegicus} MVDHLANTEINSQRIAAVENCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLSKRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFV
VSAASTTERQEWISHIEECVRRQLLATGRQPTTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPKPLRVCSLCYRELAAQKRREEA
KERFRGSPGQLTHLGSTMCGASSGDDDDSDEDREGSGDGDWPTQVEFYASGVSWSAFHS*
12 >lcl|NP_001013448.1|Plus1complement(11254200..11254775) NW_047425 ras homolog gene family, member H Rhoh __SEG__ Chr14 {Rattus norvegicus} MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHSSFLNLKNKWISEVRSNLPCTP
VLVVATQTDQREMGPHRASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRKLFSINECKIF*
13 >lcl|NP_001013921.1|Plus1complement(4594671..4596509) NW_047562 ubiquilin-like Ubqlnl __SEG__ Chr1 {Rattus norvegicus} MPHIISRSPRMPQSRHPAGVPADGNIPPGVIRVIVKTPGNQNVFTVAEDTSVRQFKEQLSSHFKCQMEQLVLVSMGRLLKDHDTLSQRGITDGHTIHVVIKSKHGSRSLT
HSFRNLLTNNPCHQDRNPKGNSSTVCQSAGMSETKVESSILMEPDASKVCTQDPEVGSPEQIEQMLETLCVQRLLSNMFFMHQLPPEHPDMQDLIQQNPEVSHLLDNSEI
LCQTLELARHLAIIQEIMQIQQPAQNPEHTLNPQPYLGLETIPNGNIVLGQGYDNFNDHMLNGVHVHDLLEDDSFTALLAEQVLEQVQTPSLCQPPPQEQWGQLSSSQVI
FANSCGFLTTPTEANLNTTNNASRENPAIAATQGQSNVCAVQQPTEIPSLCTIPVIQEPREGDKDTTIPQGSSAQWLEEDLQQSEEQSSSQITRSMIQLLRTHPHMAAEM
LLLLNPPQLNEQWRQQTATPLQSSQLSDLLLALANPKTSQALLQIEHGLQLLATEAPALLPYIEPYLWGLGWLIPSSCDYLDTVPWTWNVQDTVEPQCPESCHKSGTVLQ
REQPLSGDSSHSLQAPEVRFSKEMECLQAMGFVNYNANLQALIATDGDTNAAIHKLKASQGF*
14 >lcl|NP_001013981.1|Plus1349246..350742 NW_048036 hypothetical protein LOC302576 LOC302576 __SEG__ ChrX {Rattus norvegicus} MGLLNSRVLRSGDSSLVEPQPEATAGPSGQSGSRKRKLSNSVNLGPSPDIHGPQNQRINLNQVLNYIYRKRVKISSNYAYENLFLNGNDSDIKICALGRTWCLHKVFLCH
SGYFANILKDIWKESRNGVIRLLIRNEDIDTRSLHFVFGSLYTDENLSLTPLEVPRVLAAACLLRVDRVIRQCEKIMKTTINRNTACSYYLAAETYRLKAVKTECFQWLL
YNLMVHPSVALYKAVDLKLMYLLTSSSHLLVMQKEIDVYITLKTWMFLYLNPCWNGTMKELLDHTNNWLYTYMGYVDNISFLESEEGLIFQPVFKKLRFQHIICDLASTS
VLERDRLIPAEWLSPIYKQHWLTYLQAQEQKAIGPQTINEEELEQNTMRCGKMIPTDGKYIWKWLACKLSFPLCVIFTSHYIIFKQCFQQCDGSACLNHVRNFVFKITLV
CFDSNEKVTFSKTTGYKTLTFENNEEQIVMKLDAEALTFPLYIFANFLFLKLENAENM*
15 >lcl|NP_001014074.1|Plus11128988..1130412 NW_047667 hypothetical protein LOC311720 RGD1309726 __SEG__ Chr3 {Rattus norvegicus} MCVICFVKALVHVFKIYLTANYSYNFRSWPVDFRWDDLHVPGTNNSSHRALTCAAAAAGVWLLHDAALGEDALTRPPRGARSQVQCLLQQIRELPSQLASYALAHSLGRW
LVYPGSMFLMTRALLPLLQQGQERLVDRYRGRRAKLVACDGNEIDTMFMDRRQHPGSHGRGLCLVICCEGNAGFYEMGCLSAPLEAGYSVLGWNHPGFGGSTGAPFPQHD
ANAMDVVVKYALHRLHFSPANVVVYGWSIGGFTATWATMTYPELGALVLDATFDDLVPLALKVMPQSWKGLVVRTVREHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSG
HVPSLPSCQVEGDVEGNRGNELLLRLLEHRYPSVMAREGRTVVIRWLRASNLAQETALYARYHVDDEWCLATLRSYREGRQKDLDHTKTWGPHGPSFPWFVGQGLSARRR
RHLALFLARRHLKNLEATHCSPLEPEDFQLPWRL*
16 >lcl|NP_001014100.1|Plus1complement(45173439..45174599) NW_047760 WD repeat domain 89 Wdr89 __SEG__ Chr6 {Rattus norvegicus} MEKIKDQFANLHILRRSSEPKEPTYLLGIDTSKTVPAEKGGLVAVLCSNGSIRIYDKETLNLLREFSGSPGLLNGVRFANSCDNVYSASTDGTVKCWDARLASEKPAQLF
KGYPSNIFISFDVNCKDHIICAGAEKVEDDALLVFWDARFTSQDLSTRDPLGAYSETHSDDITQVRFHPSNPNMVVSGSTDGLVNVFDLSVDNEEDALVATCNSVSSVSC
IGWCGRDYKQIYCMTHDEGFCWWDLNHLDTDEPITCLNIQDVRDVTDVKEGHLDYLIGGLYHENMDRLFVIGGTNLGKIHLLSCTKTGLSHVTSLQGGHAATVRSFCWTV
SEDSLLTGGEDAQLLLWKPGAVEKTFTKKDSLKIASSVQQRVRVHSSDSYKKRKQQ*
17 >lcl|NP_001014121.1|Plus119676863..19677927 NW_047813 progestin and adipoQ receptor family member VIII Paqr8 __SEG__ Chr9 {Rattus norvegicus} MTTAILERLSTLSVSGQQLRRLPKILEEGLPKMPCTVPETDVPQLFREPYIHAGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVEAGALQWASPHTL
PLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYERFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLA
FILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRHEIFFQRHGPLSVYTACLSFFFL
AACSAATASLLRHKVKDRLIKKDS*
18 >lcl|NP_001014287.1|Plus120722169..20723326 NW_047773 MTERF domain containing 3 precursor Mterfd3 __SEG__ Chr7 {Rattus norvegicus} MSWRLLTGYQLCRLRLFRKPQPALKIRPSSVCVTYGTDCQSNKENKRTVETLRACSVDIGKICRLKGWVLLEEETYAEEIANILKELGANQTVIASILERCPEAIVCSPA
AVNTKRKLWQMVCKTKTELIQLIEQFPESFFAVKDQENQKLNVQFFQELGLKNVVITRFLTTASSIFHNPVENNKQMIGVLLESYLNLGGSEANAKVWLLKLLSQNPFIV
LSSPTAVGEVLKFLQGQGFTDSEVLQLLSKLKGFLFQLQPGSIQNSISFTKTTFECTDHDLRQLVVKCPALLYYPAPVLEERIQALLKEGISVAQIRASPMVLELTPQII
QYRIRKLNSLGYGIKDGHLASLNGTKKEFEANFSKMQAKQGRPLFNPVASLKVEE*
19 >lcl|NP_001019527.1|Plus1complement(3723466..3724722) NW_047784 testis-specific H1 histone H1fnt __SEG__ Chr7 {Rattus norvegicus} MAEAAQPTGESQGAELTIQIQQPVERALRTPVRRGAQSVLRVSQLLLRAIAGHQRLTLAALKKELGNAGYEVRRKISSHQAGDSTRSEKYTLLRVSGSDAAGYFRVWKIS
KPRRKAPRSRLTLGSHSHGKTVLKSPRPLRPRSRRKAAKKAREVWRRKARALKARSRRARSLARSMVRSRASSRASSRARSRARSRARSRARSRARSRASSRARSSARSS
ARSSARSSVRSSVRSSARSSARSSIRSRARSRARTRARSRAKDLVRSKAREQARTRAREQAHARARTHDCVRAKAQEYVRAKEQQYVSAKEQEYVRTKEQECAKAREQMR
IGAMEEARIKAIDNRVQTTMEDTSPWSTDEMRSRTKPREEKRQEPERPVKQTNQKPAVVKVDNAPSRQGKTCTKSSTKSGHPGCSGTS*
20 >lcl|NP_001019913.1|Plus12926882..2927622 NW_047422 alpha-N-acetyltransferase 1B Ard1b __SEG__ Chr14 {Rattus norvegicus} MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLH
VRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLAQMADELRRQLVLKKSRYVVLGSEENQEAQDSTLPDAEEACQPENPAGKGSEACQPENPAGKGSEACQP
ENPAGKDTGSHSTDVQDSSEYLDSTS*
21 >lcl|NP_001019937.1|Plus1complement(19941773..19942759) NW_047356 WD repeat domain 5B Wdr5b __SEG__ Chr11 {Rattus norvegicus} MATEHLPAERAQSPLSAPQRVEEPQKPNYALRLTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGKCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKLWDV
RSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVHFHCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNG
KYILTATLDSTLKLWDYSRGRCLKTYTGHKNEKYCIFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVISAACHPTENIIASAALENDKTIKIWSSDY*
22 >lcl|NP_001019956.1|Plus1complement(2047378..2048274) NW_047712 mitochondrial carrier triple repeat 1 Mcart1 __SEG__ Chr5 {Rattus norvegicus} MMGSEAHDKRPPMLTSSNQDLSPHLADVGQIKHYFCGCCAAFNNVAITYPVQKILFRQQLYGIKTRDAILQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLR
KHVSNAPEFATRSVAALLAGTTEAILTPLERVQTLLQDHKHHDKFTNTYQAFRALRCHGVAEYYRGLVPILFRNGFSNILFFGLRGPIKEHLPTATTNSEHLVNDFICGG
VLGAMLGFLSFPVNVVKARIQSQIGGPFQSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV*
23 >lcl|NP_001020151.1|Plus117817273..17818760 NW_047626 ankyrin repeat domain 34A Ankrd34a __SEG__ Chr2 {Rattus norvegicus} MLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMVRYLLEQGADPNIADRLGRTALMHACAGGGGAAVASLLLAHGADPSVRDHA
GASALVHALDRGDRETLATLLDACKAKGTEVIIITTDTSPSGTKKTRQYLNSPPSPGVEDPAPAPPSPGVCTSPSEVQLQTAGGGRGLLSPRAQEEEEKRDVFEFPLPKS
PDDPSPSEPLPKPPRHPPKPLKRLNSEPWGLVAPPQPVPPAEGRPGLERLAAEFNGLTLTGRPRLSRRHSTEGPEDPPPWAEKVTGGGPLSRRNTAPEAQESGLPSGLRQ
KLSRMESVELDTPGHFCPDSPESSRLSLERRRYSASPLTLPPAGSVSSPRQSQESLPGAVSPLSGRRRSPGLLERRGSGTLLLDHISQTRPGFLPPLNVSPHPPIPDIRP
QPGGRAPSLPAPPHSGAPGSPRTKRKLVRRHSMQTEQIRLLGGFQSLGGPGEPGR*
24 >lcl|NP_001020162.1|Plus1complement(925916..926581) NW_047334 fumarylacetoacetate hydrolase domain containing 1 Fahd1 __SEG__ Chr10 {Rattus norvegicus} MASTKPLSRFWEWGKNIVCVGRNYADHVKEMRSTVLSEPVLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGRRGEAVPEAAAMDYVAGYALCLDMTARDVQDECK
KKGLPWTLAKSFTSSCPVSAFVPKEKIPDPHALRLWLKVNGELRQEGKTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGAVKENDEIEAGIDGVVSMRFKVERSK
Y*
25 >lcl|NP_001020308.2|Plus1complement(1098419..1099345) NW_047398 immediate early response 5 Ier5 __SEG__ Chr13 {Rattus norvegicus} MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYLAGPAGTPAVPPPQQPGEPVAGPPSGWGEPPPPVARAAWPEPEPQPQPQPQRPS
VCHTPGAGSPEPVAAVSGAEDALRGGEEDSAAAAWGRVERPRVAPSGGSSDACSEGPRALRRPCGCPSAVEERSSENGSPAPAAPCPRKRGAAGVGGGRAGCSAPGSTPL
KKPRRNSEEQPVTDEEDTDEEMETGNVANLISIFGSSFSGLLRKSPAAGREEYDAEEGGPEASEPGQICCDKPVLRDMSPWSTAIVAF*
26 >lcl|NP_001020839.1|Plus110794662..10795750 NW_047398 hypothetical protein LOC304928 RGD1306783 __SEG__ Chr13 {Rattus norvegicus} MAFQFNFSIEEDLENKLTSLDDGTCVLKSQKGKEDKNQSTELPGLPQDRLWKCSSLGSAASSEDTDSPPSTADRSGVPEACEKQPSLKPAKEHVIPKDCDQVLENKVLEM
LPGSQHVSTAVVKTISLKEKFPGENIVSQSFSSHSDLIPGVYEGGLKIWECTFDLMTYFTKAKVKFAGQKVLDLGCGSGLLGITASKGGAREVHFQDYNGLVIDEVTLPN
VVANVPLQGDSNGINEPAGKRQRKSEVAQETCKCRLFSGEWAEFCKLVLSEKLFVKYDLILTSETIYNPDYYSTLHETLLRLLSRNGRVLLASKAHYFGVGGGVHLFQKF
VEEKGVFETRTLEVIDEGLKRFLMEMTFKCPS*
27 >lcl|NP_001020871.1|Plus1complement(16341271..16342092) NW_047798 F-box and leucine-rich repeat protein 12 Fbxl12 __SEG__ Chr8 {Rattus norvegicus} MRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMIWLQKEQDPTVLPLLECIVLDRVPA
FRDEHLQGLTRFRALRSLVLGGTYRVTETGLDSSLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVGGLSAQGLVFLEGMPVLESLCFQGPLITPEMPTPAQ
IVSSCLTMPKLRVLEVQGLGWEGQEAEKVLCKGLPHCLVIVRACPKESMDWWM*
28 >lcl|NP_001025209.1|Plus114259448..14263884 NW_047565 zinc finger protein 518 RGD1305314 __SEG__ Chr1 {Rattus norvegicus} MPFEQTQLFCDEKQTILKKIDTRNEIPDTIKSIPIPKISEAGFHYEPKNVNICLPKINIPNEILMKHEVEKYRKLFQSKPQTARKSVSVRTVSCAKGCAQRCESERAEDE
AGKMCAKILNFTCSKCQDRTQYSPNDLQKHFEMWHHGELPSFPCEMCSFSASDFQIFKQHRKTHRNTFVKCDICNSERSYTLLDLTKHFTSKHCVNGNFQCEECRFFTQD
VGTFVQHIHRHKEVHYKCGKCHHLCFTKGELQKHLRVHSGTLPFTCHYCSYGAIHKDQLVRHVITLHKEHLYAKEKLERDQYDKRVAKTTTGLKLILKRYKIGPTKTFWK
RKTIASGNDESIGKNAQAFNIVSKTQTKSEDQSQEQLNEEKGGRQHCEDGDKPIESGSEKATVLSTGQCNKADEGASAPSSVLSAVQGPTVLLVRNNKITIPANYSAKFM
GFKMVDGRQHIVIKLLPANKQILPSPALQPNTEKESTANLPPQAMDNTGFATGLTAMNDTDFVKAAPLSCSSPELPRKVISEKETAFISEKNNMLQMVDDSKSVTSLPTP
SESVTSVRLTTKVEARDNVDLWENPSTQSHPDLIGTSINSPDKVNLTIRPNAYSCGDMHNYCINYVNSELPAESSNCFEFSNQGSLPFHNYSKVNNKRRRFSRGAVCENL
QRESSNKTVTQQSTSDSDTTSPLRKESSNSDSLLASISPLSGTLKIKTEIEEPCDLEETQNFNEQSLFTNENQNLLNMTEEPKWDDIPCAGSPMMPRITSVFSLQSEQAS
EFLPPEVNQLLQDTLKPRSDIKEDSNNIPSKNLPLDCDQTLKKSKEEVIKSSKDFQMQDIISVPSASVGVNVPANDLNLKCNGQEKQALSVLQDVRDPGVTTKIPSIITL
LKTQSDAIITQQLVKDKLRTTTQHSGPVYVQNPLLTSEQKNPVFVQTPKGFIIPLHVANKPGLHVFSGRPVPLVNTQSVPAALLVNKKPGVVLTVNNGKPEGVPTVKTEN
VHSYGTVTKEPCRTPFLKAEHNRYCLTPGLCSSIGSCVNMKTCSENTLPLKGSYIIKTSVSSSVKAVPFANVLPEQQGPNVNVLDAVKQQNESLPKASLYTLMPDGKQAV
FFKCMMPNNTKLLKPRLVQNSTYQRIQPKRPAGAPQKILLKIFNPVLSMSAVNNLSVGNSASSFQKEIVPSKPTVHGEQKVPQSSRDALPVSVQDLMPANEAVLSSTAAC
PGSSEEPVHISERSETRVSRSKANCTIERNFNKRKTCKNKFAKIKTRISQDSETAFVSRNRSCKRKYIDNYQEPPRKKSATHRKCKERANAEDVQETFGFSRPRLPKDSG
RTLRLFPFNSEQLVKCPRRNQPVVVLNHPDADAPEVERVMKTITKFNGRVLKVSLSKATINALLKPVSITSETTYSDFSKRHKMLKPVNSVKERFVLKLTLKKTSKNNYQ
IVKTTSEDVLKSKFNCWFCGRVFDNQDVWAGHGQRHLVEATKDWNMLE*
29 >lcl|NP_001029253.1|Plus1556749..557786 NW_047725 progestin and adipoQ receptor family member VII Paqr7 __SEG__ Chr5 {Rattus norvegicus} MAMAVAQKFSHLLSSLWHVGQKPLQAEPVFTVDRAEVPRLFWKPYIYAGYRPLHQNWCFYFRTLFQQHNEAVNVWTHLLAALALLLRLIVLAGSVDFWEDPHALPLFIIV
LASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPSWHDKVQAIFLPTAAFLAWLSCAGSCYNKYSQKPGLLGRSFQEVPSALAYALDISPV
VHRIIVSPLPAEEDPALLYHKCQVVFFLLAAAFFSTVMPESWFPGSCHIFGQGHQVFHVFLVLCTLAQLEAVTLDYQARGAIYKPLHARWPHNFFGLFLLTVGSSILTAL
LLSQLVRRKLHQKTK*
30 >lcl|NP_001032272.1|Plus1complement(2334095..2334670) NW_047562 ras homolog gene family, member G Rhog __SEG__ Chr1 {Rattus norvegicus} MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPI
LLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL*
31 >lcl|NP_001032432.1|Plus1complement(77777..78013) NW_047795 methyltransferase like 7A Mettl7a __SEG__ Chr7 {Rattus norvegicus} GGAFYFMEHVADERSTWNYFWQQVLDPVWFLVFDGCNLTRESWKTLEQASFSKLKLQHIQAPLSWALVRPHIYGYAVK*
32 >lcl|NP_001032746.1|Plus1complement(126065..129163) NW_047659 RNA binding motif protein 12 Rbm12 __SEG__ Chr3 {Rattus norvegicus} MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRTGGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPS
SGMSSRVNLPATVPSFNNPSPSVVTATTSVHESNKSIQTFSTASVGTAPPSMGTSFGSPTFSSTIPSTASPMNTVPPPPIPPIPSMPSLPPLPSIPPIPVPPPVPTLPPV
PPVPPIPPVPSVPPMTTLPPISGMPPLNPPPVAPLPTGMNGSGAPISLNNNLNPVFLGPLNPVNPIQMNSQSSVKSLPINPDDLYVSVHGMPFSAMENDVREFFHGLRVD
AVHLLKDHVGRNNGNGLVKFLSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQSMGPSGQAHPPPQTLPRSKSPSGQKRSRSRSPHEAGFCVYLKGLPFE
AENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRNDADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMVLNPEGEVSSAKVCAHITN
IPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKTEDDAHKSEHLHRKKLNGREAFVHIVTLEDMREIEKNPPAQGKKGLKIPVPGNPAVPVIPSAGMPAA
GIPSAGIPSAGIPSAGMPSAGMPSAGLPAAGLPAAGLPGSGMPGSGMPGSGIPGPGIPGPGIPGPGIPGPGMPGPGIPGPGIPGPGIPGAGIPGPPMPGPAMPGPSMPGP
AMPGPAMPGPAMPGPAIPGPALPGPAIPGPGIPSAGGEEHVFLTVGSKEANNGPPFNFPGNFGGPNAFGPPLPPPGLGGAFGDVRPVMPSVGNSGLPGLGLEVPGFGGAP
NNISGPSGFGGIPQNFGNGPGSLNAPPGFGNGPPGLGSVPSHLSGPPAFGPGPGPGPIHIGGPPGFGASSGKPGPTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKY
NEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG*
33 >lcl|NP_001034095.1|Plus111908261..11910030 NW_047560 ectoderm-neural cortex protein 2 Klhl25 __SEG__ Chr1 {Rattus norvegicus} MSVSVHETRKSRSSTGSMNISVFHKASHPDCVLAHLNTLRKHCMFTDVTLWAGDRAFPCHRAVLAASSRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRI
VINEENAESLLEAGDMLQFHDVRDAAAEFLEKNLSPSNCLGMMVLSDAHQCRRLYEFSCRMSLVHFETVRQSEDFNSLSRDTLLDLISRDELETEDERVVFEAILQWVKH
DLEQRKVHLPLLLRNVRLALLPSDCLKKAVSGEALLMADECTKLIIDEAFRCKTKILLNDGVVTSPFARPRKAGHTLLILGGQTFMCDKIYQVDHKAKEIIPKADLPSPR
KEFSASAIGCKVYVTGGRGSENGVSKDVWVYDTVHEEWSKAAPMLIARFGHGSAELENCLYVVGGHTSLAGIFPASPSVSLKQVEKYDPGDNKWTMVAPMRDGVSNAAVV
SAKLKLFVFGGTSIHRDMVSKVQCFDPSDNRWTIKAECPQPWRYTAAAVLGSQIFIMGGDTEYTAASAYRFDCETNQWTRIGDMTAKRMSCHAVASGNKLYVVGGYFGTQ
RCKTLDCYDPTSDTWNCITSVPYSLIPTAFVSTWKHLPA*
34 >lcl|NP_001037724.2|Plus1complement(14272827..14273123) NW_047536 F-box protein 31 Fbxo31 __SEG__ Chr19 {Rattus norvegicus} MAVCARLCGVGPARGCRRRQQRRGPAETAAADSEADTDPEEERIEAGPARCSLLELPPELLVEIFASLPGTDLPSLAQVCSRFRRILHTDTIWRRRCRE
35 >lcl|NP_001037753.1|Plus11593940..1594992 NW_047718 protein KTI12 homolog Kti12 __SEG__ Chr5 {Rattus norvegicus} MPLVVVCGLPSSGKSRRTEELRRALTGEGRSVYVVDDASVLGAQDSTVYGDSAGEKALRAALRAAVERRLSRQDVVILDSMNYIKGFRYELYCLARAVRTPLCLVYCIRP
GWPSRGLPVPGACESSDPAVSVSWRPRADYGEKTQAVGAVEQRAISPLANGGVPTAVPKELDPKDILPSNPPAVMTPESEKSAEPAPCAFPPELLESLALRFEAPDSRNR
WDRPLFTVVGLEEPLPLAEIRSALFENRAPPPHQSTQSQPLASGSFLHQLDQATSQVLTAVMEAQKSAVPGDLLTLPGTTEHLRFTRPLTLAELSRLRRQFISYTKMHPN
NENLPQLANMFLQYLNQSLH*
36 >lcl|NP_001071146.1|Plus1complement(4571835..4573367) NW_047562 hypothetical protein LOC499222 RGD1562433 __SEG__ Chr1 {Rattus norvegicus} MARAREEAGDSQLVSGRESSSRIIRVSVKTPQDCQEFFLAENSNVHRFKKQISKYLHCDTDRLVLIYTGKILQDQDILSQRGILDGSTVHAVVRSRLKGSACTGTLAGPT
GHCTHRSEPSVKLGRLARSSPDLADFFSQLVQLLPAAPESVVQFLEDPLIQGLANEKQANGVHIPESSKTVQKRDPALKFPETFQKPVQQQEVLQEHKQRLEALKAVPGG
DNAMHPSCSDIQQAMLSTLASLVASKGHISGSDLCRGEANNAHSSLDTTTIPATSAPVRTLAQEVSTGGVTQVKGLVSSQAGSGCRQGMLDLHPSSETPSQESQQPVEKV
PLTNQLRLSPSVLRRALTVLQQNPSLAHQLATGSPLLHHIPLLPILTNPRALQALLQIEEGLMILSREVPELGPLFRESAKPRGARGAQETRGRRQAHREDTSQHSLAFL
QLFHSLASACSQSTQTALPASPFTEDRYQQELEELKALGFANHDANLQALVATDGDIHAAIEKLLGAPQD*
37 >lcl|NP_001093998.1|Plus128171290..28172873 NW_047657 recombination activating gene 2 Rag2 __SEG__ Chr3 {Rattus norvegicus} MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPAVFSKDSCYLPPLRYPATCSYKGSTDSDKHQYIIHGGKTPNNELSDKIYIM
SVACKNNKKVTFRCTEKDLVGDVPEARYGHSIDVVYSRGKSVGVLFGGRSYMPSTQRTTEKWNSVADCLPHVFLVDFEFGCATSYILPELQDGLSFHVSIARNDTIYILG
GHSLASNIRPANLYRIRVDLPLGTPAVNCTVLPGGISVSSAIVTQTNNDEFVIVGGYQLENQKRMVCSIVSLGDNRIEISEMETPDWTPDIKHSKIWFGSNMGNGTVFLG
IPGDNKQAMSEAFYFYMLRCSEDNSSEEQKIVSNSQTSTEDAGDSTPFEDSEEFCFSAEAISFDGDDEFDTYNEDDEDDESVTGYWITCSPTCDVDINTWVPFYSTELNK
PAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVRIARALQTPKRNLPLQKPPMKSLHKKGSGKVLTPAKKSFLRRLFD*
38 >lcl|NP_001094466.1|Plus1complement(15540076..15540882) NW_047626 TRAF domain and POZ/BTB containing protein T1 RGD1559714 __SEG__ Chr2 {Rattus norvegicus} MSRDLEVKSCGYIHISVQNFCYEWAIRNFSFCMDGIRENITSPGFSLEASEEVQWCLTIYPNGVDEESTDYLSVYLGLLSCPKSPVWAKVQFWIINAQGEKYVITKISDV
LRFLPNRYWGCKNFILRDFLLYHSHWLLPEDKLTLCCKVSIIGPYFSRPGQNMPPAIRDPMQILAEDLGELWENSLFTDCSLVVAGQEIRSHKAILAARSPVFRAMFEHE
MLDSLRNRIEIHDIHLQVFKEMMHFIYTGTVPHLHNHSMATGLLAAAD*
39 >lcl|NP_001099226.1|Plus1complement(25362199..25362762) NW_047696 phosphatidylethanolamine binding protein 2 Pebp2 __SEG__ Chr4 {Rattus norvegicus} MPADITVWAGPLSLQDVDEQPQHLLRVTYAGAEVSELGQVLTPTQVKNRPSSITWDGLDPGKLYTLILTDPDAPSRKEPIYREWHHFLVVNMKGNDISSGKVLSDYVGSG
PPKGTGLHRYVWLVYQQDKPLKCDEPILTNRSGNQRGKFKAAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLSGK*
40 >lcl|NP_001099257.1|Plus142131583..42133373 NW_047334 major facilitator superfamily domain containing 6-like Mfsd6l __SEG__ Chr10 {Rattus norvegicus} MSPNPQWDVPRALGVARLFHLVCGVRDACVTPFLTLYLRQLGVAAPWVGILMGTKHLIAACWTPFCAFLARRYQKRRMFLTGSLLGSAGASLLMVLVPPADRNLGNHFCN
GSSKVATTVLPLVVTQTVTMTSAQGSVPNHWAGAPSLPGSRHTRALDTSGFPNGSGKTQERTLRGLQTYLVGSVEGVRTTAQALNLVTSGLRENSQKGTSEVSNANLSLL
PGSTTLGGPVNVSKTQGDIQTHNHTLKGSQWTVILSFGFLVFWELLAAPLEQVADDSLYEYLDFVDAADRNKDLWVWRLLGISAGVCGIAALVEHLECFLVANGPQGVIY
FYSYSLVSTLALAVSTAFPVPIDQQQRPSYKAIKALSLVRDDSRLILLAFTVFWIGATTSTVQNFLFWHMKDHGSSDLVMGFSVVLGLLGEILFHPFRTSLLRKLSRVGV
LGLGLGCLALQMLYYAFIWSWWSVLPVQILSAISSGALWWAVGASIGDLASSRMERSLNTLFRGHLYESGCSLGSFVGGFVALRFGVAVLYQACCVVLLLWLAVFLSIQP
RLPQEQRINYSKLLAMEGSNSSDSEQGSEGDWLVRAMREEHTDWKG*
41 >lcl|NP_001099303.1|Plus11347952..1348821 NW_047337 phosphatase, orphan 1 Phospho1 __SEG__ Chr10 {Rattus norvegicus} MCQRPWLWPANQPLPGRLPPRRLSLAPSSCSSSPCSQDGRMAAPGAPRFLLTFDFDETIVDENSDDSIVRAAPGQQLPESLRATYREGYYNEYMQRVFKYLGEQGVRPRD
LRAVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESALRAAGHHSLFRRILSNPSGPDARGLLTLRPFHTHSCSRCPANMCKHKVLSEYLRERARDGVHFERL
FYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRAHVVPWETAADVRQHLQQVLKMC*
42 >lcl|NP_001099317.1|Plus12039677..2041752 NW_047340 intramembrane protease 5 Imp5 __SEG__ Chr10 {Rattus norvegicus} MACLGSLLPIGSLLLLLLSPEARGEYGVVRVVSKNWNKDYCVLYSSDYVTLPRDLSHAPLLPLHDGTKTPWCPDEDSFHQAQDSSLSQRPLHQTTTMVVRGNCSFYAKGW
LAQDHGAHGLLIVSRASNQQCSDTTSKPQDPSKPRPALTIPVAVLRYTDMLDILSHTYGDTNVHIAMYAPLEPIIDYNMVIIFILAVGTVAAGGYWAGLMEADRLQRHQA
RRGGGFGGHNQSQTVSAERSPRAWKEEDYEDAAVDFTPAMTGAVVTMSCSIMVLLYFFYDCFVYIMIGIFGLGASTGLYSCLAPIVRYLPLWQHQWVLPGHRASVKLSLL
LLAGLCAMVTVLWVIYRNEDRWAWLLQDTLGVAYCLFVLRRVRLPTLKNCTSFLLALLAFDVFFVFITPLFTKTGESIMVEVASGPVDSSSHERLPMVLKVPRMSFSALT
LCDQPFSILGFGDIVVPGFLVAYCHRFDVQIQSRQVYYRACTVAYAMGLLVTFVAMVLMQMGQPALLYLVSSTLLTSLVVATCRQELTLFWTGQGRAKIPAEPVVQPCIV
SAVACRMKLEGVKDSRVTNRFEEAIDRESGDLDSNPGDDIAEMVTLSEDEATSPEGHSESSEGWSDTNLDPDELPSGSPMALEELMPLAMLIPLIPPIPHTSELGRIHTQ
SRVRDSSLPWMGMHKRKGLKVKKSMSTQAPL*
43 >lcl|NP_001099616.1|Plus1complement(5335985..5336689) NW_047513 haloacid dehalogenase-like hydrolase domain containing 1A Hdhd1a __SEG__ Chr18 {Rattus norvegicus} MAEAVPVPQLRPVTHLIFDLDGLLLNTEDLYTDVFQAICSRYGKKYNWDVKSLVMGKKAPETTQIIVDFLKLPISKEQLLEESQERLQKVLHTAALMPGAEELIHHLRKN
RLPFALATSSATLSFQTKTSRYKGFFSLFHHIVLGDDPEVINSKPAPDIFLTCAKRFSPPPNPEDCLVFEDSPNGVEAAVACGMQVVMVPHENLSSDLTTKATLVLSSLH
EFKPELFGLPAFDE*
44 >lcl|NP_001099819.1|Plus11926814..1927509 NW_047565 tumor protein D52-like 3 Tpd52l3 __SEG__ Chr1 {Rattus norvegicus} MDPSHLESHPSGQKSEPAGLDVSSTSPNCFSSNQGLDSVYQELDLDSLNEDLSLSVSDAMTETSASTNEFHLASEPDLTEAEQMELRSELTKLEEEILSLRDLLAAKEKR
CGELKRKLGCVALVGLRQNLSKSWHDVQASNTYMKQKTSTALASMGSAICRKLGDMKKSSTFKSLEELVGTVKSRVAGGRELGSGLLPSPASGSDPHSVLGSGYETVSGL
DDQLFSLLKPE*
45 >lcl|NP_001100127.1|Plus1complement(1637859..1639871) NW_047712 zinc finger and BTB domain containing 5 Zbtb5 __SEG__ Chr5 {Rattus norvegicus} MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNS
VVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALSSSQSGEEPSAPMSSSMRNNLDQRTPFPMRRLHKRKQTVEERARQRLRSSMDESAISDVTPE
SGPSGVHSREEFFSPDSLKIVDNPKPDGMADNQEDSAMMFDRPFGAQEDAQMPSQSDGSAGNMASRATQVETSFEQEAVAEKGSFQCENPEVGLGEKEHMRVVVKSEPLS
SPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKTSFSISNFLNKSRGSNFSTSQSTDDNLPNTTSDCRLEGEAP
YLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPVQEVMGLPCVQTSGYQGEQFGMDFPRSGLGLHSSFSRAMMGSPRGGASNFPYYRRIAPKMPVVTSVRSSQISEN
QASSQLMMNGASSFENGHSSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSKTTCLRW
QSSNLPSTLL*
46 >lcl|NP_001100315.1|Plus1complement(10897635..10899239) NW_047800 ankyrin repeat domain 34C Ankrd34c __SEG__ Chr8 {Rattus norvegicus} MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQSISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGA
DPSLEDRTGASALVYAINADDKDALKHLLDACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRQSPPLCATPSDVELKASGLSSPPSEKDDDFFILQTGHQSCC
STSKVLNEPGSPTRKVSSLKRARLPQLKRLQSEPWGLIAPSVLAAAARQDETHGTSTDNEVIRSINDLSFPKRGPLSRANSIDSKDPTMFPTVQEQVLKVSSSTPASWKA
AYEKGQAPHPRLARRGTLPVDQEKCGMCPPGPSTLKDTASLKMLENDLYDLDIQPGGDPPNSMSLESGKGPLDRKKLNSSHLSLFHGSRESLDAVPSTSPSSVRRRPPHL
LERRGSGTLLLDRIAHTRPGFLPPLNVNLNPPIPDIRASNKPASPLASGLKSMVPVAPNSPKRVDLRSKKKLLRRHSMQIEQMKQLSDFEEIMA*
47 >lcl|NP_001100772.1|Plus1complement(1105816..1106145) NW_047470 nucleoredoxin-like 1 Nxnl1 __SEG__ Chr16 {Rattus norvegicus} MVSLFSGRILIRNNSDQDEVETEAELSRRLENRLVLLFFGAGACPQCQAFAPVLKDFFVRLTDEFYVLRAAQLALVYVSQDPTEEQQDLFLRDMPEKWLFLPFHDDLRR*
48 >lcl|NP_001100796.1|Plus1complement(2326100..2328001) NW_047476 kelch repeat and BTB (POZ) domain containing 11 Kbtbd11 __SEG__ Chr16 {Rattus norvegicus} MENSVAPFVLYPGTEPRTPGEDSLPLPAEEEGAASPAQTPCSLSASLCFSSGDDSPPQSRASAAEGSEASPPSLRSDLRVVETQWDVSSAASPESPQECARPEEPASPEE
PPSRREHARPVELESLDELGEPVPVPPGVGSEHGEPDLVIEVAGRRLRAHKAVLAARSDYFRARASRDVLRVQGVSFTALRLLLADAYSGCMAGVRPDNVAEVVAGARRL
QLPGAAQRATEAMAPQLSLDNCYEVLSAGKRQRLSELRDAAYRFMCDHYLEVLREPAVFGRLSGAERDLLLRRRLGTGRACLLAAALGTTGERSGSRPQSPSGDAESRGD
AAVYCYQAEAGEWRELTRLPEGAPARGCGLCVLFNYLFVAGGVAPAGPDGRARPSDQVFCYNPVTDCWSTVRPLRQARSQVQLLALDGHLYALGGECLLSVERYDPRADR
WTAVAPLPRGAFAVAHEAATCNGEIYVSGGSLFYRLLKYDPRRDEWQECPCSSSRERSADMVALDGFLYRFDLCGSRGDAQAATGSGGGVSVFRYHCLAKQWSQCAAHLR
PPGAPAGLQPFRCVALDGTIYCVSRAGTWRFVPSQDTEAGSDMGPGGSFEPEPLGSPLDVRGVLFPFVLNLPEKPDRGEQGAA*
49 >lcl|NP_001100797.1|Plus1complement(2708029..2709042) NW_047477 abhydrolase domain containing 13 Abhd13 __SEG__ Chr16 {Rattus norvegicus} MEKPWMLWSFIERWLLALVSWSWALCRISLLPLIVTFHLYGGIVLLLLIFVSIAGILYKFQDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGVRLNLILVRYTGDN
SPYCPTIIYFHGNAGNIGHRLPNALLMLVNLKVNLVLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRPDLDKTKVFLFGRSLGGAVAIHLASENSHRISAIMVENTFL
SIPHMASTLFSFFPMRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVIKSHSPEDMTKT
SSNVTII*
50 >lcl|NP_001101013.1|Plus1complement(4584211..4586178) NW_047562 ubiquilin 3 Ubqln3 __SEG__ Chr1 {Rattus norvegicus} MAKSGEALPQGSPAPVQDSQLIRVTVKTPKDKEDFSVVDTCTIRQLKEKISHRFKAHPNQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTTGTECPAPPVSTP
GPNPLELPQPNSAYPVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHMSVPELVAQLVDDPFIQGLLSNTGLMRQLVLDNPHMQQLIQQNPEIGHILNNPEIMRQT
MEFLRNPSMMQEMMRSQDRALSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFATATTASTTTTSSQPSRTENCDPLPNPWTSTCGVSGSRQGRQPGDQDTSESR
NRLPSFLGNIGLFDYLQQLHETSQALGSYLQGTVPTPSSSQETPLSGNRVPPNLPPSPKPGSGQPLPKDSVAIKGKSSCPAFLRHSSENSTGQGGSLHDSGKSSTGPSTG
LPNLTSQIGDNANRSPFVSTPSSLISPTPGAPESPWLPPTGYPRSLRSALTNQVPRMQNELHQQLPLLLHLQTAMTNPRVMQALLQIEQGLQILATEAPRLLLWFMPCLA
GLSGVIGGTESREGVVMSEDPRPTPTSQISLVQGSAELGFHSSPFLQVLQALASTNPQQLQLEAHFRVQLEQLRAMGFLNLEANLQALIATGGDVDAAVEKLRKS*
51 >lcl|NP_001101286.1|Plus1complement(3355093..3356397) NW_047651 hypothetical protein LOC311795 RGD1308019 __SEG__ Chr3 {Rattus norvegicus} MDRGHPSLEPQAKGPCVIAPVRAVLRLRRRVCVLRKRRLLQTGTEPSVGTGTLGSSASLGTLRADLDQPKFFTFDSLTELSSRTPRKRRRRSRVVLYPETSRKCRPRTER
QSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRSVFGQPAAVSRIMALLRDYLATHVHSHPLLLALHGPSGVGKSHVGRLLARHFRAVLEDGALVLQYH
ARHHCPELRPVQDCRKELAQRVADVVAQAEAEEKTPLLVLDEAELLPPALLDELHDLLQPQRSHHFHNAIYVLLSGAGGIEITHFVLQNASRMLPSLRHSVGRTQTEESP
ALEELQTSLRELLAREHPLWHTAAIVPFLLLDKPDVVNCFREEMAGEGFFPEQAQAEHLAEQLSYYHVAGHEFAITGCKQVVAKVNLLQHKPAHAGHESVGPGV*
52 >lcl|NP_001101411.1|Plus1176091..177596 NW_048032 DDB1 and CUL4 associated factor 12-like 1 Wdr40b __SEG__ ChrX {Rattus norvegicus} MRQADSQTQPSPAEQEMPQPAGPSNSSPPTMGPQQTGSRKRKAAEVDQGAGTSSSPGPAAAMATVGAGNAEGSLMLTKRPRRPIAHLSMVNYLKGRALGADGHPGFAGFE
GDLRSYGVLRLPELLRERQLTLGPLNKVFASQWLNARQVVCGTKCNTLFVVDVKTDHIMRIPLMRDRVPDLSRGPPSCGIHAVELNPSKTLLATGGENPNSLAVYQLPTL
DPVCLGDCQGHRDWIFAIAWMSDTVAVSGSRDGTVALWKVDPDMFNGSIAWHKDAGLPVYAHISPTDMEAIPKATTNPGNRKVRALAFSNKNQELGAVSLDGYFHLWKAR
SSLSRLLSLRLPYCRENVCLTYCDEFSLYAVGSQSHVSFLDLRQGQQNIPPLCSREGGTGVRSLSVHQHIVTVGTGHGSLLFYDIRAQKFLEERSAANPDMFPVPSGRKL
KLTCGSGWINQDDLLENYVAGVEDFPNALYTHCYNWPEMKLFVGGGPLASGLHGNYAGLWS*
53 >lcl|NP_001101414.1|Plus1complement(5751881..5753734) NW_047715 kelch-like 9 Klhl9 __SEG__ Chr5 {Rattus norvegicus} MKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGEEIFPVHRAMMASASDYFKAMFTGGMKEKDLMCIKLHGVNKVGLKKIIDFI
YTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYNLIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCSELELFKAAC
RWLRLEDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWKSL
APMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHA
GTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVV
GGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS*
54 >lcl|NP_001101570.1|Plus1complement(353682..355265) NW_047775 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 Dyrk2 __SEG__ Chr7 {Rattus norvegicus} MNDHLHISHSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLESIHRRQGSSTSLKSMEGMGKVKASPMTPEQAMKQYIQKLTAFEHHEIFSYPEIYFL
GPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFR
NHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPID
MWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQ
CLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTAVKRVTESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS*
55 >lcl|NP_001101721.1|Plus1complement(457971..459887) NW_048038 ubiquilin 2 Ubqln2 __SEG__ ChrX {Rattus norvegicus} MAENGESSGPPRPSRGPAAAPGAANPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQG
QATTQPSTTAGTSTTTTTTTTAAAPPAATTSSAPRCSTTATTTNSSNLGLGSLASLGNLGLNSSNFTELQNQMQQQLLASPEMMIQIMENPFVQSMLSNPDLMRQLIMAN
PQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFATVGSSSSSGEGTQPSRTENRDPLPN
PWAPPPTTQTSATTTTTTTSSGTVAGSNTSSTTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMAAQMMLSSPLFTANPQLQEQM
RPQLPNFLQQMQSPETIAAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGVGVGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPGSTGTGIPPAT
TVSSSAPTETISPTSESGPSQQFIQQMVQALTGGSPPQPPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS*
56 >lcl|NP_001102125.1|Plus1complement(23060101..23060850) NW_047710 pleckstrin homology domain containing, family F (with FYVE domain) member 2 Plekhf2 __SEG__ Chr5 {Rattus norvegicus} MVDRLANSEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGELRNGWLIKTPTKSFA
VYAATATEKSEWMNHINKCVSDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMAACQ
PTRSDSYSQSLKSPLNDASDDDDDDDSSD*
57 >lcl|NP_001102301.1|Plus1complement(43547199..43547897) NW_047334 potassium channel tetramerisation domain containing 11 Kctd11 __SEG__ Chr10 {Rattus norvegicus} MLGAMFRADTLMPANLNPQGDGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLKAEADFYQIRPLLDALRELEASRGTPASTAALLHADVDVSPRLVHFSARRGPH
HYELSSVQVDTFRANLFCTDPECLAAMRNRFGVASGDRAEGGPHFRLEWASRPQELPEVEYQRLGLQPLWTGGPEDRREVVNTPTFLEEVLRVALEHGFRLDSVFPDPED
LLNSRSLRFVRH*
58 >lcl|NP_001102378.1|Plus11758974..1759384 NW_047556 nanos homolog 2 Nanos2 __SEG__ Chr1 {Rattus norvegicus} MDLPPFDRWRDYFNLSQVVLGIIQSRKQRLEDEVSEELASRPQGMSERGLEVSPGSLATACNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLK
YCPLNSSQQSLYRRSGRNSAGRRVKR*
59 >lcl|NP_001102457.1|Plus110174789..10175385 NW_047773 DIRAS family, GTP-binding RAS-like 1 Diras1 __SEG__ Chr7 {Rattus norvegicus} MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLDELSPIYKLIVQIKGS
VEDIPIMLVGNKCDETQREVHTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRSVSLSVDGKRSNKQKRADRIKGKCALM*
60 >lcl|NP_001102488.1|Plus1complement(732783..733388) NW_048046 RAB9B, member RAS oncogene family Rab9b __SEG__ ChrX {Rattus norvegicus} MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYAD
VKDPEHFPFVVLGNKVDKEDRQVTTEEAQAWCMENGNYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKASSSCC*
61 >lcl|NP_001102621.1|Plus113473799..13474581 NW_047561 hypothetical protein LOC499209 RGD1559529 __SEG__ Chr1 {Rattus norvegicus} MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEIELSKAEKNA
MLNITLKQHVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSF
QAFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR*
62 >lcl|NP_001102632.1|Plus119996974..19998527 NW_047563 zinc finger and BTB domain containing 3 Zbtb3 __SEG__ Chr1 {Rattus norvegicus} MEFPEHSQQLLQSLREQRSQGFLCDCTVMVGSIQFLAHRAVLASCSPFFQLFYKERELDKRDLVCIHNEIVTAPAFGLLLDFMYAGQLALRGDTPLEDVLAAASYLHMND
IVKVCKQRLQARALAEADSTKKEEETNPASLEFLSGSSRGPQPLLASVEPSVRWSKEEWKGPATPLPIAHPADGPPVSGGADTTQPSMEVDSSHLRAPPPPVADVSVSLA
SPSSSTETTPVNYFSSGLPTVSVEPLTPLDVVPESLRVVEPRDTGGPLQGFYPPAPAPPPAPAPVLSQATAPVEAELVQVKVEAIVISDEETDLSEEQPQGSEGLFPSGG
AMYGGQPSQAEAFEEPGATGLEEVGPSDHFLPPEPHLPYHLLPGPGQYHRGLVTSPLPAPPALHEPLYPPSEYEAAQGSFGSFTEDVPTCKTCGKTFSCSYTLRRHATVH
TRERPYECRYCLRSYTQSGDLYRHIRKAHNEDLAKRSKPDPEASTILGVQPLSGSQTTERHSGGGGPPKDFVLGPKN*
63 >lcl|NP_001102644.1|Plus117421928..17423454 NW_047616 ankyrin repeat domain 34B Ankrd34b __SEG__ Chr2 {Rattus norvegicus} MDEGSEVSTDGNSLIKAVHQSRLRLTRLLLEGGAYINESNDRGETPLMIACKTKHVDQQSVGRAKMVKYLLENSADPNIQDKSGKSALMHACLERAGPEVVSLLLKSGAD
LSLQDHSGYSALVYAINAEDRDTLKVLLSACQAKGKEVIIITTAKSPSGRHTTQQYLNMPPADMDGSHPPATPSEIDIKTASLPLSYSSETDLTLFGFKDRELSGSSDNT
WDPDSPRRRPGMATNGPKLSQAPAWIKSTPSLKHQARVASLQEELQDISPEEEVAYKTNALALSKRFITRHQSIDVKDTVHLLRAFDQVNSRKMSYDEINYHSLFPEGNQ
SCVETPTDQDPDSSQIFASTLKNIVQKRNSGANHYSSDSQLAEGITPPTSEDGKASKKKIFAPSPSLLSGSKELVETAPPGPLSRRNHAVLERRGSGAFPIDHSLAQSRP
GFLPPLNVNPHPPITDIGVNNKICGLLSCGQKVLMPTAPIFPKEFKTKKMLLRRQSLQTEQIKQLVNF*
64 >lcl|NP_001102755.1|Plus111609563..11610831 NW_047773 hypothetical protein LOC500798 Fam148c __SEG__ Chr7 {Rattus norvegicus} MRKTNMWFLERLRGSGENGASRGVGGEAGDKTSKGPLYSNVLTPDKIPDFFIPPKLPSGPPEAEGQADLGPSTSEQNLASPGPRRAPRSPRLPVKLASESRNLLKAATRH
VIQIESAEDWTAEEATNADPQAQGAMSLPSVPKAQTSYGFATLAESPHTRRKESLFHSEHGALAQVGSPGASRRRAGAKANGGDGGSREVGGGLMSPSRYFSGGESDTGS
SAESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLKQSVGRHGSLSADDSTPDTSPGVRRRLTRRATPEPGPESGQAPRGEHTVRMGTRGSVRLLAEYEAAQARLRVRLLAA
EGLYDRPCDARSINCCVGLCLVPGKLQKQRSTIIKNSRHPIFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEEELPLTSLLPFL*
65 >lcl|NP_001102784.1|Plus1complement(7166441..7168453) NW_048032 zinc finger and BTB domain containing 33 Zbtb33 __SEG__ ChrX {Rattus norvegicus} MESRKLISATDIQYSASLLNSLNEQRGHGLFCDVTVIVEDRKFRAHRNILSASSTYFHQLFSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRADLLDELIKSGQLLGV
KFIAELGVPLSQVKSISGTVQDGTAETLPSSSNDKSPEIEKSKDEAQDNGAPVMPIITESFSLSAEDYEMKKIIVTDSDDDDDDDVIFCSEILPAKEDLPSNNTATQVQP
NPASVAISEVTPCTSSNSPPVTNITPPQLPTPVNQSTLSQAQGSEELLVSSASTHLTPNIILLNQAPLTAPPSVSSSLPNHMSSSVNVLVQNQQAPNSAVTGNKAEEEEE
ILDDDDDIISSSPDSAVSNTSLVPQADASKSTTFDGSLTQKMQAPILPQEPPSNSLKISDVITRNTNDPGLRSKHVMEGQKIITLDTATEIEGLSTGCKVYANIGEDTYD
IVIPVKDDPDGGEAKLENELPKTSGSEPSNKRMKVKHDDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYQCRYCDKVFPLAEYRTKHEIHHTGERRYQCL
ACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCKSLQIRQYAYLSNKPSAMPVMKDDAVGYKVDAGKEPPVGTTSAPPQNKSTFWEDIFIQQENDSIFKQNVTDGST
EFEFIIPESY*
66 >lcl|NP_001102845.1|Plus1376776..377459 NW_048035 hypothetical protein LOC679682 LOC679682 __SEG__ ChrX {Rattus norvegicus} MALPTKSSILDLSPGTQCSRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGVGKSALTIQMTHHCFVKDHDPTIQDSYWKEVALDNGGYILNVLDTAGQDSHRALRDQCL
AAGDGVLGVFALDDPSSLDQLQQICSTWNPHHKQPLVLVGNKSDLVSSAGDAHTAAAVLAHKLGAPLVKTSAKTRQGVEEAFALLVHEIQRAQEAVAESSKKTRHHKAVC
SCGCSVA*
67 >lcl|NP_001102981.1|Plus1complement(16457771..16458526) NW_047713 haloacid dehalogenase-like hydrolase domain containing 3 Hdhd3 __SEG__ Chr5 {Rattus norvegicus} MAHRLQMRLLTWDVKDTLIKVRRPVGEEYASKARAHGVLVEATAVEQAFRQAFRAQSHSFPNYGLSLGLTSRQWWMDVVLHTFRLAGVPDAQAMAPVADQLYEDFSSPFA
WRVLEGAETTLKGCRKRGMKLAVVSNFDRRLEDILTGLGLREHFDFVLTSEAVGCPKPDPRIFREALQLACVEPSAAAHVGDSYRCDYQGARAVGMHSFLVVGAEPLDSS
VRDAVPKEHILPSLSHLLPALDLLEASSPVS*
68 >lcl|NP_001103120.1|Plus128734865..28735644 NW_047454 potassium channel tetramerisation domain containing 4 Kctd4 __SEG__ Chr15 {Rattus norvegicus} MERKIIRREKEREYEGRHNSLEDAEQGKNCTSTLTTLNVGGYLYITQRQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLL
AQEAEFFQLKGLAEEVKSRWKKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSVSSNIIQFKYFIKSENGTRLVLKEDNTFVCTL
ETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK*
69 >lcl|NP_001116448.1|Plus112694221..12695534 NW_047779 tRNA wybutosine-synthesizing protein 2 homolog Trmt12 __SEG__ Chr7 {Rattus norvegicus} MERECEKSVVVAVVTEPRFTQRYRDYLEKQKLLDRQYRVEKLRDGTVALPVLAETLSEHHLQELKNRVAPGSTCKLTQLLDPLPSKKARVCSPAQRLCLEVRRWVEDRGV
TWSTELEADLPRSWQRHGDLMLLSEDCFQATQWKRLEPELWETVASALGVQRLAKRGRVLPDGTRTPTVTLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVAS
LSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRKNLEINGVADRCQIHFGDNRKLKLSNTADRVNLGLIPSSEEGWPIACQVLRKDVGGILHIHQNVE
SFSGKNPQPPGSSNMEKKHWPHPQKITTDKQGNRTTGSCMGEMSSASKPEWQRWAESAESQIASLLHQVHGKPWRTRILHVHPVKSYAPHVDHIVLDLECRPCPLVG*
70 >lcl|NP_001119774.1|Plus133005324..33006586 NW_047762 zinc finger and BTB domain-containing protein 42 LOC691556 __SEG__ Chr6 {Rattus norvegicus} MEFPEHGVRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDQPASSRDTVRLNGDIVTVPAFSRLLDFMYEGRLDLHSLPVEDVLAAASYLHMYDI
VKVCKGRLRKKDPDLETRTLGTELPGQTPHPLPSWPPAFCQATPKAKPPSLGVKAVHPLPKFGPPSWQVSEESSGALDLSLKPGPRPEQAHPPCLLQTSQCSSIQQGAQP
LVKAEQDSFSEQDSSSPQSADRSPPPVCASAARGLAVNLEPLHIQGTGSQQLGLHAEPVVDSEDLGPGRHLCICPLCCKLFPSTHALQPHLSAHFRERDSVRTRLSPEGA
VPTCPLCSKTFSCTYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHVRKFHYGLVKPLLV*
71 >lcl|NP_001121127.1|Plus1576591..576854 NW_047562 coiled-coil-helix-coiled-coil-helix domain containing 8 Chchd8 __SEG__ Chr1 {Rattus norvegicus} MSTSVPQGHNWTRQVKKDDEEEDPLDQLITRSGCAASHFAVQECMAQHQDWRRCQPQVQAFRDCMSAQQARRREELQRRKEQASAQH*
72 >lcl|NP_001124009.1|Plus131943..34078 NW_047778 zinc finger and BTB domain containing 39 Zbtb39 __SEG__ Chr7 {Rattus norvegicus} MGMRIKLQSSNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHKAVLACAAGYFQNLFLNTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYEVAERLG
MEDLLRACHSTFPDLESTTIAKSLTSTSDSPCVTLSCPSVDPTHPLGELRGSGEHFGPDRNYALPTDAGGSYKEEERAIAGDTNHSLPLPQVPLPPKSEDHDAPVPFTSV
PSMVTPPPVLGTVSTGIQTSTTSSCQPYKVQSNGDFGKSNFFTSDNALDITPQTNPCLSNNDQARDPGFGQMDELQLEDLGDEDLQFEDPAEDLGTTEEVIELSDDSEDD
LAFGDNRENKAMPCQVCKKVLEPNIQLIRQHARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFLFSCDMCETKFFTQWQLTLHRRDGIFENNVIVHPNEPLSGKLG
LFPGAASPELKCAACGKALAKDFHVVRGHILEHVSLKGQACSVCDQRHLNLCSLMWHTLSHLGISVFSCSVCASSFVDWHLLEKHMAVHQSLEDVLFRCHLCSQSFRSEA
AYRYHVSQHKCSSGLDPRPAVGLPHLALQKRKLPAEDFLSEELALQGQPGNSKYSCKVCGKRFAHTSEFNYHRRIHTGEKPYQCKVCHKFFRGRSTIKCHLKTHSGALMY
RCTVCGHYSSTLNLMSKHVGVHKGSLPPDFTIEQTFMYIIHSKEAEKNPDS*
73 >lcl|NP_001127983.1|Plus1complement(23526462..23526779) NW_047625 hypothetical protein LOC295019 RGD1307595 __SEG__ Chr2 {Rattus norvegicus} MTPIKLLVQPTQRPEGRTYAEYGSVNECMEGICKMYEEHLKRLNPLSQSITYGVSQLFEFIDRMVDLSCLVFREDTQTYKPHSREWVKERIYMLLSQQAQRDESE*
74 >lcl|NP_001128463.1|Plus1complement(648023..649402) NW_047597 zinc finger and BTB domain containing 12 Ng35 __SEG__ Chr20 {Rattus norvegicus} MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYL
QMEHVVEKCRNALSQFIEPKIGLKEDGISEASLMSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVA
HRLKPPGGLAGGLGIGASVGSHLGELAQSSVAPNTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAVAMAARGAGGSLGAGGSRGPLPGGFSSGNPL
KNIKCTKCPEVFQGVEKLVFHMRAQHFIFMCPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYCDVRFAHKPAIRRHLKEQHGK
TTAENVLEAGVAEINVLIR*
75 >lcl|NP_067700.2|Plus1complement(13840559..13841254) NW_047694 probable N-acetyltransferase CML1 Cml1 __SEG__ Chr4 {Rattus norvegicus} MPRFETQKSPMAPYHIRQYQDSDHKSVVDVFTKGMEEHIPSTFRHMLMLPRTLLLLLGVPLALVLVSGSWLLAVVCIFFLLLLLRFLAGQPWKEYVATCLRTDMADITKS
YLNAHGSFWVAESGNQVVGIVAALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTLQQGAMTLYLGMGFQKTGQRFLTMFWRLVGIR
TIQLKYPFPSA*
76 >lcl|NP_072157.1|Plus1complement(13781305..13781973) NW_047694 N-acetyltransferase 8 Nat8 __SEG__ Chr4 {Rattus norvegicus} MASFHIRQFQERDYEQVVDMFSRGMKEHIPTAFRHLLLLPRTLLLLLGVPLALVLVSGSWLLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFW
VAESGGQIVGTVGALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLVTGLLQQGAVTLYYSMGFQKTGESFMDILTWLVDVSLIHFIYPLP
SS*
77 >lcl|NP_445910.1|Plus1754482..755087 NW_048040 RAB9A, member RAS oncogene family Rab9a __SEG__ ChrX {Rattus norvegicus} MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYAD
VKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSDHLIQTDTVNLHRKPKPNSSCC*
78 >lcl|NP_445951.1|Plus14330047..4331171 NW_047688 mitochondrial transcription termination factor precursor Mterf __SEG__ Chr4 {Rattus norvegicus} MASRNIWRVRRNFLFDLRGWVPQYSAEVFLKSISFRPFSVECNSKDGENGDLLNNLLTMGVDVDMARRRQPGVFNRAVTNEQELKMFLLSKGASDKVIGSIISRYPRAIT
RTPESLSKRWDLWREIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTSAPRTFSNSLNLNKQMVEFLQETGISLGHNNPTDFVRKIISKNPS
ILIQSTKRVKTNIEFLQSTFNLDKEDLLLLICGPGARILDLSNDCTKRNYTNIKKRLLSLGCTEEEVQKFVLSYLNMIFLSEKKFNDKIDCLLEEKISTSQILENPRVLD
SSIHTLKTRIRELAHAGYDVSTSSIALLSWSQRRYEAKLKRLSG*
79 >lcl|NP_446200.1|Plus128463642..28465858 NW_047658 dipeptidyl peptidase III Dpp3 __SEG__ Chr3 {Rattus norvegicus} MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFG
DTKFVPNLPKEKLERVILGSKAAQQHPEEVRSLWQTCGELMFSLEPRLRHLGLGKEGVTTYFSGDCAMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKYHYEVRLASVL
NTEPALDSELTSKLKSYEFQGNHFQVTHGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIKSYRDPFGSRGEFEG
FVAMVNKDMSAKFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATKREKLTFMEEEDKDLYIHWKG
PSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLQIFGFEGTDAEDVIYVNWLNMVRAG
LLALEFYTPEKANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVHLDRSKIRSVGKPALERSLRRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRD
TVLLRKESRKLIVQPNTRLEGSEVQLVEYEASAAGLIRSFCERFPEDGPELEEVLTQLATADAQFWKDQVQEAPSGQA*
80 >lcl|NP_543160.1|Plus1complement(13761278..13761961) NW_047694 camello-like 5 Cml5 __SEG__ Chr4 {Rattus norvegicus} MALYQIRQYQERDHKHVVDLFSSGIKEHIPAAFRYTLLLPKTLLFLFAAPLTIVLASGSWLLAVVCIFFLLLLLRFLAGQPFKEYVAMCLQTDMADITKSYLNAHGSFWV
AESGGQVVGIVAALPVKESPSGRKQLQLFHLSVSSQCRGQGIAKALVRTVLQFARDQGYMDVVLETSIIQQGAMTLYEAMGFQRTGKNLENSIIKWLIGFFLFRFTYAFP
SAQEHEL*
81 >lcl|NP_596901.1|Plus137183653..37184204 NW_047625 RAP2B, member of RAS oncogene family precursor Rap2b __SEG__ Chr2 {Rattus norvegicus} MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVP
MILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL*
82 >lcl|NP_598242.1|Plus1complement(13862604..13863272) NW_047694 N-acetyltransferase 8B Nat8b __SEG__ Chr4 {Rattus norvegicus} MVSYHICEYQDSDYKSVVDVFTKGAEEYIPSTFRHLLLLPRTLLLLLGVSLALVLVSGSWLLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFW
VAESGEQVVGTVGALPVKEPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTMQIGAVTLYLGMGFQKTGQYFPSMLWRLVGIRFVQLNYSFP
SA*
83 >lcl|NP_872611.2|Plus113931551..13932132 NW_047693 ras homolog gene family, member A RSA-14-44 __SEG__ Chr4 {Rattus norvegicus} MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVLLICFSIGNPDSFGNIPHKWIPEVKHFCPNV
PIILVGSKKDLRNDLNTIQELAKRKQEPVKPEQGRDLANSIGAFEYVECSAKTKDGVRKVFEKATRAALQTNRVKKKTGCFVF*
84 >lcl|NP_998729.1|Plus11820703..1822100 NW_047597 zinc finger and BTB domain containing 9 Zbtb9 __SEG__ Chr20 {Rattus norvegicus} MDASTPLPPAPSSPRCNPAPQTIHIDFPHHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPNVIEADAFEGLLQLIYSGSLHL
PLDALPAHLLVASGLQMWQVVDRCSEILRELETSSGISSGGGASSLTLLSTTSAGGWCIRSSPFQNPGRSSASTENSAAPESPSGGEGGELEGMLQIQVKVEEEEEQRSA
APPFQTPQPERVSGAVSQACGSHPLPTSTLPSKPSEDENSTLDPPAPPVQTSQILYVNQENVECKEETSGGRTLSGGAKEKTKVLPGENSEENGELRYLLSSGGGETSGA
GDPSWKPVDLHGNEILSGGGGPGGTGQAMHGPVKLGGTPPADGKCFACLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHARALHACPHCGRRFR
VQAFFLRHRDLCKGQGWPTYHWTYK*
85 >lcl|XP_001053005.1|Plus19397499..9398143 NW_047471 high mobility group box 1 LOC678705 __SEG__ Chr16 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEIWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEEDDDDDDE*
86 >lcl|XP_001056973.1|Plus12138197..2139417 NW_048043 kelch domain-containing protein 2-like LOC679960 __SEG__ ChrX {Rattus norvegicus} MADGNEDARAEDMPGPAFEGYEAMELACPAERSGHVAVSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMESGRWKKINTEGDVPPSMSGSCAVCVDRVLYLFGGHH
SRGNTNKFYMLDSRSADRVLQWERIDCQGIPPSSKDKLGVWVYKNKLIFFGGYGYIPEDKVLGTFEFDETSFRNSSHPRGWNDHVHILDTETFAWSQPITTGKAPSPRAA
HACATVGNKGFVFGGRYRDTRMNDLHYLNLDTWEWNELIPQGICPVGRSWHSLTAVSSDHLFLFGGFTTEKQPLSDAWTYCISKNEWIQFNHSYVEKPRLWHTACASDEG
EVIVFGGCANNLLVHHRAAHSNEVLIFSVQPKSLVRLSLEAVICFKDMLANSWSCLPKHLLHSVNQRFGSNNSSGS*
87 >lcl|XP_001059167.1|Plus18361448..8362095 NW_047711 high mobility group box 1 LOC685520 __SEG__ Chr5 {Rattus norvegicus} MGKGDPKKLRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYH
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPCEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE*
88 >lcl|XP_001060839.1|Plus1complement(13830937..13831617) NW_047694 probable N-acetyltransferase CML4-like LOC681227 __SEG__ Chr4 {Rattus norvegicus} MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSWLLATVYSFLFLLCLRLLIWFSWRNYVAMCLKSDLADITKSYLNAHGSFWV
AESGGQVVGIVGSLPVKEPPSGRRQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLQTSSVQYSAMSLYQGMGFQKTGQHFMSITTRLIGLPIFHFTYSLPS
VWEPRM*
89 >lcl|XP_001064502.1|Plus111217151..11217513 NW_047813 Crx opposite strand transcript 1 LOC685604 __SEG__ Chr9 {Rattus norvegicus} MERSPRSLTSYTLGPLDQKYSWERLWELEQDFKREPYPDLKAQKFMATRLKLKEGQIGAWFIQRSLEQEMCPPLTRLQQSARGNTSSASHKALCCQPPSWKSRLIPINAP
ESSASCKHSC*
90 >lcl|XP_001067593.1|Plus11366296..1366616 NW_047365 HIG1 domain family, member 2A LOC688606 __SEG__ Chr12 {Rattus norvegicus} MVAPGPVSPEAPFDPSKAPVIEGFSPTVYTNPEGFKEKFIRKTRENPMVPIGCLGTAAALTYGLYCFHRGQSHRSQLMMRTRIAAQGFTVVAILLGLAASTMKSRS*
91 >lcl|XP_001069010.2|Plus120510009..20511373 NW_047492 serine/threonine-protein kinase MARK2-like LOC688970 __SEG__ Chr17 {Rattus norvegicus} MFWGLILNVCFISHYKFGSSHIKEGLIMEQDPESRDSIENFTTDYKIIRTLGRGRFSVVKMAYHVPTLTCVAIKVLKNTEKCSSVMSREVDILKSLGHPHIIKVVEVVQT
REATHLVMEHASQGDLLDRIRECGYLKSWEARRMFRQILEAVQFCHDNNIVHRDIKANNILIDGRWNAKLCDFGLAAKTLPGQKLIDFCGTLPYCAPEFFEAEEYEGRPF
DVWSVGVLLFFMVTGHLPFLGKSFAEVRRQISSANFSIPPHVANDIFNVIVEMLMINPSRRPSIQQIMMRPMIKDSQAYSPPTSIQTFTGTPSPSTIKAMRVMRHTPEKS
TESLIDQNINEVLATYLIQQHKPLRKVCTHHQVESGLEELHSFPRFLKRKGPLLSSFTLSSHSSNMRENEDRKNSRKVVRRHDVGYQQTRTNTLQLDLLDYPIAEEFKDN
RLQIRKTFSDCVVL*
92 >lcl|XP_001069647.1|Plus1complement(14158468..14159562) NW_047626 TDPOZ-T2-like LOC689129 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKICGYTHISVQKFCYKWTISNFSFWMDGIWENITSPVFSLETNEEVQWCLTIYPNGVDEESKDYLSVCLGLHSCPKSPVLAKFQCWIINAQGEKHHITKIPNV
IRFLPNEQWALRKFILRDFLLSHRHCLLPEDQLILCCKVSIVGPSFSRPGHNMRPAIKDATQMLADDVGELWENSLFTDCTLVVGGQEFRAHKAILAARSPVFRAMFEHE
MQEHLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADKYDLQDLKVICEDSLCRNLSVKNAVPTLILADLHSTEHLKTRAMDFIILHAFEVSETLEWKS
MVESHPHLVEEAFRTLASVHCFSLEPSLKRQKIV*
93 >lcl|XP_001069858.1|Plus1complement(2724342..2725976) NW_047652 zinc finger and BTB domain containing 34 Zbtb34 __SEG__ Chr3 {Rattus norvegicus} MARQTLVLATESQRAPFMLLALVEEPWRITGALCLCRLRLVSGEMDSSSFIQFDVPEHSSTVLSQLNELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTM
SGLSISVIKNPSVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQMQCVIDKCTQILESIHSKISVGDVDSVTIGAEETPESRNGVKDGSFFTSPVEISPPYCPQVRQPPV
SSDLRMETTPNKALRSRLQEEGHSDRGSSGSVSEYEVQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGEQVVAVNVGTYGSVLQHAYPYS
QAASQPSSVPEAFGGQTNSSPSRSMLSCFRGRGARQKRALSVHLHSDLQGVVQGSDSEAMMNNPGYESSPRERSARGYWYPYNERLICIYCGKSFNQKGSLDRHMRLHMG
ITPFVCKFCGKKYTRKDQLEYHIRGHTDDKPFRCEVCGKCFPFQGTLNQHLRKNHPGVTEGRGRMESPERTDVYGEQKLESDASASEMALDSRLEIHTVSDAPD*
94 >lcl|XP_001070260.2|Plus1complement(21319848..21320564) NW_047492 serine/threonine-protein kinase MARK2-like LOC689287 __SEG__ Chr17 {Rattus norvegicus} MAYHVPTLTCVAIKVLKNTEKCSSVMSREVDILKSLGHPHIIKVVEVVQTREATHLVMEHDSQGDLLDRIRECGYLKSWEARRMFRQILEAVQFCHDNNIVHRDIKANNI
LIDGRSNAKLCDFGLAAKTLPGQKLIDFCGTLPYCAPEFFEAEEYEGRPFDVWSVGVLLFFMVTGHLPFLGKSFAEVRRQIILANFSIPPHVANDIFNVIVEMLMINPSR
RPSIQQIMMCPMIKDSQA*
95 >lcl|XP_001070351.1|Plus1complement(15094277..15095359) NW_047626 TDPOZ-T2-like LOC689305 __SEG__ Chr2 {Rattus norvegicus} MSRDLEVKSCGYTHISVQNFCYEWAIRNFSFCMDGILENITSPGFSLEASEEVQWCLTIYPNGVDEESTDYLSVYLGLLSCPKSPVWAKVQFWIINAQGEKYVITKISDV
LRFLPNRYWGCKNFILRDFLLYHSHWLLPEDKLTLCCKVSIIGPYFSRPGQNMTPAIRDTMQILAEDLGELWENSLFTDCSLVVAGQEIRSHKAILAARSPVFRAMFEHE
MVDSLRNRIEIHDIHLQVFKEMMHFIYTGMVPHLHSHSMATGLLAAADKYALQGLKVMCEDALCSNISVKNAVPTLILADLHRAENLKTKAMDFIILHVSEVSDTVGWKS
MVESHPYLVEETFHSLASIHCPCLEPSLKC*
96 >lcl|XP_001070715.1|Plus1complement(15378924..15380018) NW_047626 TDPOZ-T2-like LOC689416 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKICGYTHISVQKFCYKWTISNFSFWMEGIWEIITSPVFSLETSEEVQWCLTIYPNGVDEESKDYLSVCLGLHSCPKSPVLAKFQCWILNAQGEKHHITKIPNV
IRFLPNEQWALRKFILRDFLLSHRHCLLPEDQLILCCKVSIVGPSFSRPGHNMRPAIKDATQMLADDVGELWENSLFTDCTLVVSGQEFRAHKAILAARSPVFRAMFEHE
MQEHLTNRIEIHDIHLQVFKELMAFIYTGKAPHLHSHSMATGLLAAADKYDLQDLKVICEDSLCRNLSVKNAVPTLILADLHSTEHLKTRAMDFIILHASEVSETLEWKS
MVESHPHLVEEAFRTLASVHCFSLEPSLKRQKIV*
97 >lcl|XP_001072450.1|Plus115018146..15019468 NW_047693 hypothetical protein LOC689900 __SEG__ Chr4 {Rattus norvegicus} MNTADDSTMDYRPIDDSTVDTAEDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTA
DDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTADTADDSTVD
TADDNTVDTADDSTVDTADDITVDTAHDSTADTAHDSTADTADDSTVDTADDSTVDTADDSTVDTADDSTVDTADDSTADTAHDSTVDTAHDSTADTADDSTADTAHDST
VDTADDSTVDTAHDSTVDTAHDSTVDTADDSTMNTADDSTVDTADDSTVDTAHDSTVDTAHDSTVDTADDSTMNTADDSTVNYSIMDDSSTEDSMANTADDNMARLQSSS
*
98 >lcl|XP_001079587.1|Plus1complement(46598167..46599339) NW_047657 kinase D-interacting substrate of 220 kDa-like LOC691770 __SEG__ Chr3 {Rattus norvegicus} MLKPKDLCPRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDPAMRSRFVRLLLEQGAAVNLRDERGRTALSLACERGHLDAVQLLVQYSGDP
EATDSAGNSPVMWAAACGHGAVLEFLVRSFRRLGLRLDRTNRAGLTALQLAASRGHGTCVQALTGPWGRAAAAAAARGSNSDSPPGHSAPVPSPERRRPSPRRLPRPLLA
RFARAAGGHGHGHGHGHGHGGELASAGKGSGRHRAQGSERPELGRSMSLALGTMTEEETARLRAGALMVRPNSPQSSGSGRWRSHEVLEGAPLALMQAPVGLSPHPEGGP
GSGRLGLRRRSTAPDIPSLVGEASGPESGPELENNALPFSVPGPKPWQAGTEAVVLQAQR*
99 >lcl|XP_002728195.1|Plus1178552..179268 NW_047437 similar to Acidic leucine-rich nuclear phosphoprotein 32 family member A (Leucine-rich acidic nuclear protein) LOC680377 __SEG__ Chr14 {Rattus norvegicus} MEMEKRILELQNRTPSDVTELVLDNCRPTEGKIEGLVDESEDLEFLSTINIGLTSVSNLSTLNKLKKLELSENRISGTWKY*QRIRTLSV*I*VATK*KISAQ*GHRRS*
RISGVYTVYG*GDQPEYLPRCVQVPAPGHVPRWLCQGQGGP*LGC*GLRGG*Q*GR*GGGRV**VCPASGRGRG*GGRRGGRGHEWEGGG*RRSRRQGSG*CGSEEDAGE
EGNQKQKQELDDEGEEDD*
100 >lcl|XP_002728801.1|Plus1complement(<7045547..7045987) NW_047558 high-mobility group box 1-like LOC691220 __SEG__ Chr1 {Rattus norvegicus} MSSYSFFMQTTRRSTGRSTWMLLSTSQSSPRSAQRGERPCLLKKRGNFEDMAKADNAHYEREMKTFILPKGETKKKFKDPNASKRPPSAFFLFFSEYCPKIKGEHPGLTF
CVVAKKLGEMCNNTAADDKQPCEKAAKLKEKYEKEQE
101 >lcl|XP_002728827.1|Plus13101611..3101955 NW_047562 rCG40612-like RGD1560664 __SEG__ Chr1 {Rattus norvegicus} MPKADKACYEREMKSYNIPHKGETKKYSRIPMCPRGCLYTSSCSVLSTAKKIKDEHPGLTFGDVAKKLGEMWNSTTLDGKQPCDKKAAKLKEKYKKDTAAYRAKGKSNAM
KGGG*
102 >lcl|XP_002728896.1|Plus1complement(14788598..14789203) NW_047563 hypothetical protein LOC100361288 __SEG__ Chr1 {Rattus norvegicus} MLSQDSNDITEDVSLFDAEEETTSRPRKSKIRHAVASFFRVSAVVVYLLCKPLSSSFIACMVTIILLLSCDFWAVTNVTGRLMVSLRWWNHIDEDGKSHWVFESRKSTPQ
DNKTISEAESRISWLGLIACPVLWVIFAFSALFSFRVKWLAVAIMGVVLQGANLYGYIWCKLGSKKNLTSMATSYLGKQFLRQNAGDGQTS*
103 >lcl|XP_002728924.1|Plus1complement(1933281..1933745) NW_047565 protein kinase NYD-SP25 LOC100360397 __SEG__ Chr1 {Rattus norvegicus} MDPSHLESHPSGQKSEPAGLDVSSTSPNCFSSNQGLDSVYQELDLDSLNEDLSLSVSDAMTETSASTNEFHLASEPDLTEAEQMELRSELTKLEEEILSLRDLLAAKEKR
CGELKRKLGCVALVGLXXXXXXXXXXXXXXXXXXGRLGKWAVNR*
104 >lcl|XP_002728997.1|Plus111720641..11721858 NW_047601 transforming growth factor beta regulator 1-like LOC100361475 __SEG__ Chr20 {Rattus norvegicus} MSVLSGLASEPRTPLSSKARMKRLPKKNQNEKYRLKYLRLRRAAKATVFENAVCDEIARLEEKFLKAKEERRYLLKKLLQIHALTEGEPQAAAPSHSSSLPLAYGVTSSV
GTIQGAGPSTGAEEPFAKKSKKEKKEKGKENSKLEVLKKTSKRKKMEGNARKLVRPIALDPSGQPVFPIGLGGLTVYSLGEIITNRPGFHDENAIYPVGYCSTRVYASMK
CPDQKCLYTCQIKDGGVQPQFEIVPEDDPRNTIVGSSADACYEELLRAISAATGKLMPNPLSCGADFFGFSHPTIHNLIQSCPEAQNCVNYQWVKFDACKPRKGQLSQEL
PENDAAMSLEAFPTQTFDDDHEDSILPGSLDLPELQHEAFVSSYQPEFLTHEPLVDTDLQHLKSPSQCSPIQSSD*
105 >lcl|XP_002729021.1|Plus1498066..499157 NW_047602 homeobox protein-like LOC100363047 __SEG__ Chr20 {Rattus norvegicus} MEAGSNVDSSCVLRESRRRKTVWQAWQKKALLTAFSKNQYPSFWDRQELARQIQLPASRIRVWFQNQRSRTGEVRHGPKRSSRGSIPLASQQLEEVFGSRSQGSSMPSDS
RRPCTRLNLQQLRILVQAFERNPLPGFATREQQGQRTGLSEDTIHIWFQNRRSRQALAPDQDVPPSQVEIVATGGLSGRDEAVQDNLLTMATAGGVGMENSSSSDQPHIH
KNSQHPQVALPEGRGQSQTATQAYEPGSLELLLDKLLEEDQVEGDRPFPVDLDGNSRGKEHVGVQETILQLAATDCVSKESSSYSDPTNFSRESQLPQWAQPEGQCQEQA
LTQGCNTGPLELFLDQLLMEVRVETHSPGPVHL*
106 >lcl|XP_002729022.1|Plus1complement(567945..568736) NW_047602 homeobox protein-like LOC100363299 __SEG__ Chr20 {Rattus norvegicus} MEAGSNVDSSCVLRESRRRKTVWQAWQKKALLSAFSKNQYPSFWDRQELARQIQLPASRIRVWFQNQRSRTGEVRHGPKRSSRGSIPLASQELEEGFGSRSQGSCMPSDS
RRPRTRLNLQQRRILVQAFERNPLPGFATREQLGQRTGLNEDMFDIWFQNRRARQARAPDQDVPASQVQDVATGGHSGKDEAAPDNLLLMAAAGGVGMENSSSSDQPHFH
EESQHPQVALPEGRGQSQTATQAYEPGTLELQCVCALLCVCYF*
107 >lcl|XP_002729030.1|Plus11057..2229 NW_047611 homeobox protein-like LOC100359610 __SEG__ Chr20 {Rattus norvegicus} MEAGSNVDSSCVLRESRHRKTVWQAWQKKALLSAFSKNQYPSFWDRQDLARQMQLPASRIRVWFQNQRSRKGEVRHGPKRSSRGSIPLASQQLEEGFGSRSQGSSMPSDS
RRPRTRLNLQQGSILVQAFERNPLPGFATREQLGQRTGLNEDTIHIWFQNRRARQARAPDQDVPASQVQDVATGGLSGKDEAAPDNLLLMAAAGGVGMENSSSSDQPHFH
EESQHPQVALPEGRGQSQTATQAYEPGTLELLLDELLEEVQVEGDRPFPVDLDGNPGGKEHGVVQETILQLAATDCVSKESSSYSDPTNFSRESQLPQWAQPEGQGQEQA
LTQGCNRGPLELFLDQLLMEVRVETLSPGPVHLEGAVQQMHATPELPLSQEEYEALLDIL*
108 >lcl|XP_002729124.1|Plus114024732..14025814 NW_047626 TDPOZ-T2-like LOC100362670 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKSCGYTHISVQKFCYEWTISNFSFCMDGIRENVTSPRFSLEASEEMQWCLRIFPNGVDEESKNYLSVYLGLLSCPKSPVWAKVQFWIINAQGEKYLLTKMSNV
LRFLLNQYWGYKKFILRDFLLSHRHRLLPEDQFTLCCKVSIVERSFSMHGDNMRPAIKDPRQMLVNDIGELWENSLFTDCSLVVAGQEFRSHKAILAACSPVFRAMFEHE
MLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSRSMATGLLAAADKYDLQGLKGMCEDALCRNLSVKNAVPTLILADLHKTEHLKTRAMDFIILHASEVSDTVGWKS
MVESHPHLVEEAFYSLSSIQCPGFEPSLEC*
109 >lcl|XP_002729142.1|Plus1complement(13449826..13450419) NW_047626 RAF domain and POZ/BTB containing protein T2-like LOC100363449 __SEG__ Chr2 {Rattus norvegicus} MTPANKDPRQMLADDVGELWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHEMLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSHSMATELLAAADMYDL
QDLKVMCEDSLCRNLSVKTAVPTLMADLHSTELLKTRVMDFIILHASEVSETLEWKSMVESHPHLVEEAFGSLASMHYFFLEPSLKR*
110 >lcl|XP_002729143.1|Plus1complement(13667542..13668621) NW_047626 TDPOZ-T2-like RGD1560661 __SEG__ Chr2 {Rattus norvegicus} MSRDLKFKSCGYTHSSVQKFCYEWTISNFSFCMDGNLENITSPVFSLEANEEEMQWCLRIHPNGIDEESKDYLSVYLWLLSCPESPVWATFQFWIVNAQGEKYQIIKVPN
VLKFLPNQQWGHKKFILRDFLLFYRHWLLPEDQLTLCCKVCIVGPVFSRPGQNMTPAIRDPRQMLADDLGELWENPLFTDCTLLVAGQEFRDHKAILAAHSPVFRAMFEH
EMLESLTNHIEIHDIHLQVFKEMMPFIYTGKAPHLHIHSMATGLLAVADMYDLQDLKVMCEDALCRNISVKNAVPTLILSDLHSADHLKTKAMDFIILHASEFSETMGWK
SMVESYPHLVEEAFHSLSSIQCPFFVALT*
111 >lcl|XP_002729144.1|Plus1complement(15126095..15127174) NW_047626 TDPOZ-T2-like RGD1560477 __SEG__ Chr2 {Rattus norvegicus} MSRDLEFKRCGYIYSSVQKFCYEWTISNFSVCMDGILENITSPVFSLEANAEEMQWCLRIHPNGIDEESKDYLSVYLWLLSCPESPVWATFQFWIINAQGEKYQIIKVPN
VLKFLPNQKWGHKKFILRDFLLFYRHWLLPEDQLTLCCKVCIVGPVFSRPGQNMTPAIRDPRQMLADDLGELWENPLFTDCTLVVAGQEFRDHKAILAAHSPVFRAMFEH
EMLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHIHSMATGLLSVADMYDLQDLKVMCEDALCRNLSVKNAVPTLILADLHNADHLKTKAMDFIILHASEFSETMGWK
SMVESYPHLVEEAFHSLSSIQCPFFVALT*
112 >lcl|XP_002729221.1|Plus14913784..4914077 NW_047656 alkylglycerone phosphate synthase-like LOC100360503 __SEG__ Chr3 {Rattus norvegicus} MVARGAALSDLSPAPSGLGRQHKAEAMAEAAGEAGASERDPDAVRARRRLRVLSGHLLGRPQEAPSTNECKARRAASAAGASPAASPAAPESGTIPKK
113 >lcl|XP_002729522.1|Plus1complement(1008592..1009983) NW_047712 heterogeneous nuclear ribonucleoprotein K LOC100359916 __SEG__ Chr5 {Rattus norvegicus} METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEE
GLQLPSPAATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKG
RAQPYDPNFYDETYDYGGFTMLFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGWPG
DRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDWIITITGT
QDQIQNAQYLLQNSVKQYSGKFF*
114 >lcl|XP_002729601.1|Plus1complement(2714490..2716811) NW_047726 rCG31274-like Klhdc7a __SEG__ Chr5 {Rattus norvegicus} MLPTRKGTEAHDWHLDMQLTSKVVLSAAALLLVTVAYKLYKSRPAPAPHAGRKKERHKAENETEGLGQPAFQEAPPGTLPRGPRRRKASKGAGSPLDYSLEDPGDSYILD
TPRSEEPTRKGSDESQDRQRPDSQQVPPPCGGQEAGTAVRGKPNPPHPLHSGCEPTSSPARLIPGVGGSCVGDNLSPWPDSRPLEETGSGDPEAPNCWTDPTLVNGDMNQ
SWIFTHMTGVSRGEAGALQAAANMGLATQQQEGATSASHTFSSVARIRMEENVIQKAEGPELKGRIYDYFVESTSKAVSRPVPCAAALADAAPSPGPGPEPLVTGAATRD
QADNTAGGTLQVASPQPVPSPSAPGFGRKVSLLQIAENPELQLQPEGFRMPLPAHLDQSAQLGSDCSHGEPHVQLVAGTNFFHIPLTPASALDVRLDLGNCYEMLTLAKR
QGLEALKEAAYKVLSDNYLQVLRSTDIYGGLSGAERELILQRRFRGHKCLVVADMCPQEDSGRLCCYDNVQDAWHPLAQLPLEAMSRGCALCSLFNYLFVVSGCQGPAGQ
PSNRVFCYNPLTAIWSEVCPLNQARPHCRLVALEGYLYAIGGECLNTVERYDPRLDRWTFAPPLPNDTFALAHTATVCANEIFVTGGSLRYLLLRFSAQEQRWWAGPTAG
SKDRTAEMVAVNGFLYRFDLNRSLGISVYRCNASTRLWYECATYRLPYPDAFQCAVVDDRIYCVGRRRTLCFLADHISPRFVPNELQGFPAARGTLLPAVLTLPVPDVPQ
TPV*
115 >lcl|XP_002729904.1|Plus15790238..5790819 NW_047784 methyltransferase like 7A-like LOC100362962 __SEG__ Chr7 {Rattus norvegicus} MTLAILALRLVVCTLSFPLFLLNLIGVWSWVCKRCFPYFLKRFTVMYNEQMATRKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLFKS
VAENRHLQFERFLVAVGEDMHQVADGSVDVVVCTLVLCSVKSQEKILREVCRVLRPVSDRCEDWLAAAIMSEGGTISFEWILN*
116 >lcl|XP_218667.4|Plus1complement(13883951..13885435) NW_047544 MAP/microtubule affinity-regulating kinase 3-like RGD1560303 __SEG__ Chr1 {Rattus norvegicus} MNSESEDESSEPSTRSLGLFSEEVFTRQYTILKPLGQGGTTEVRLSSHRLTGTPVAVKALVKHERHWASTMSEVEIMKILNHNNIVSLLQVMETEQNIYIIMEVAQGDSL
LNRVQKAGRLKEDEARGIFVQLLSALGYCHGKGIIHRDLKPDNIIVDEHGNVKIIDFGLGAKFLPGQKLKRLCGAFQFIPPELFLGLPYDGPKVDIWALGVLLYFMVTGF
APFSGTTLSELSKNVLQGRYDIPYNLSKDLRSMISLLLTVNARQRPTAQDLSSHPWLQEWGKTLTFHSNRDTSFPNRDIMVAMENIGFHVQDIKESLKHKKFDETMATYL
LLRVQACQNGGNYVQTKLLNPGVAPFPSAADPDTFPLPPRRRASEPSLKIVVASSEQQRLRQSGGTNAPVQPKKTPVMGRGYKRCVTDPCILRRNTGMNVDTISFSASSQ
TLSDSERSRSLQPRGWAKWKKRIRACVRTLCCCLSPHKICPRKVCPQKRGDTIR*
117 >lcl|XP_218822.2|Plus116401401..16402558 NW_047560 hypothetical protein RGD1560277 __SEG__ Chr1 {Rattus norvegicus} MAVPHRSQETSYLLPPNPEDWEEQGIPDFVYGQKDLVSKEIQWPKNSPSALNSLPLSRFDSALCSAWRQRVELGLFRYRLEDLQTQILPGSVGFVAQLNIERGIQRRRPQ
NIKSVRQEFDPEQFNFNKIRPGEVLFRMQREPNGPAAPKQEDVLVVINVSPLEWGHVLLVPTPAHGLPQRLLPGVLRVGLEAVLLSQHPGFRVGFNSLGGLASVNHLHLH
GYYLAHPLPVEGAPSTPLDPKGYIHLLQALPAPGFLFYTSGPGPDLEALISRVCQATDYLSDHEIAHNLFVTRGAPPGQASSTSDLSGIRVILWARKSSFGIKESGAFNV
ALCELAGHLPVKTSQDFSSLTEAAAVALIQDCLLPQTQADEVQAALVALMAQEEL*
118 >lcl|XP_223228.1|Plus11947640..1949943 NW_047423 ankyrin repeat domain 56 Ankrd56 __SEG__ Chr14 {Rattus norvegicus} MAGELSQEALLDFLCQAGGRVRNAELLSHFKSFLRDPHVPSGQLQERRELFKGFVNSVAAVRQDPDGTKYVVLKRRYRDLLGEEGLQRPAPTDQQPRSHRRLDPEPQKPP
AGAGTRVDVGDDELVGSSARKAAGPDPGPGDSPSQRTLGPEAAQARGRCAAVGTRGRCCWECQQNGWGQPTEQPLPEDLGDPAAACEKPERAAPARDDLGAPGWLREGAA
AERSPESVTPVWAPAAVEAAGSPTSPPALPPHPAPSREPLELFTAGFPNHSTQQLQQQQQRTREWVARYPLAPEAGIQGPIRAWSVLPDNFLQLPSETAFGVSETNSALP
EPALSFHSLLPGVPDESSESWPGNPPLTVFRSIRCQLSLQDLDDFVDQESHGSEESSSGPKESPGTPEEGLQTVLRTSSWGELRDPVEDQFVSPNEGSPCLIPRGLRNRG
NVPSFRKAPTVAKSLGDHPQETFPAPKFRRSVRRSSRTGRTKSPSSSDEEHLDEDLLKRSRRPPRSRKPSKAGALPSPRVDVVLIQKLANANAVTGQPHSSWVPGRDGSA
ALIPHRPSEHRSPLVPLDAREHEWIVRLASGSWFHVQMLFWEDPQLALYRDFLTGYTALHWIAKHGDLNALQDLVSGARKAGVALDVNVRSSCGYTPLHLAAMHGHQGVI
KLLVQRLASRVNIRDCSGKKPWQYLNSNVSGETWQLLGAPRGKPIFPVYSLVQSSSPARKVKSREVSRTVTRKTSLAALLKTQHNKWKLASQYEKFHTPKDREEYSD*
119 >lcl|XP_223417.1|Plus1complement(12073322..12074218) NW_047425 mitochondrial carrier triple repeat protein 1-like RGD1565119 __SEG__ Chr14 {Rattus norvegicus} MMGSEAHDKRPPMLTSSNQDLSPHLADMGQIKHYFCGCCAAFTNVAITYPVQKILFRQQLYGIKTRDAILQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLR
KHVSNAPEFATRSVAALLAGTTEAILTPLERVQTLLQDHKHHDKFTNTYQAFRALRCHGVAEYYRGLVPILFRNGFSNILFFGLRGPIKEHLPTATTQSAHLVNDFICGG
VLGAMLGFLSFPINVVKARIQSQIGGPFQSLPMVFKTIWIERDRKLINLFRGAHLNHHRSLISWGIINATYEFLLKIV*
120 >lcl|XP_223434.2|Plus1complement(1607950..1608855) NW_047426 mitochondrial carrier triple repeat 2 Mcart2 __SEG__ Chr14 {Rattus norvegicus} MLGSEAHDKRPPMLTSSNQDLSPHLADVGQIKHYFCGCCAAFNNVAITYPVQKIFFRQQLYRIKTWDAILQLRKDGFRNLYRGIFPPLMQKTTTLALMFGLYEDLSCLLR
KHVSNAPEFATRSVAALLARTTEAILTPLERVQTLFQDHKHRDKFTNTYQAFRALRCHGVAEYYRGLVPILFRNGFSNILFFFFFGLRGPIKEHLPTATTQSAHLVNDFI
CGGVLGAMLGFLSFPVNVVKARIQSQIGGPFQSLPMVFKTIWIERDRKLINLFRGAHLNHHRSLISWGIINATYEFLLKIV*
121 >lcl|XP_225362.4|Plus1complement(4672408..4673688) NW_047492 zinc finger CCCH domain-containing protein 15-like RGD1564243 __SEG__ Chr17 {Rattus norvegicus} MPPKKQAQARGSKKAEQKKKEKIIKEKNFELKNKKVAKQQKFIKAVIHQVTFGQQNPRQVAQNEAEKKLKKDDKKKELQELNELFKQVVTAQKISKGANPKSVVCAFFKQ
GQCTKGDKCKFFHDLTLERKCEKQSVYIDARDEELEKDTADNWNEKRLEEVVNKRHGEAEKKKSKTQIVCRHFLEAIENNKYRWFWVCLGGEDNSMYRHALPPGFVLKKD
KKKEEKENEISLDDLIERERSAPVPNVTKITLESFLAWKKRKRQEKIDKLEQDMERQKDYFKAGKALVTSGREVFEFHPELVNDDDVEADDTRYIQRTEGDEVDDSMGVN
DIDLSLYIPRDVEETGITMASLERFSTYASDKDENKLSEASGGLAENGERSDLDKDSGGEEQENGSIDAVPVDENLFTGEDLDELEEELNTLDLEE*
122 >lcl|XP_227347.2|Plus113371695..13372789 NW_047626 TDPOZ-T2-like RGD1564386 __SEG__ Chr2 {Rattus norvegicus} MSGDLEDKICGYTHISVQKFCYNWTISNFSFCMDGIQESITSPVFSLEANEEVQWCLTIYPNGVDEESKDYLSVCLGLHSCPKSPVLAKFQCWITNAQGEKHQITEIRNV
IRFLPNEQWALRKFILRDFLLSHRHWLLPEDQLILCCKVSIVGPSLSRPGHSMRPEIKDPTQMLADDVGELWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHE
MLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADKYDLQDLKVICEDSLCRNLSVKNAVPTLILADLHSTEHLKSMAMDFIILHASEVSETLEWKS
MVESHPHLVEEAFCTLASVHCFSLEPSLIRQNVF*
123 >lcl|XP_227350.4|Plus1complement(13454763..13455857) NW_047626 TDPOZ-T2-like RGD1563451 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKISGYTHISVQRFCYKWTISNFSFCMDGIRENITSPVFSLEGNEEVQWCLRIFPNGVDEESKDYLSVSLGLHSCPKSPVLAKVQFWIINAQGEKHQIKEIPNI
LSFSPKHQWGLRKFILREFLLSRRHGLLPEDQLILCCKVSVVGPSFSTPGHNMTPTNKDPRQELADDIGELWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHE
MLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSHSMATELLAAADMYDLQDLKVMCEDSLCRNLSVKTAVPTLILADLHSTELLKTRVMDFIILHASEVSETLEWKS
MVESHPHLAEEAFLSLASIQCSSLEPSLKRQKVF*
124 >lcl|XP_227351.2|Plus113504222..13505304 NW_047626 TDPOZ-T2-like RGD1565369 __SEG__ Chr2 {Rattus norvegicus} MSGDLESKICDYTHISVQKFCYKWTISNFSFCMDGIYEIITNPVFSLEANEEVQWCLRIFPNGVDEESKDYLSVCLGLLSCPKSPVWAKVQFWIINAQGEKHQITKIPNV
LRFLANQHQGVRKFILRDFLLSHRHWLLPEDQLILCCKVSIVGPSFSRPEQNMTPAIKDPTQMLANDVGELWENSLFTDCSLVVGGQEFRAHKAILAARSPVFRAMFEHE
MLENLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADKFDLQHLKIMCEDSLCRNLSVKNAVPTLILADLHSAEHLKSMAMDFIILHASEVSKTLEWKS
MVESHPHLVEEAFHSLASMQCFFLEPSLKR*
125 >lcl|XP_227352.1|Plus1complement(13528108..13529184) NW_047626 TDPOZ-T2-like RGD1560109 __SEG__ Chr2 {Rattus norvegicus} MTGDLEAKICGFTHISVQNFSYEWTISNFSFCMDRIWKIITSPVFSLEANEELHWCLRIYPNGVDEESKDYLSLSLGLLSCPKSPVLAKLHFWILNAQGEKHQITKIPNV
LRFPPNEQWGLRKFILQDFLLSHRHWLLPEEQLILCCKVSIIGPCFSRPGQNMTPAIKDPRQILADDVGELWENSLFTDCSLVVAGQEFRAHKAILAGHSPVFRAMFEHE
MQERLTNRIEFHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADMYDLQELKDMCEDSLCRNLSVKNAVPTLILADLHSTKHLKTRAMDFIILHASEVSETVGWKS
MVESHPHLVEEAFYSLSSIQCPGLEPSL*
126 >lcl|XP_227852.1|Plus1complement(14804271..14805353) NW_047626 TDPOZ-T2-like RGD1563455 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKSCGYTHISVQKFCYEWTISNFSFCMDGIRENVTSPRFSLEASEEMQWCLRIFPNGVDEESKNYLSVYLGLLSCPKSPVWAKVQFWIINAQGEKYLLTKMSNV
LRFLLNQYWGYKKFILRDFLLSHRHRLLPEDQFTLCCKVSIVERSFSMHGDNMRPAIKDPRQMLVNDIGELWENSLFTDCSLVVAGQEFRSHKAILAACSPVFRAMFEHE
MLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHSRSMATGLLAAADKYDLQGLKGMCEDALCRNLSVKNAVPTLILADLHKTEHLKTRAMDFIILHASEVSDNVGWKS
MVESHPHLVEEAFYSLSSIQCPGFEPSLEC*
127 >lcl|XP_227869.3|Plus115227785..15228879 NW_047626 TDPOZ-T2-like RGD1562014 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKICGYTHISVQKFCYKWTISNFSFWMEGIWEIITSPVFSLETNEEVQWCLTIYPNGVDEESKDYLSVCLGLHSCPKSPVLAKFQCWILNAQGEKHHITKIPNV
IRFLPNEQWALRKFILRDFLLSHRHCLLPEDQLILCCKVSIVGPSFSRPGHNMRPAIKDATQMLADDVGELWENSLFTDCTLVVSGQEFRAHKAILAARSPVFRAMFEHE
MQEHLTNRIEIHDIHLQVFKELMAFIYTGKAPHLHSHSMATGLLAAADKYDLQDLKVICEDSLCRNLSVKNAVPTLILADLHSTEHLKTRAMDFIILHASEVSETLEWKS
MVESHPHLVEEAFRTLASVHCFSLEPSLKRQKIV*
128 >lcl|XP_228797.1|Plus1502192..503688 NW_048036 GCL (Drosophila germ cell-less) homolog family member (gcl-1)-like RGD1564931 __SEG__ ChrX {Rattus norvegicus} MGLLNSRVLRSGDSSLVEPQPEATAGPSGQSGSRKRKLSNSVNLGPSPDIHGPQNQGFSLHQVLNYIYRKRVKISSNYAYENLFLNGNDSDIKICALGRTWCLHKVFLCH
SGYFANILKGIWKESRNGVIRLLIRNEDIDTRSLHFVFGSLYTDENLSLTPLEVPRVLAAACLLRVDRVIRQCEEIMKTTINRNTACSYYLAAETYRLKAVKTECFQWLL
HNLMVHPSVALYKAVDLKLMYLLTSSSHLLVMQKEIDVYTTLKTWMFLYLNPCWNGTMKELLDHTNNWLYTYMGYIDNISFLESEEGLIFQPVFKKLRFQHIICDLASTS
VLERDRLIPAEWLSPIYKHQWLTLLRAQEYGTIGPQTINEEELEQNTMRCGKRIPRDGRYTWKWSAGRLCFPLRVTFTSHGVILRQRHQECDGSSCQNHIRNVVFRITLV
CFDSNEKITFIKTTGYKILTFEFNEEQIVMKLDAEVLTFPLYIFGNFLFLNLGNAENK*
129 >lcl|XP_232330.5|Plus18928759..8929961 NW_047696 F-box and leucine-rich repeat protein 14 Fbxl14 __SEG__ Chr4 {Rattus norvegicus} METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGH
AFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSL
KHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMH
GLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKVR*
130 >lcl|XP_232819.3|Plus1694891..697422 NW_047711 RNA binding motif protein 12B Rbm12b __SEG__ Chr5 {Rattus norvegicus} MAVVIRLQGLPFIAGPVDIRHFFKGLTIPDGGVHVIGGKAGEAFIIFATDEDARRAISRSGGFIKDSSVELFLSSKVEMQKTIDMKRSARVGRGRPGPEASGVGNMYHFI
DALKEEERYSGYGSAVNPDAGFHINGTGLDLRPRKTRPLKAENPYLFLRGLPYLVNEDDVRVFFSGLCVDGVILLKHHDGRNNGDAIVKFASCVDASGGLKCHRSFMGSR
FIEVMQGSEQQWIEFGGTASKGGDTLHKRSEEHSPSRRLNDRYFWKRSRSKSPRTRSRSPLGFYVHLRNLSLHTNKRDLRYLFRDTDLSNDQIKFLYKDDRRTRYAFVMF
KNQKDYNTALGLHKTVLQYRPVLIDPISRKEMVKIIECYEKKRPESLEEERPGRVSQKYSEEGFPGSGQKLCIYIRNLPFDVTKGEVQKFFADFSLVEDDIYLLSDDKGI
GLGEALVRFKSEEQAMKAERLNRQRFLGTEVLLRLISEEQMQEFGVNFSWMSNEKTQACSRSHDGDDCSCLFDLKDPLATGQSFGQSESIRYQPKDFRKMGHFKHPRGYF
QQSDRHSPEDFRHSPEDFGHPREEHSRRSREEDWRRPLEDWKWPLEDDFRQSREKDCRQLPEKDFRCPWEEDFRRPSQEHFRRSYQEHIRQPPHEHFRYSREEDSRHVAD
EDFRYPADEDFRTSQEDLRCPTDEDFRQVCLEDHREVPEGDLRRSDKFRLPGEDFWTSSDFRGHHPFVNFGHLEGGKFDFGKYNIGCFSEGKVASDLNLNCRSGGIIRVM
ISNLPFKANANEILDFFHGYKVIPDSVSIQYNEEGLPLGEAIVAMTNYNEALAAVKDLSGRPVGPRKVKLSLL*
131 >lcl|XP_236503.5|Plus1<16927797..16928855 NW_047800 progestin and adipoQ receptor family member IX Paqr9 __SEG__ Chr8 {Rattus norvegicus} RSHPSSVPRSQPAATTKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLASVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLGGSDVPFHHPWLLPLWCYASGVLLTFAM
SCTAHVFSCLSLRLRAAFFYLDYASISYYGFGSTVAYYYYLLPSLSLLDARVMTPYVQQRLGWHVDCTRLIAVYRALVLPVAFVLAVACTVACCKSRTDWCSYPFALRTF
VFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTVGYMLL
LVVCLGLVIRKFLNSTEFCSKK*
132 >lcl|XP_343852.3|Plus1512743..514182 NW_047332 sperm motility kinase 2B-like RGD1559876 __SEG__ Chr10 {Rattus norvegicus} MCGLKGEVTAGPTLPYETLGAQYVILRTIGQGSYGQVKLAHHRLTGTAVAIKVLLKERTQYYPIRTEVGILKKMNHPNIISLHQIIETEQNIFLILELADGRELFDWIEK
SGHLHEGLARKIFIQIVHAMSYCHDIGIVHRDLKPDNIMVDASGKVKIVDFGLGALVTPGMKLSEHCGALRFCAPEFFLNQPYDGTKVDTWNIGVVLYFMVTGDLPFVGT
TLKELGNQVLLGRYAIPRHLSKELREIIRYLLTVNPTERPTLKDIMTHPWLKQGNAGFLSHCDKIDSSHLDPAIIAAMADMGFDPCVVQKSLVDKLYNEPMATYGLLKRQ
AGKQDDHTSQPEPVQPGLTPFPTLTDPTSFPSYREQTTDRPAIRAFLSLSSKTDSSKDKEHGGQRLRRSATAPIMPPHCPQKRIIIFSDERVNNRRQHNSTMDSIRGAYR
SWKRWTGRIGASLLQLCCCCCCCCCIPLKNNRVVPQMEA*
133 >lcl|XP_344451.4|Plus1complement(58848794..58849777) NW_047454 potassium channel tetramerisation domain containing 12 Kctd12 __SEG__ Chr15 {Rattus norvegicus} MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPER
SRLQREAEYFELPELVRRLGAPQQPGPGPPPPHSRRGVHKEGSLGDELLPLGYAEPEPQEGASAGAPSPTLDLASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSY
TIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQAFDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE*
134 >lcl|XP_344620.4|Plus1complement(21061106..21062950) NW_047492 serine/threonine-protein kinase MARK2-like RGD1566040 __SEG__ Chr17 {Rattus norvegicus} MFWGLFLNVCFISHCKFASSLIKEGLIMEQDPESRDSIENFTTDYKIIRTLGRGRFSVVKMAYHVPTLTCVAIKVLKNTEKCSSVMSREVDILKSLGHPHIIKVVEVVQT
REATHLVMEHASQGDLLDRIRECGYLKSREARRMFRQILEAVQFCHDNNIVHRDIKANNILIDGRSNAKLCDFGLAAKTLPGQKLIDFCGTLPYCAPEFFEAEEYEGRPF
DVWSVGVLLFFMVTGHLPFLGKSFAEVRRQISSANFSIPPHVANDIFNVIVEMLMINPSRRPSIQQIMMRPMIKDSQAYSPPTSIQTFTGTPSPSTIKATRVMRDTPEKS
TESLIDQNINEVLATYLIQQHKPLRKVCTHHQVEPGVEDLHSFPRFLKRKGPLLSSFTLSSHSSNIREKEDRKNSRKVVRRHAVGYQQTRTNTVQLDLLDCPIAEEFRDN
RLQIRKTFSDSKTVLSCSLTEHIQSPRLQYTYSTTADRNVSSFIPPHDFCASLQTPKGISLAGCSGDTWQRETLVDKNTFIKEEAMVHEDTVTSGQPQVPCPASRRGWRH
HWKGFKKTISRSLRNLCCCLPPPSENQVSCNNLALRKRGEHCVTHRTRWVHVLIHFIHIPSCPL*
135 >lcl|XP_345238.1|Plus1complement(13188767..13189861) NW_047626 TDPOZ-T2-like RGD1564513 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKSYGYTHISVQKFCYEWTISNFSFCMDGIRENIASPVFSLEASEEVQWCMRIHPNGVDEESKDYLSVYLSLVSCPESPVWAKVQFWIINAQGEKHQVKKIPNV
LRFLPKEQWGYKKFILRDFLLSHRDWLLPENQLTLCCKVSVVGPFFSTPGQNMKPAIRDPMQMLADGLGDLWENSVFTDCSLVVAGQEFRAHKAILAARSPVFRAMFEHE
MLENLTNRVEIHDIHLHVFKEMMGFIYTGKAPNLHNHSMATGLLAAADMYDLQDLKVMCEDALCRNLSVENAVSTLILADLHSTEHLKTKAMDFIILHASEVSETLAWKS
MVESHPHLVEEAFRSLDSIQCPFLEPSLKRRKII*
136 >lcl|XP_345242.1|Plus1complement(14225245..14226339) NW_047626 TDPOZ-T2-like RGD1562545 __SEG__ Chr2 {Rattus norvegicus} MSGDLEAKICSYTHISVQRFCYKWTISNFSFCMDGIRENITSPVFSLEGNEEVQWCLRIFPNGVDEESKDYLSVSVGLHSCQKSPVLAKVQVWIINAQGEKHQIKEIPNI
LSFSPKQQWGLSKFVLRDFLLSLRHWLLPEDQLILCCKVSIVGPSFSTPGHNMTPANKDPRQKLADDIGELWENSLFTDCSLVVAGQEFRAHKAILAARSPVFRAMIEHE
MLESLTNQVEIHDIHRQVFKEMMAFIYTGKAPHLHSHSMATDLLAAADMYDLQDLKVMCEDSLCSNLSVKNAIPTLILAALLSTVHLKTRVMDFIILHASEVSKTLEWKS
MVESHPHLVEEAFLSLASIQCFSSETSLKHLKIF*
137 >lcl|XP_345726.2|Plus1complement(31586497..31587099) NW_047762 RAP2B, member of RAS oncogene family-like RGD1565168 __SEG__ Chr6 {Rattus norvegicus} MEGLVLRPAKDYRVVLLGSVAVGKTALATQFACGRFPERCEPSVEELFSKVIEVNRAPALLEIVDTVGAEHLVTLKDLYIRNSDGFVVLYSVCNEASFQAVRPLRERMGR
LRGSRAVPLVLVGTKVDLDAERQVLTAQGRALAREWRCPFLEITAKSKMMVDRVFTQVVREMEALAPPGQEAPRIPANAPETWPAERFIG*
138 >lcl|XP_573089.1|Plus1complement(25770577..25772235) NW_047334 ankyrin repeat domain 43 Ankrd43 __SEG__ Chr10 {Rattus norvegicus} MALAAAAAAAAAAAGVSQAAVLGFLREHGGQVRNSELLSRFKPLLDAGDPRGRAARRDRFKKFVNNVAVVKELDGVKFVVLRKKPRPPEEPEAPLPSNPGVPDALAECAA
VPAEDSCAPGAPHSPQPLGEQPEDSSAPSEIQHTSETPPSGVTLVEAPSDSEPQAREPENPELPQSLEVASELARPASVPSGLVLSSTESPGPEPAPPTAQVPPKKPCML
PVRCVVPGPAALRIRAEEQGLRRQRSEEPSPRGSPMLLRRLSVEESGLGLHLGPGRSPHLRRLSRAGPRLLSPDMEEVPIAPPPPPAVPLEPTEHEWLVRTASGRWSHQL
HGLLLRDCGLAAKRDFMSGFTALHWAAKSGDREMALQLVEVARRGGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDYSGRRAYQYLRPGSSYALRRL
LGDPGLRSTTEPDAASGGSGSLVSRHPVQVAATILGSTTSAFLGVLADDLMLQDLARGLKKSSSFSKFLGASPMAPRKKTKIRGGLPSFTEISRRPTPGPLAGLVPSLPP
PT*
139 >lcl|XP_573095.1|Plus1complement(27887656..27888291) NW_047334 high mobility group box 1 RGD1563668 __SEG__ Chr10 {Rattus norvegicus} MGKGDPKKLRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYISPKGETKKKFKDPNAPKTPPSAFFLFCSEYR
PKIKGEHPGLSIGDVVKKLGEMWTNTAADDKQPYEKMAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEDEEDDDDE*
140 >lcl|XP_574154.2|Plus111472045..11473475 NW_047513 Methionyl aminopeptidase 2-like isoform 2 RGD1560341 __SEG__ Chr18 {Rattus norvegicus} MAGVEEASSFGGHLNGDLDPDDREEGTSSTAEEAAKKKRRKKKKGKGAVSAGQQELDKESGTSVDEVAKQLERQALEEKEKDDDDEDGDGDGDGAAGKKKKKKKRGPRVQ
TDPPSVPICDLYPNGVFPKGQECEYPPTQDGQTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKPIKENGLNAGLAFPTG
CSLNNCAAHYTPNAGDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDILLKAVKDATNTGIKCAGIDIRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHS
IGPYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVEHVPIRLPRTKHLLNVINENFDTLAFCRRWLDRLGESKYLMALKNLCDLGIVD
PYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY*
141 >lcl|XP_574368.1|Plus1complement(18898131..18899576) NW_047555 multiple inositol polyphosphate phosphatase 1-like RGD1564801 __SEG__ Chr1 {Rattus norvegicus} MLRGAHSHLSASVALAAVLAVALLSSFARCSLPGRGDPVASVLSPYFGTKTRYEDVNPWLLGDPVAPRRDPELLAGTCTPVQLVALIRHGTRYPTTKQIRKLRQLQGLLQ
TRESVDGGSRVAAALDQWPLWYDDWMDGQLVEKGRQDMRQLALRLAALFPDLFCQEKYGRLRLITSSKHHCVDSSAAFLQGLWQHYHPGLPPPDVSDMECDPPRVNDKLM
RFFDHCEKFLTEVERNATALYHVEAFKTGPEMQTVLKKVAATLQVPVNNLNADLIQVAFFTCSFDLAVQGVHSPWCDVFDVDDAKVLEYLNDLKQYWKRSYGYAINSRSS
CNLFQDIFLHLDKAVEQKQRSQPVSSPVILQFGHEETLLPLLSLMGYFKDKEPLTAYNFEEQVHREFRSGHIVPYASNLIFVLYHCEDAQTPQEKFQIQMLLNEKVLPLA
HSQKTVALYEDLKNHYQDILQSCQTSKECNLPKVNITSDEL*
142 >lcl|XP_575506.1|Plus19573849..9574493 NW_047693 high mobility group box 1 RGD1560584 __SEG__ Chr4 {Rattus norvegicus} MGKGYPKKPRGKMSSHAFFVQTCREEHKKKHLNASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNALKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWTNTAVDDKQPCEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEDEEEEEEENEDEEEEEDDDE*
143 >lcl|XP_575587.2|Plus1complement(13824130..13824810) NW_047694 camello-like 2 Cml2 __SEG__ Chr4 {Rattus norvegicus} MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSWLLATVYSFLFLLCLRLIFWVSCRNYVAKCLQADLADITKSYLNAHGSFWV
AESGGQVVGIVAALPVKEPPSGRKQLQLFRLSVSSQHRGQGIAKALVRIVLQFARDQGYTDVVLVTGNMQYSAMSLYQGMGFQKTGHYFVSIAKRLIGLSIFHFTYSLPS
VWEPRM*
144 >lcl|XP_575656.2|Plus1complement(9974136..9975854) NW_047696 cat eye syndrome chromosome region, candidate 6 homolog Cecr6 __SEG__ Chr4 {Rattus norvegicus} MHPALGHPRALSSAPASFPPPPAAARLQPLFLRGGSSRGRRGSGDSSTSTSTSRGGGGGRRGGGGGSPSSSTGAEREDDDESISISKPLVPAAAALPGPPAQGGVPASAT
APAAASSTSTPTSSCSMTAADFGAGAAAGTVGGPGSRSAAGAGGTGTGSAASCCSCCCCCCGRPSRSGRRGRRRGCSPSPGCRWGYQALSVVLLLAQGGLLDLYLIAVTD
LYWCSWIATDLVVVVGWAIFFAKNSRGRRGGPANSTHNHHQLHHHSAPPLHLSAAASAGAGAKARGGRGGSGGSGTGPGTAGAAGEFAFAYLAWLIYSIAFTPKVVLILG
TSILDLIELRAPFGTTGFRLTMALSVPLLYSLVRAISEAGAPPGSAGPLLLQPQQHRAAGCFLGTCLDLLDSFTLVELMLDGRVPLPAHLRYLLIAVYFLTLASPVLWLY
ELNTAVAAPSWGQASGPGSCSRLLRLLGGCLVDVPLLALRSLLVVSYQQPLSIFMLKNLFFLGCRGLEALEGCWDRGSWVSPSRARSSYGAPPSAPPPPPPPPPQGGSQR
GHLENEGGPHGYVNTLAVASQN*
145 >lcl|XP_576927.3|Plus1complement(934453..936003) NW_048035 pigpen-like RGD1566093 __SEG__ ChrX {Rattus norvegicus} MASNDYTQQATQSYGAYPTQPGQGYSQQSNQPYGQQSYSGYGQSADTSGYGQSSYGSSYEQTQNTGYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSST
SGSYGGSSQSSSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSRQWRWWRGGGGNYGQDQSSMSGGDGGGGYGNQYQSGGSGGGYGGGQQDRGGHGRG
GGGVYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSHHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNEKTGQPMINLYTDRETGKLKGEA
TVSFDDPPSAKTAIDWFDGKEFSGNLIKVSFATRRADFNRVNGRGGRGQGGPMGHGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRSECNQCKA
PKPDGPGGGPGGSHMGGNYGDDRHGRGGYDRGSYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPI*
146 >lcl|XP_577726.2|Plus1complement(1418780..1419850) NW_047554 zinc finger protein 160-like RGD1564848 __SEG__ Chr1 {Rattus norvegicus} MIDKNKKVKVIDFGLSTQFQPGKMLNHHCGTYSFGSPELLLGHRYDGPKNDMWIIGVVLYCMVVGKLPFDSVIIQELQRQVVAGVYPAPCGVSKELEDLLSKLLRVNLNF
RPTARKAMKHPWFKEHWNGLIGPYEEMLPLTPDPAILDAMKSIGFQASVVKHSLKQRKYNEEMATYFFLQKQALQGDGCTAQAQQVSSLAAPFPSLDPAAAFRLEPKRSG
SLPVLGTLRVSSSHGHVSHYGQNAHPKGGKRSTVAGRLRPLPMTPTQDHYHKCAVSVPCIQTTSIFTEKSSNKEIKEDNPLSNRAPLEDKPIPSRVRHRGFKGWTRNIAN
ALIKLCCCMPRRKKPRLGQNRISPQK*
147 >lcl|XP_578033.1|Plus113326739..13327833 NW_047626 TDPOZ-T2-like RGD1564915 __SEG__ Chr2 {Rattus norvegicus} MTGDLEAKICGFTHISVQNFSYEWTISNFSFCMDGIWKIITSPVFSLEANEEVQWCLRIYPNGVNEESKDYLSVSLGLLNCPKSPVLAKLQFWIINAQGEKHQITKNPNV
LRFPPNEQWGLRKFILRDFLLSHRHWLLPEEQLILCCKVSIVGPCFSRPGQNMTPAIKDPTQMLADDVGELWENSLFTDCSLVVGGQEFRAHKAIVAAHSPVFRAMFEHE
MQERLTNCIEIHDIHLQVFKEMMAFIYTGKAPHLHSHSMATGLLAAADMYDLQDLKDMCEDSLCRNLSVKNAVPTLILADLHSTKHLKTRAMDFIILHASEVSETLGWKS
MVESHPHLVEEAFRTLASIQCFSLEPSLKCQKIF*